KMC000001A_c03
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KMC000001A_C03 KMC000001A_c03
atcaCTTAACTAGCGGAAATTATTAAAACTTCCAAATAATTATACATGAACGATTCCAAT
GTCAATCGAAGAAGAAATATATGTACAAATTACATTACAACAAACGAAGCAGTCCTGTAC
AATGTGAAAGTTGGTATGGCAAAATGGCCATCAATTACGGCCAGGTATTGTCGATATCCG
TTGACACTAACGGACATTAGTACTTACATCGAGATTAAAAAAGTGAACAAAATTCTTCTA
TGGATTGAGATGAAAGTCTGTTCACTATGATATCCAAACACACTATTTCGGAACTGTTAT
TTACACCAATTTTCACACTTCCCACAGTTACTGCACTTCAAGTTTTTCACACAGCTTGGA
TTCTGGATAATTACTCCCCTTTCTAAAACTTTTAATAGTCATAATAAACTAATAACTATA
CAGAGTATCCTCTTGTTTCAGATTTTTTTCCCATGTGTTTAATCGTCACAAGTCCTTTCT
CTCCCACCCTATCTTTCGCACTTCCTTTAGATTGTCTATCAGTTTTGTTAACTAATGATA
TACTTGAGGAGATACATAAAACTCACTCTCGATAACAGCTGGTCTGAGATCTTCATCACG
CATGAACTCCAAAGGGAAAGAAACAAGGTGTCCTTTTACATGCTTCAATCTATCTACCGG
GTCTA


Nr search

BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KMC000001A_C03 KMC000001A_c03
         (665 letters)

Database: nr 
           1,393,205 sequences; 448,689,247 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_188302.2| phospholipase D zeta1 (5' fragment); protein id...    70  3e-11
dbj|BAB92819.1| putative phospholipase D-like protein [Oryza sat...    65  6e-10
ref|NP_187214.1| phospholipase D family; protein id: At3g05630.1...    53  4e-06
gb|AAO21120.1| phospholipase D2 [Homo sapiens]                         39  0.063
dbj|BAA19882.1| phospholipase D [Rattus norvegicus]                    38  0.11

>ref|NP_188302.2| phospholipase D zeta1 (5' fragment); protein id: At3g16785.1
            [Arabidopsis thaliana] gi|20139230|sp|Q9LRZ5|PDP1_ARATH
            Phospholipase D p1 (AtPLDp1) (Phospholipase D1 PHOX and
            PX containing domain) (Phospholipase D zeta 1) (PLDzeta1)
            gi|15723315|gb|AAL06337.1|AF411833_1 phospholipase D
            zeta1 [Arabidopsis thaliana]
          Length = 1096

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 31/43 (72%), Positives = 36/43 (83%)
 Frame = -3

Query: 663  DPVDRLKHVKGHLVSFPLEFMRDEDLRPAVIESEFYVSPQVYH 535
            DP+DRLK +KGHLVSFPL+FM  EDLRP   ESE+Y SPQV+H
Sbjct: 1054 DPMDRLKAIKGHLVSFPLDFMCKEDLRPVFNESEYYASPQVFH 1096

>dbj|BAB92819.1| putative phospholipase D-like protein [Oryza sativa (japonica
            cultivar-group)] gi|21328113|dbj|BAC00694.1| putative
            phospholipase D-like protein [Oryza sativa (japonica
            cultivar-group)]
          Length = 1115

 Score = 65.5 bits (158), Expect = 6e-10
 Identities = 29/43 (67%), Positives = 36/43 (83%)
 Frame = -3

Query: 663  DPVDRLKHVKGHLVSFPLEFMRDEDLRPAVIESEFYVSPQVYH 535
            DP+++L+ V+GHLVSFPLEFM  EDLRP   ESE+Y SPQV+H
Sbjct: 1073 DPMEKLQAVRGHLVSFPLEFMCQEDLRPFFGESEYYTSPQVFH 1115

>ref|NP_187214.1| phospholipase D family; protein id: At3g05630.1 [Arabidopsis
            thaliana] gi|20139231|sp|Q9M9W8|PDP2_ARATH Phospholipase
            D p2 (AtPLDp2) (Phospholipase D2 PHOX and PX containing
            domain) (Phospholipase D zeta 2) (PLDzeta2)
            gi|6714447|gb|AAF26134.1|AC011620_10 putative
            phospholipase D [Arabidopsis thaliana]
          Length = 1039

 Score = 52.8 bits (125), Expect = 4e-06
 Identities = 26/44 (59%), Positives = 32/44 (72%), Gaps = 1/44 (2%)
 Frame = -3

Query: 663  DPVDRLKHVKGHLVSFPLEFMRD-EDLRPAVIESEFYVSPQVYH 535
            D  + LK  +G+LV FPL+FM D EDLRP   ESEFY +PQV+H
Sbjct: 996  DSWEILKETRGNLVCFPLQFMCDQEDLRPGFNESEFYTAPQVFH 1039

>gb|AAO21120.1| phospholipase D2 [Homo sapiens]
          Length = 630

 Score = 38.9 bits (89), Expect = 0.063
 Identities = 17/37 (45%), Positives = 24/37 (63%)
 Frame = -3

Query: 648 LKHVKGHLVSFPLEFMRDEDLRPAVIESEFYVSPQVY 538
           L  V+GHLV FPL+F+ DE L P +   E  + P+V+
Sbjct: 593 LTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPPEVW 629

>dbj|BAA19882.1| phospholipase D [Rattus norvegicus]
          Length = 933

 Score = 38.1 bits (87), Expect = 0.11
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = -3

Query: 648  LKHVKGHLVSFPLEFMRDEDLRPAVIESEFYVSPQVY 538
            L H++GHLV FPL+F+ DE L P +   E  +  +V+
Sbjct: 896  LAHIRGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVW 932

  Database: nr
    Posted date:  Apr 1, 2003  2:05 AM
  Number of letters in database: 448,689,247
  Number of sequences in database:  1,393,205
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 538,249,782
Number of Sequences: 1393205
Number of extensions: 11055336
Number of successful extensions: 29571
Number of sequences better than 10.0: 29
Number of HSP's better than 10.0 without gapping: 27885
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29557
length of database: 448,689,247
effective HSP length: 119
effective length of database: 282,897,852
effective search space used: 28855580904
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 GENLf027d03 BP063767 1 566
2 GENLf066e02 BP065914 5 390
3 GENLf001a04 BP062408 49 550
4 GENLf066f04 BP065921 66 614
5 GENLf024a01 BP063578 67 515
6 GENLf015g04 BP063169 71 622
7 GENLf047b09 BP064822 72 570
8 GENLf081c07 BP066744 76 589
9 GENLf025e09 BP063657 89 592
10 GENLf045e05 BP064722 119 368
11 GENLf085d11 BP066977 144 586
12 GENLf003f08 BP062526 147 673




Lotus japonicus
Kazusa DNA Research Institute
Department of Plant Gene Research