KMC000003A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000003A_C01 KMC000003A_c01
acacaagcaatgactaagcacacataatgacataatatagattAGAGAAACAAAAACAAA
CAAAGTAATATAAATACTAAGTACTGAGAGATTTATATGCAGGAGTTAGGACCAAATTCA
GCAATATGTAAGTCAGAGATAATAAATAAGTCTGACCCATAAACATATATTCAGGTCATA
TAATCCAACCTCGAACAGCTCTTCTTCTACACATGTTCCCAATCCGATGCTAATCCATCC
GAGTAATAAGTAGGAACCTGAAGCTCGCGGGGCTGAACTTCATCATTGTCCTCCAGGTCC
ACATGAAACTCGTTCGAGATTGACTTGTCCACGAGCAGCGTAGGAACTGTTGAGATCAAC
ATTCATCCTCTTACCCTCTGAAGCATTTTCTGAAATGGATGAGTCATACATTCTTTGGCC
AGAAAATCCAACACCATCTGACAATTTCTCTTGTGAAGATACAGAGCTTGAATCTTCCGC
CCGGGACTTGAGAATGTGGAACCTAGCCACAACAGATGCCTCGTAATCATCAGCCTTGTT
TTCTGCAGGAACAGGAGAGTCCTGACAGAAAGTCCCGCAATGGACTTGGTTTGGATTATC
TCCTCCTTCAGGTGACAACTTGCCTGCTGAGTCTGATGG


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000003A_C01 KMC000003A_c01
         (639 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAK31196.1|AF349511_1 general amidase-B [Aspergillus fumigatus]     36  0.49
gb|ZP_00023022.1| hypothetical protein [Ralstonia metallidurans]       36  0.49
ref|XP_231276.1| similar to 5-AMP-activated protein kinase, gamm...    36  0.49
ref|NP_189200.1| hypothetical protein; protein id: At3g25720.1 [...    32  9.3
dbj|BAA97453.1| streptococcal hemagglutinin [Streptococcus gordo...    32  9.3

>gb|AAK31196.1|AF349511_1 general amidase-B [Aspergillus fumigatus]
          Length = 550

 Score = 35.8 bits (81), Expect = 0.49
 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = -1

Query: 561 DSPVPAENK-ADDYEASVVARFHILKSRAEDSSSVSSQEKLSDGVGFSGQRMYDSSISEN 385
           D+ +P+E + +DD+ ASV A  H++++     S + S ++L     FS   +      +N
Sbjct: 23  DAQIPSEWRLSDDFRASVPADGHLIEADIARRSGILSDKELDITENFSAVELL-----KN 77

Query: 384 ASEGKRMNVDLNSSYAARGQVNLERVSC 301
            +E K   VD+ +++  R  +  +  SC
Sbjct: 78  LAERKFSAVDVTTAFCKRAAIAQQLTSC 105

>gb|ZP_00023022.1| hypothetical protein [Ralstonia metallidurans]
          Length = 979

 Score = 35.8 bits (81), Expect = 0.49
 Identities = 29/99 (29%), Positives = 48/99 (48%)
 Frame = -1

Query: 564 QDSPVPAENKADDYEASVVARFHILKSRAEDSSSVSSQEKLSDGVGFSGQRMYDSSISEN 385
           QD+ VPA    D+ + S   R    K++A+  + V+SQ KL +    +  R+ D  + +N
Sbjct: 380 QDTTVPAAGPRDELKLSKADRGAQGKAQAQAEADVASQRKLKE----AESRVAD--LEKN 433

Query: 384 ASEGKRMNVDLNSSYAARGQVNLERVSCGPGGQ**SSAP 268
            S+ +R+    N+  A   Q N    +  P G+   SAP
Sbjct: 434 ISDMQRLMELKNAEIAKLNQANQAAKAPAPAGKAAESAP 472

>ref|XP_231276.1| similar to 5-AMP-activated protein kinase, gamma-2 subunit (AMPK
           gamma-2 chain) (AMPK gamma2) (H91620p) [Rattus
           norvegicus]
          Length = 628

 Score = 35.8 bits (81), Expect = 0.49
 Identities = 31/86 (36%), Positives = 39/86 (45%), Gaps = 1/86 (1%)
 Frame = +2

Query: 239 PSNK*EPEARGAELHHCPPGPHETRSRLTCPRAA*ELLRSTFILLPSEAFSEMDESYILW 418
           P ++  P AR      CPP P+       C RA+ E LR    ++ SEAFSE   S +L 
Sbjct: 218 PRSRERPPARSKGRPFCPPHPNSRE----CQRASGETLRGFREIIRSEAFSENPWSVLL- 272

Query: 419 PENPTPSDNFSC-EDTELESSARDLR 493
               T   N+S   D  LE S   LR
Sbjct: 273 ---VTRQSNWSAVSDQFLEVSVARLR 295

>ref|NP_189200.1| hypothetical protein; protein id: At3g25720.1 [Arabidopsis
           thaliana]
          Length = 282

 Score = 31.6 bits (70), Expect = 9.3
 Identities = 11/27 (40%), Positives = 16/27 (58%)
 Frame = -3

Query: 331 WTSQSRTSFMWTWRTMMKFSPASFRFL 251
           WTSQ   S  W W+ +++  P + RFL
Sbjct: 76  WTSQELVSDSWNWKCLLRLRPLAERFL 102

>dbj|BAA97453.1| streptococcal hemagglutinin [Streptococcus gordonii]
          Length = 2178

 Score = 31.6 bits (70), Expect = 9.3
 Identities = 27/101 (26%), Positives = 40/101 (38%)
 Frame = -1

Query: 636  SDSAGKLSPEGGDNPNQVHCGTFCQDSPVPAENKADDYEASVVARFHILKSRAEDSSSVS 457
            S SA   + E       V   T    S   + +++    ASV A        A  SSSVS
Sbjct: 1066 STSASVSASESASTSASVSASTSASTSASVSASESSSTSASVSA-----SESASTSSSVS 1120

Query: 456  SQEKLSDGVGFSGQRMYDSSISENASEGKRMNVDLNSSYAA 334
            + E  S     S      +S S +ASE    +  +++S +A
Sbjct: 1121 ASESASTSASVSASESASTSASVSASESASTSASVSASESA 1161

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 538,934,110
Number of Sequences: 1393205
Number of extensions: 11759598
Number of successful extensions: 47767
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 46330
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47596
length of database: 448,689,247
effective HSP length: 118
effective length of database: 284,291,057
effective search space used: 26723359358
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 MPDL080c08_f AV780647 1 530
2 GNLf002h03 BP074930 36 390
3 MPDL056h04_f AV779360 44 594
4 MR019e02_f BP077438 68 429
5 MPDL077d02_f AV780465 69 660
6 MRL010g03_f BP084224 72 472
7 MFL004g11_f BP033606 73 618
8 GENLf036c06 BP064226 108 597
9 GENLf001b01 BP062411 160 553




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research