KMC000002A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000002A_C01 KMC000002A_c01
cctcATATCTAGAATAATTTACATCATCAGTGAAGCTAAAGATCAGTGCATATGAATTAC
TTTTTACAAATAAAATAAAATTGTACATACTAAAATATTCTAGTTTTCCACCTCCATAGC
AAAGCCCATCAATAAATCGGGGCTACAAAGCTAACCACACTTTGGAACCATTTCCAAATC
TAAAACTAAATCCAATCTCTATGACCTTGTGCTCTAGCTTTTGGTGCCAAAGCAAACAGT
GTTCCTGAACTCGGCTACTTTTCCTTAAGGCCACCATTTTTTCTTGGTAACCTGATGCTG
CAATGAGATATAACAAACCCATTAATCAATTTCTCCTTCTTCTACGTCATCTGTTGGCCC
TGCTTCATTCTTAGGAGGTTCTTCTTCCTCATCCTCATCATCCACCTTCATGTACAACCC
TAGCTGTTCTAATGGATTAAAACTACCCTGTCGTTTGAAAGAACCCAGTCCATTTTGAGG
ACGATCTGGGCTTGACTCTTCAGCGAAACTTATTAAAGGTTCATCTTGTACACCACTCAG
CATCTCTAGATCTTCCAAGAATTGACTGGTCTCATTGATATCTACAGTCTTCTCCATCTT


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000002A_C01 KMC000002A_c01
         (600 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB02121.1| gb|AAF01563.1~gene_id:K17E12.8~similar to unknow...    99  4e-20
ref|NP_189362.1| unknown protein; protein id: At3g27260.1 [Arabi...    99  4e-20
ref|NP_568297.1| kinase - like protein; protein id: At5g14270.1,...    84  1e-15
ref|NP_201137.1| putative protein; protein id: At5g63320.1 [Arab...    82  4e-15
dbj|BAB41205.1| kinase-like protein [Oryza sativa]                     82  5e-15

>dbj|BAB02121.1| gb|AAF01563.1~gene_id:K17E12.8~similar to unknown protein
           [Arabidopsis thaliana]
          Length = 818

 Score = 99.0 bits (245), Expect = 4e-20
 Identities = 52/76 (68%), Positives = 60/76 (78%)
 Frame = -1

Query: 600 KMEKTVDINETSQFLEDLEMLSGVQDEPLISFAEESSPDRPQNGLGSFKRQGSFNPLEQL 421
           KMEKTV+INE S+FLEDLEMLS    E L S AEE+SP+RP + LGSF  +GS NPLEQL
Sbjct: 634 KMEKTVEINENSRFLEDLEMLSSSAPEQLPSSAEETSPERPLDALGSFNLRGS-NPLEQL 692

Query: 420 GLYMKVDDEDEEEEPP 373
           GLYMK DD++EE E P
Sbjct: 693 GLYMKQDDDEEEPEAP 708

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 35/67 (52%), Positives = 45/67 (66%)
 Frame = -1

Query: 525 DEPLISFAEESSPDRPQNGLGSFKRQGSFNPLEQLGLYMKVDDEDEEEEPPKNEAGPTDD 346
           + P++    E+S +RP +  GSF  +GS NPLEQLGLYMK DD++EE E P       +D
Sbjct: 754 EAPVVPKPNETSLERPVDAFGSFNLKGS-NPLEQLGLYMKQDDDEEEPEAPA-VPNLAND 811

Query: 345 VEEGEID 325
           VEEGEID
Sbjct: 812 VEEGEID 818

>ref|NP_189362.1| unknown protein; protein id: At3g27260.1 [Arabidopsis thaliana]
          Length = 813

 Score = 99.0 bits (245), Expect = 4e-20
 Identities = 52/76 (68%), Positives = 60/76 (78%)
 Frame = -1

Query: 600 KMEKTVDINETSQFLEDLEMLSGVQDEPLISFAEESSPDRPQNGLGSFKRQGSFNPLEQL 421
           KMEKTV+INE S+FLEDLEMLS    E L S AEE+SP+RP + LGSF  +GS NPLEQL
Sbjct: 629 KMEKTVEINENSRFLEDLEMLSSSAPEQLPSSAEETSPERPLDALGSFNLRGS-NPLEQL 687

Query: 420 GLYMKVDDEDEEEEPP 373
           GLYMK DD++EE E P
Sbjct: 688 GLYMKQDDDEEEPEAP 703

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 35/67 (52%), Positives = 45/67 (66%)
 Frame = -1

Query: 525 DEPLISFAEESSPDRPQNGLGSFKRQGSFNPLEQLGLYMKVDDEDEEEEPPKNEAGPTDD 346
           + P++    E+S +RP +  GSF  +GS NPLEQLGLYMK DD++EE E P       +D
Sbjct: 749 EAPVVPKPNETSLERPVDAFGSFNLKGS-NPLEQLGLYMKQDDDEEEPEAPA-VPNLAND 806

Query: 345 VEEGEID 325
           VEEGEID
Sbjct: 807 VEEGEID 813

>ref|NP_568297.1| kinase - like protein; protein id: At5g14270.1, supported by cDNA:
           gi_16604680 [Arabidopsis thaliana]
           gi|16604681|gb|AAL24133.1| putative kinase [Arabidopsis
           thaliana]
          Length = 688

 Score = 84.3 bits (207), Expect = 1e-15
 Identities = 49/92 (53%), Positives = 61/92 (66%)
 Frame = -1

Query: 600 KMEKTVDINETSQFLEDLEMLSGVQDEPLISFAEESSPDRPQNGLGSFKRQGSFNPLEQL 421
           +ME++V++NE ++FLEDLE+L  V  + L +  EE   D P  GL SF   GS NPLEQL
Sbjct: 601 EMEQSVELNENAKFLEDLELLKTVDTDHLTNTIEEE--DGPDVGLRSFSFGGS-NPLEQL 657

Query: 420 GLYMKVDDEDEEEEPPKNEAGPTDDVEEGEID 325
           GL+MK  DEDEEE  P     P  D+EEGEID
Sbjct: 658 GLFMK-QDEDEEEADPLTSPAPEIDIEEGEID 688

>ref|NP_201137.1| putative protein; protein id: At5g63320.1 [Arabidopsis thaliana]
           gi|10177440|dbj|BAB10736.1|
           gb|AAC55944.1~gene_id:K9H21.2~similar to unknown protein
           [Arabidopsis thaliana]
          Length = 569

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 51/100 (51%), Positives = 66/100 (66%), Gaps = 10/100 (10%)
 Frame = -1

Query: 600 KMEKTVDINETSQFLEDLEML--SGVQDEPLISFAEESSPDRPQN--GLGSFKRQGSFNP 433
           KMEKTV+INE  +F+EDL+ML  +G + + L +  E  SP   ++  GLGSFK + + NP
Sbjct: 156 KMEKTVEINEGIRFMEDLQMLRATGTEGDQLPTSMEVMSPKFSEDMLGLGSFKMESNSNP 215

Query: 432 LEQLGLYMKVD-DEDEEEEPP-----KNEAGPTDDVEEGE 331
           LE LGLYMK+D DEDEEE+PP     K E  P D  E+ E
Sbjct: 216 LEHLGLYMKMDEDEDEEEDPPHFSQRKVEDNPFDRSEKQE 255

>dbj|BAB41205.1| kinase-like protein [Oryza sativa]
          Length = 714

 Score = 82.0 bits (201), Expect = 5e-15
 Identities = 46/92 (50%), Positives = 64/92 (69%)
 Frame = -1

Query: 600 KMEKTVDINETSQFLEDLEMLSGVQDEPLISFAEESSPDRPQNGLGSFKRQGSFNPLEQL 421
           +ME+TV+IN+    L+DLEML     E ++S  +E+SP+  Q+G+ SF   GS NPLEQL
Sbjct: 627 EMERTVEINDNLH-LKDLEMLGTATTEHIVSSVDETSPEHSQDGMPSFL-PGSGNPLEQL 684

Query: 420 GLYMKVDDEDEEEEPPKNEAGPTDDVEEGEID 325
           GL+MK D+E+EEE+P  +    T D EEGEI+
Sbjct: 685 GLFMKADEEEEEEDP--SCVPSTKDAEEGEIN 714

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 491,022,171
Number of Sequences: 1393205
Number of extensions: 10907217
Number of successful extensions: 53562
Number of sequences better than 10.0: 77
Number of HSP's better than 10.0 without gapping: 35052
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46724
length of database: 448,689,247
effective HSP length: 117
effective length of database: 285,684,262
effective search space used: 23426109484
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 SPDL028c01_f BP053721 1 526
2 GENLf001a12 BP062410 5 418
3 GENLf012f08 BP062986 7 601
4 MPDL033a01_f AV778107 8 540
5 SPDL032f10_f BP054009 8 201
6 SPDL032d06_f BP053993 36 541
7 MRL007g01_f BP084068 47 412
8 MRL006f04_f BP084022 49 255
9 GENLf091h03 BP067342 75 562




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research