AV426994 ( MWM075g04_r )

[UP]


[1][TOP]
>UniRef100_Q2YHP5 Proline-rich protein (Fragment) n=1 Tax=Phaseolus vulgaris
           RepID=Q2YHP5_PHAVU
          Length = 264

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 31  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 90

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 91  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 150

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 151 VEKPPVYKPPVEKPPVYKPP 170

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 41  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 100

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 101 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 160

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 161 VEKPPVYKPPVEKPPVYKPP 180

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 51  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 110

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 111 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 170

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 171 VEKPPVYKPPVEKPPVYKPP 190

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 61  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 120

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 121 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 181 VEKPPVYKPPVEKPPVYKPP 200

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 71  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 130

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 131 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 190

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 191 VEKPPVYKPPVEKPPVYKPP 210

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 81  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 140

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 141 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 200

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 201 VEKPPVYKPPVEKPPVYKPP 220

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 91  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 150

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 151 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 210

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 211 VEKPPVYKPPVEKPPVYKPP 230

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 101 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 160

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 161 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 220

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 221 VEKPPVYKPPVEKPPVYKPP 240

 Score =  293 bits (751), Expect = 3e-78
 Identities = 131/140 (93%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 111 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 170

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 171 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 230

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVY+PP
Sbjct: 231 VEKPPVYKPPVEKPPVYQPP 250

 Score =  289 bits (739), Expect = 8e-77
 Identities = 127/134 (94%), Positives = 129/134 (96%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           +KPPV KPPV KPP   PP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV
Sbjct: 27  DKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 86

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV
Sbjct: 87  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 146

Query: 368 YKPPVEKPPVYKPP 409
           YKPPVEKPPVYKPP
Sbjct: 147 YKPPVEKPPVYKPP 160

 Score =  278 bits (712), Expect = 1e-73
 Identities = 126/140 (90%), Positives = 128/140 (91%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 121 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 240

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVY+PP  KPP  K P
Sbjct: 241 VEKPPVYQPPYGKPPHPKYP 260

[2][TOP]
>UniRef100_Q40375 Repetitive proline-rich cell wall protein 2 n=1 Tax=Medicago
           truncatula RepID=PRP2_MEDTR
          Length = 371

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 39  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 98

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 99  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 158

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 159 VEKPPVYKPPVEKPPVYKPP 178

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 49  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 108

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 109 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 168

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 169 VEKPPVYKPPVEKPPVYKPP 188

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 59  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 118

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 119 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 178

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 179 VEKPPVYKPPVEKPPVYKPP 198

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 69  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 128

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 129 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 188

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 189 VEKPPVYKPPVEKPPVYKPP 208

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 79  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 138

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 139 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 198

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 199 VEKPPVYKPPVEKPPVYKPP 218

 Score =  295 bits (755), Expect = 1e-78
 Identities = 132/140 (94%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 89  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 148

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 149 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 208

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 209 VEKPPVYKPPVEKPPVYKPP 228

 Score =  295 bits (754), Expect = 1e-78
 Identities = 131/140 (93%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 99  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 158

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 159 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 218

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPP+YKPP
Sbjct: 219 VEKPPVYKPPVEKPPIYKPP 238

 Score =  295 bits (754), Expect = 1e-78
 Identities = 131/140 (93%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 109 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 168

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 169 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 228

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPP+YKPPVEKPPVYKPP
Sbjct: 229 VEKPPIYKPPVEKPPVYKPP 248

 Score =  295 bits (754), Expect = 1e-78
 Identities = 131/140 (93%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 119 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 178

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPP
Sbjct: 179 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPP 238

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 239 VEKPPVYKPPVEKPPVYKPP 258

 Score =  294 bits (753), Expect = 2e-78
 Identities = 130/140 (92%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 129 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 188

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP
Sbjct: 189 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPP 248

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPP+YKPP
Sbjct: 249 VEKPPVYKPPVEKPPIYKPP 268

 Score =  294 bits (753), Expect = 2e-78
 Identities = 130/140 (92%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 139 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 198

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 199 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPP 258

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPP+YKPPVEKPPVYKPP
Sbjct: 259 VEKPPIYKPPVEKPPVYKPP 278

 Score =  294 bits (753), Expect = 2e-78
 Identities = 130/140 (92%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 149 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 208

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPP
Sbjct: 209 VEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPP 268

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 269 VEKPPVYKPPVEKPPVYKPP 288

 Score =  294 bits (753), Expect = 2e-78
 Identities = 130/140 (92%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 159 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 218

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP
Sbjct: 219 VEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPP 278

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 279 VEKPPVYKPPVEKPPVYKPP 298

 Score =  294 bits (753), Expect = 2e-78
 Identities = 130/140 (92%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 169 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 228

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 229 VEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPP 288

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 289 VEKPPVYKPPVEKPPVYKPP 308

 Score =  294 bits (753), Expect = 2e-78
 Identities = 130/140 (92%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPP
Sbjct: 179 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPP 238

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 239 VEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 298

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 299 VEKPPVYKPPVEKPPVYKPP 318

 Score =  291 bits (746), Expect = 1e-77
 Identities = 129/140 (92%), Positives = 132/140 (94%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP
Sbjct: 189 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPP 248

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 249 VEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 308

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPV KPPVYKPP
Sbjct: 309 VEKPPVYKPPVYKPPVYKPP 328

 Score =  291 bits (746), Expect = 1e-77
 Identities = 129/140 (92%), Positives = 132/140 (94%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 199 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPP 258

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 259 VEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 318

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPVYKPPVEKPPVYKPP
Sbjct: 319 VYKPPVYKPPVEKPPVYKPP 338

 Score =  291 bits (744), Expect = 2e-77
 Identities = 127/134 (94%), Positives = 130/134 (97%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           +KPPVY+PPV KPP   PP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV
Sbjct: 25  DKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 84

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV
Sbjct: 85  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 144

Query: 368 YKPPVEKPPVYKPP 409
           YKPPVEKPPVYKPP
Sbjct: 145 YKPPVEKPPVYKPP 158

 Score =  291 bits (744), Expect = 2e-77
 Identities = 130/140 (92%), Positives = 132/140 (94%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           V +PPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 29  VYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 88

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 89  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 148

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 149 VEKPPVYKPPVEKPPVYKPP 168

 Score =  286 bits (732), Expect = 5e-76
 Identities = 129/140 (92%), Positives = 130/140 (92%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPP-----IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP     IYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPP
Sbjct: 209 VEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPP 268

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPP
Sbjct: 269 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPP 328

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPV KPPV KPP
Sbjct: 329 VEKPPVYKPPVYKPPVEKPP 348

 Score =  283 bits (723), Expect = 6e-75
 Identities = 127/140 (90%), Positives = 129/140 (92%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP
Sbjct: 219 VEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPP 278

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPVEKPPVYKPP
Sbjct: 279 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEKPPVYKPP 338

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPV KPPV KPPVYKPP
Sbjct: 339 VYKPPVEKPPVYKPPVYKPP 358

 Score =  280 bits (716), Expect = 4e-74
 Identities = 125/140 (89%), Positives = 128/140 (91%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPP+YKPPVEKPP Y PP+     YKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 229 VEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPP 288

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPP
Sbjct: 289 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP 348

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPVYKPPVEKPPVY PP
Sbjct: 349 VYKPPVYKPPVEKPPVYGPP 368

[3][TOP]
>UniRef100_P13993 Repetitive proline-rich cell wall protein 2 n=2 Tax=Glycine max
           RepID=PRP2_SOYBN
          Length = 230

 Score =  295 bits (754), Expect = 1e-78
 Identities = 131/140 (93%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 64  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 123

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 124 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 183

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPP+YKPP
Sbjct: 184 VEKPPVYKPPVEKPPIYKPP 203

 Score =  295 bits (754), Expect = 1e-78
 Identities = 131/140 (93%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 74  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 133

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 134 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 193

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPP+YKPPVEKPPVYKPP
Sbjct: 194 VEKPPIYKPPVEKPPVYKPP 213

 Score =  294 bits (753), Expect = 2e-78
 Identities = 132/139 (94%), Positives = 132/139 (94%), Gaps = 5/139 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEY-----TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           EKPPVYKPPVEKPP Y      PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 35  EKPPVYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 94

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 95  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 154

Query: 353 EKPPVYKPPVEKPPVYKPP 409
           EKPPVYKPPVEKPPVYKPP
Sbjct: 155 EKPPVYKPPVEKPPVYKPP 173

 Score =  293 bits (749), Expect = 5e-78
 Identities = 131/140 (93%), Positives = 132/140 (94%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVE PP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 44  VEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 103

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 104 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 163

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 164 VEKPPVYKPPVEKPPVYKPP 183

 Score =  293 bits (749), Expect = 5e-78
 Identities = 130/140 (92%), Positives = 132/140 (94%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VE PP+YKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 54  VENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 113

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 114 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 173

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 174 VEKPPVYKPPVEKPPVYKPP 193

 Score =  288 bits (736), Expect = 2e-76
 Identities = 127/139 (91%), Positives = 129/139 (92%), Gaps = 5/139 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E PPVYKPP EKPP Y PP+     YKPPVE PP+YKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 25  ENPPVYKPPTEKPPVYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPV 84

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 85  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 144

Query: 353 EKPPVYKPPVEKPPVYKPP 409
           EKPPVYKPPVEKPPVYKPP
Sbjct: 145 EKPPVYKPPVEKPPVYKPP 163

 Score =  280 bits (717), Expect = 3e-74
 Identities = 126/140 (90%), Positives = 128/140 (91%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 84  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 143

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPP
Sbjct: 144 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPP 203

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPP  KPP  K P
Sbjct: 204 VEKPPVYKPPYGKPPYPKYP 223

[4][TOP]
>UniRef100_Q43414 Proline rich protein (Fragment) n=1 Tax=Cicer arietinum
           RepID=Q43414_CICAR
          Length = 227

 Score =  293 bits (751), Expect = 3e-78
 Identities = 128/140 (91%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPP+EKPP Y PP+     YKPPVEKPPVYKPP+EKPPVYKPPVEKPP+YKPP
Sbjct: 7   VEKPPVYKPPIEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPP 66

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 67  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 126

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPP+YKPP
Sbjct: 127 VEKPPVYKPPVEKPPIYKPP 146

 Score =  293 bits (751), Expect = 3e-78
 Identities = 128/140 (91%), Positives = 133/140 (95%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           +EKPPVYKPPVEKPP Y PP+     YKPP+EKPPVYKPPVEKPP+YKPPVEKPPVYKPP
Sbjct: 17  IEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPP 76

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 77  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 136

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPP+YKPPVEKPPVYKPP
Sbjct: 137 VEKPPIYKPPVEKPPVYKPP 156

 Score =  292 bits (747), Expect = 9e-78
 Identities = 129/140 (92%), Positives = 132/140 (94%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PPI     YKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 27  VEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPP 86

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPP
Sbjct: 87  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPP 146

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPP+EKPPVY PP
Sbjct: 147 VEKPPVYKPPIEKPPVYTPP 166

 Score =  292 bits (747), Expect = 9e-78
 Identities = 129/140 (92%), Positives = 132/140 (94%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPP-----IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPP+EKPP Y PP     IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 37  VEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 96

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP
Sbjct: 97  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPP 156

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           +EKPPVY PPVEKPPVYKPP
Sbjct: 157 IEKPPVYTPPVEKPPVYKPP 176

 Score =  289 bits (740), Expect = 6e-77
 Identities = 126/140 (90%), Positives = 132/140 (94%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           +EKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 47  IEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 106

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP+EKPPVY PP
Sbjct: 107 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPP 166

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPP+E+PPVYKPP
Sbjct: 167 VEKPPVYKPPIEEPPVYKPP 186

 Score =  288 bits (736), Expect = 2e-76
 Identities = 126/135 (93%), Positives = 129/135 (95%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPV KPPV KPP   PP+YKPPVEKPPVYKPPVEKPPVYKPP+EKPPVYKPPVEKPP
Sbjct: 2   VYKPPVEKPPVYKPPIEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPP 61

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           +YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 62  IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 121

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPVEKPPVYKPP
Sbjct: 122 VYKPPVEKPPVYKPP 136

 Score =  287 bits (734), Expect = 3e-76
 Identities = 125/140 (89%), Positives = 131/140 (93%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPP+YKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 57  VEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 116

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP+EKPPVY PPVEKPPVYKPP
Sbjct: 117 VEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPPVYKPP 176

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           +E+PPVYKPPVEKPPVY PP
Sbjct: 177 IEEPPVYKPPVEKPPVYGPP 196

 Score =  276 bits (705), Expect = 7e-73
 Identities = 124/147 (84%), Positives = 129/147 (87%), Gaps = 12/147 (8%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 67  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 126

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPP+YKPPVEKPPVYKPP+EKPPVY PPVEKPPVYKPP+E+PPVYKPP
Sbjct: 127 VEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPPVYKPPIEEPPVYKPP 186

Query: 350 VEKPPVYKPPVEKPPVY-------KPP 409
           VEKPPVY PP EKPP Y       KPP
Sbjct: 187 VEKPPVYGPPYEKPPHYPGYPPYEKPP 213

 Score =  256 bits (653), Expect = 7e-67
 Identities = 117/136 (86%), Positives = 121/136 (88%), Gaps = 5/136 (3%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKP 181
           PVYKPPVEKPP     +YKPP+EKPPVYKP          PVYKPPVEKPPVYKPP+EKP
Sbjct: 1   PVYKPPVEKPP-----VYKPPIEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPIEKP 50

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP
Sbjct: 51  PVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 110

Query: 362 PVYKPPVEKPPVYKPP 409
           PVYKPPVEKPPVYKPP
Sbjct: 111 PVYKPPVEKPPVYKPP 126

[5][TOP]
>UniRef100_Q9SC42 Proline-rich protein n=1 Tax=Pisum sativum RepID=Q9SC42_PEA
          Length = 214

 Score =  290 bits (741), Expect = 5e-77
 Identities = 124/135 (91%), Positives = 128/135 (94%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE PP+YKPPVEKPP Y PP+YKPPVEKPPVYKPPVEKPPVYKPPV+KPPVYKPPVEKPP
Sbjct: 33  VETPPIYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVKKPPVYKPPVEKPP 92

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPVEKPP YKPPVEKPPVYKPPVEKPP YKPPVE+PPVYKPPVEKPP YKPPVEKPP
Sbjct: 93  VYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPPTYKPPVEKPP 152

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPVEKPP YKPP
Sbjct: 153 VYKPPVEKPPTYKPP 167

 Score =  285 bits (728), Expect = 1e-75
 Identities = 123/135 (91%), Positives = 126/135 (93%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPVYKPPV KPP   PP+YKPPVEKPPVYKPPV+KPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 43  VEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVKKPPVYKPPVEKPPVYKPPVEKPP 102

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            YKPPVEKPPVYKPPVEKPP YKPPVE+PPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP
Sbjct: 103 TYKPPVEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPP 162

Query: 365 VYKPPVEKPPVYKPP 409
            YKPPVEKPP YKPP
Sbjct: 163 TYKPPVEKPPAYKPP 177

 Score =  282 bits (722), Expect = 7e-75
 Identities = 122/134 (91%), Positives = 126/134 (94%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           EKPPVY+PPVE PP Y PP+ KPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV+KPPV
Sbjct: 24  EKPPVYRPPVETPPIYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVKKPPV 83

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           YKPPVEKPPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP YKPPVE+PPVYKPPVEKPP 
Sbjct: 84  YKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPPT 143

Query: 368 YKPPVEKPPVYKPP 409
           YKPPVEKPPVYKPP
Sbjct: 144 YKPPVEKPPVYKPP 157

 Score =  282 bits (721), Expect = 9e-75
 Identities = 124/140 (88%), Positives = 127/140 (90%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           V KPPVYKPPVEKPP Y PP+     YKPPV+KPPVYKPPVEKPPVYKPPVEKPP YKPP
Sbjct: 48  VYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVKKPPVYKPPVEKPPVYKPPVEKPPTYKPP 107

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPP YKPPVE+PPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP YKPP
Sbjct: 108 VEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPP 167

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPP YKPPVEKPPVYKPP
Sbjct: 168 VEKPPAYKPPVEKPPVYKPP 187

 Score =  257 bits (656), Expect = 3e-67
 Identities = 113/126 (89%), Positives = 116/126 (92%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPVYKPPV+K     PP+YKPPVEKPPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP
Sbjct: 68  VEKPPVYKPPVKK-----PPVYKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPP 122

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            YKPPVE+PPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP YKPPVEKPP YKPPVEKPP
Sbjct: 123 TYKPPVERPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVEKPPAYKPPVEKPP 182

Query: 365 VYKPPV 382
           VYKPPV
Sbjct: 183 VYKPPV 188

[6][TOP]
>UniRef100_Q40358 Repetitive proline-rich cell wall protein n=1 Tax=Medicago sativa
           RepID=PRP_MEDSA
          Length = 236

 Score =  279 bits (713), Expect = 8e-74
 Identities = 124/135 (91%), Positives = 125/135 (92%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPVYKPPVEKPP Y PP+YKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 39  VEKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPP 98

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 99  VYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPP 158

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPV KPPVYKPP
Sbjct: 159 VYKPPVYKPPVYKPP 173

 Score =  271 bits (693), Expect = 2e-71
 Identities = 121/135 (89%), Positives = 123/135 (91%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V +PPVYKPPVEKPP Y PP+ KPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 29  VYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPP 88

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPP
Sbjct: 89  VYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP 148

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPVEKPPVYKPP
Sbjct: 149 VYKPPVEKPPVYKPP 163

 Score =  270 bits (691), Expect = 3e-71
 Identities = 121/135 (89%), Positives = 122/135 (90%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPV KPPV KPP Y PP+YKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 69  VYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPP 128

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V KPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 129 VEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPP 188

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPVEKPPVYKPP
Sbjct: 189 VYKPPVEKPPVYKPP 203

 Score =  267 bits (683), Expect = 2e-70
 Identities = 122/140 (87%), Positives = 123/140 (87%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           V KPPVYKPPVEKPP Y PP+     YKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPP
Sbjct: 54  VYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPP 113

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           V KPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPP
Sbjct: 114 VVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPP 173

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPVYKPPV KPPVYKPP
Sbjct: 174 VVKPPVYKPPVYKPPVYKPP 193

 Score =  267 bits (682), Expect = 3e-70
 Identities = 122/140 (87%), Positives = 123/140 (87%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----P 169
           V KPPVYKPPVEKPP Y PP+YKPPV KPPV KPPV KPPVYKPPVEKPPVYKP     P
Sbjct: 84  VYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPP 143

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPP
Sbjct: 144 VEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPP 203

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPV KPPV KPPVYKPP
Sbjct: 204 VYKPPVEKPPVYKPPVYKPP 223

 Score =  267 bits (682), Expect = 3e-70
 Identities = 122/140 (87%), Positives = 123/140 (87%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPP 169
           VEKPPVYKPPV KPP Y PP+ KPPV KPPVYKPPVEKPPVYKP     PVEKPPVYKPP
Sbjct: 94  VEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPP 153

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPP
Sbjct: 154 VEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP 213

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPVYKPPVEKPPVY PP
Sbjct: 214 VYKPPVYKPPVEKPPVYGPP 233

 Score =  264 bits (674), Expect = 3e-69
 Identities = 119/135 (88%), Positives = 120/135 (88%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPPV KPP   PP+YKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 79  VYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPP 138

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 139 VYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPP 198

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPV KPPV KPP
Sbjct: 199 VYKPPVYKPPVEKPP 213

 Score =  254 bits (649), Expect = 2e-66
 Identities = 115/134 (85%), Positives = 118/134 (88%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           +KPPVY+PPV KPP   PP+YKPPVEKPPVYKPPV     YKPPVEKPPVYKPPV KPPV
Sbjct: 25  DKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPV-----YKPPVEKPPVYKPPVVKPPV 79

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           YKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPV
Sbjct: 80  YKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPV 139

Query: 368 YKPPVEKPPVYKPP 409
           YKPPVEKPPVYKPP
Sbjct: 140 YKPPVEKPPVYKPP 153

[7][TOP]
>UniRef100_Q9MAW3 TrPRP2 n=1 Tax=Trifolium repens RepID=Q9MAW3_TRIRP
          Length = 343

 Score =  277 bits (709), Expect = 2e-73
 Identities = 122/135 (90%), Positives = 125/135 (92%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPPV KPP Y PP+YKPPV KPP+YKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 199 VYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPP 258

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 259 VVKPPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 318

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPVEKPPVY+PP
Sbjct: 319 VYKPPVEKPPVYEPP 333

 Score =  270 bits (691), Expect = 3e-71
 Identities = 123/140 (87%), Positives = 124/140 (88%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPP 169
           V KPPVYKPPV KPP Y PP+YKPPV KPPVYKPPV KPPV     YKPPV KPPVYKPP
Sbjct: 184 VYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPP 243

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 244 VEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPPVEKPPVYKPP 303

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPVYKPP
Sbjct: 304 VEKPPVYKPPVEKPPVYKPP 323

 Score =  269 bits (688), Expect = 6e-71
 Identities = 122/139 (87%), Positives = 123/139 (88%), Gaps = 5/139 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           EKPPVY PPV  PP   PP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV
Sbjct: 25  EKPPVYTPPVYTPPIVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 84

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----PPVYKPPV 352
           YKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV K     PPVYKPPV
Sbjct: 85  YKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPV 144

Query: 353 EKPPVYKPPVEKPPVYKPP 409
            KPPVYKPPV KPPVYKPP
Sbjct: 145 YKPPVYKPPVVKPPVYKPP 163

 Score =  268 bits (684), Expect = 2e-70
 Identities = 119/135 (88%), Positives = 121/135 (89%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPPV KPP Y PP+YKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 169 VVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPP 228

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           +YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 229 IYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPP 288

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPVEKPPVYKPP
Sbjct: 289 VYKPPVEKPPVYKPP 303

 Score =  267 bits (683), Expect = 2e-70
 Identities = 119/135 (88%), Positives = 121/135 (89%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPPV KPP   PP+YKPPV KPPV KPPV KPPVYKPPV KPP+YKPPV KPP
Sbjct: 179 VVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPP 238

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 239 VYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPPVEKPP 298

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPVEKPPVYKPP
Sbjct: 299 VYKPPVEKPPVYKPP 313

 Score =  265 bits (677), Expect = 1e-69
 Identities = 121/140 (86%), Positives = 122/140 (87%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 49  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 108

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           V KPPVYKPPV KPPVYKPPV KPPV  PPV KPPVYKPPV KPPV KPPV KPPVYKPP
Sbjct: 109 VVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPP 168

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPVYKPPV KPPVYKPP
Sbjct: 169 VVKPPVYKPPVVKPPVYKPP 188

 Score =  265 bits (676), Expect = 2e-69
 Identities = 120/140 (85%), Positives = 122/140 (87%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           + KPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 39  IVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 98

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV  PPV KPPVYKPPV KPPV KPP
Sbjct: 99  VEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPP 158

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPVYKPPV KPPVYKPP
Sbjct: 159 VYKPPVYKPPVVKPPVYKPP 178

 Score =  262 bits (669), Expect = 1e-68
 Identities = 117/135 (86%), Positives = 119/135 (88%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP+ KPPV KPP   PP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 34  VYTPPIVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 93

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV  PPV KPPVYKPPV KPP
Sbjct: 94  VYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPP 153

Query: 365 VYKPPVEKPPVYKPP 409
           V KPPV KPPVYKPP
Sbjct: 154 VVKPPVYKPPVYKPP 168

 Score =  262 bits (669), Expect = 1e-68
 Identities = 117/135 (86%), Positives = 119/135 (88%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPPV KPP Y PP+ KPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 159 VYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP 218

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPV KPP+YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 219 VYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPP 278

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPVEKPPVYKPP
Sbjct: 279 VYKPPVEKPPVYKPP 293

 Score =  259 bits (662), Expect = 7e-68
 Identities = 119/140 (85%), Positives = 120/140 (85%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPP
Sbjct: 59  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPP 118

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           V KPPVYKPPV KPPV  PPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPP
Sbjct: 119 VVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP 178

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPVYKPPV KPPV KPP
Sbjct: 179 VVKPPVYKPPVYKPPVVKPP 198

 Score =  256 bits (655), Expect = 4e-67
 Identities = 118/140 (84%), Positives = 119/140 (85%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y PP+     YKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPP
Sbjct: 69  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPP 128

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           V KPPV  PPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPPVYKPP
Sbjct: 129 VYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPP 188

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPV KPPV KPPVYKPP
Sbjct: 189 VYKPPVVKPPVYKPPVYKPP 208

 Score =  256 bits (655), Expect = 4e-67
 Identities = 118/140 (84%), Positives = 119/140 (85%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPPV KPP Y PP+YKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 144 VYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP 203

Query: 185 VYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VYKPPV KPPVYKPPV KPPV     YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPP
Sbjct: 204 VYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPP 263

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPVYKPPV KPPVYKPP
Sbjct: 264 VYKPPVYKPPVVKPPVYKPP 283

 Score =  256 bits (654), Expect = 6e-67
 Identities = 115/135 (85%), Positives = 117/135 (86%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPPV KPP   PP+YKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 119 VVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP 178

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V KPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP+YKPPV KPP
Sbjct: 179 VVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPP 238

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPVEKPPVYKPP
Sbjct: 239 VYKPPVEKPPVYKPP 253

 Score =  254 bits (649), Expect = 2e-66
 Identities = 114/135 (84%), Positives = 116/135 (85%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPPV KPP Y PP+YKPPV  PPVYKPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 109 VVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPP 168

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V KPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 169 VVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPP 228

Query: 365 VYKPPVEKPPVYKPP 409
           +YKPPV KPPVYKPP
Sbjct: 229 IYKPPVVKPPVYKPP 243

 Score =  254 bits (648), Expect = 3e-66
 Identities = 117/140 (83%), Positives = 118/140 (84%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEY-----TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP Y      PP+YKPPV KPPVYKPPV KPPVYKPPV KPPV  PP
Sbjct: 79  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPP 138

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           V KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPP
Sbjct: 139 VYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPP 198

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPVYKPPV KPPVYKPP
Sbjct: 199 VYKPPVYKPPVVKPPVYKPP 218

 Score =  254 bits (648), Expect = 3e-66
 Identities = 115/135 (85%), Positives = 116/135 (85%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPVYKPPVEKPP Y PP+ KPPV KPPV KPPV KPPVYKPPV  PPVYKPPV KPP
Sbjct: 89  VEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPP 148

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPV KPPVYKPPV KPPV KPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 149 VYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPP 208

Query: 365 VYKPPVEKPPVYKPP 409
           V KPPV KPPVYKPP
Sbjct: 209 VVKPPVYKPPVYKPP 223

 Score =  254 bits (648), Expect = 3e-66
 Identities = 114/135 (84%), Positives = 116/135 (85%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPVYKPPV KPP Y PP+ KPPV KPPVYKPPV  PPVYKPPV KPPVYKPPV KPP
Sbjct: 99  VEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPP 158

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPV KPPV KPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 159 VYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP 218

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPV KPP+YKPP
Sbjct: 219 VYKPPVVKPPIYKPP 233

 Score =  253 bits (646), Expect = 5e-66
 Identities = 114/135 (84%), Positives = 116/135 (85%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPPV KPP   PP+YKPPV KPPV KPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 139 VYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPP 198

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPV KPPV KPPV KPPVYKPPV KPP+YKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 199 VYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPP 258

Query: 365 VYKPPVEKPPVYKPP 409
           V KPPV KPPVYKPP
Sbjct: 259 VVKPPVYKPPVYKPP 273

 Score =  251 bits (641), Expect = 2e-65
 Identities = 116/140 (82%), Positives = 117/140 (83%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPPV  PP Y PP+YKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 124 VYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPP 183

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPP 349
           VYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPPV     YKPPV KPPVYKPP
Sbjct: 184 VYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPP 243

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPV KPPV KPP
Sbjct: 244 VEKPPVYKPPVYKPPVVKPP 263

[8][TOP]
>UniRef100_P08012 Repetitive proline-rich cell wall protein 1 n=1 Tax=Glycine max
           RepID=PRP1_SOYBN
          Length = 256

 Score =  269 bits (687), Expect = 8e-71
 Identities = 118/135 (87%), Positives = 122/135 (90%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPVYKPPV KPP Y PP+YKPP+EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 88  VEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPP 147

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPP+ KPP
Sbjct: 148 VEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPP 207

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPP+EKPPVYKPP
Sbjct: 208 VYKPPIEKPPVYKPP 222

 Score =  267 bits (682), Expect = 3e-70
 Identities = 121/140 (86%), Positives = 123/140 (87%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV---- 172
           V KPPVYKPPVEKPP Y PP+YKPP+ KPPVYKPPVEKPPVYKPPV KPPVYKPPV    
Sbjct: 53  VYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 112

Query: 173 -EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
            EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPP
Sbjct: 113 IEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 172

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPV KPPVYKPP
Sbjct: 173 VEKPPVYKPPVYKPPVYKPP 192

 Score =  267 bits (682), Expect = 3e-70
 Identities = 116/135 (85%), Positives = 122/135 (90%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           +EKPPVYKPPV KPP Y PP+YKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 113 IEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 172

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V KPPV KPPVYKPPV KPPVYKPPVEKPP+YKPPV KPP+ KPPV KPPVYKPPV KPP
Sbjct: 173 VEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPPVYKPPVYKPP 232

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPV+KPP+YKPP
Sbjct: 233 VYKPPVKKPPIYKPP 247

 Score =  266 bits (681), Expect = 4e-70
 Identities = 119/135 (88%), Positives = 121/135 (89%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPVYKPPV KPP Y PP+YKPPVEKPPVYKPPV KPPVYKPPV KPP+ KPPV KPP
Sbjct: 63  VEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPP 122

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 123 VYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPP 182

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPV KPPVYKPP
Sbjct: 183 VYKPPVYKPPVYKPP 197

 Score =  266 bits (680), Expect = 5e-70
 Identities = 117/135 (86%), Positives = 121/135 (89%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           + KPPVYKPPVEKPP Y PP+YKPPV KPPVYKPP+EKPPVYKPPV KPPVYKPPV KPP
Sbjct: 78  IYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPP 137

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 138 VYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 197

Query: 365 VYKPPVEKPPVYKPP 409
           V KPP+ KPPVYKPP
Sbjct: 198 VEKPPIYKPPVYKPP 212

 Score =  266 bits (680), Expect = 5e-70
 Identities = 117/135 (86%), Positives = 121/135 (89%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPP+EKPP Y PP+YKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 103 VYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 162

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPP+YKPPV KPP+ KPPV KPP
Sbjct: 163 VYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPP 222

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPV KPPVYKPP
Sbjct: 223 VYKPPVYKPPVYKPP 237

 Score =  264 bits (675), Expect = 2e-69
 Identities = 117/135 (86%), Positives = 120/135 (88%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PPVYKPPVEKPP Y PP+YKPPVEKPPVYKPPV KPP+YKPPV KPPV KPPV KPP
Sbjct: 38  VYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPP 97

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPV KPPVYKPP+EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 98  VYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPP 157

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPV KPPVYKPP
Sbjct: 158 VYKPPVYKPPVYKPP 172

 Score =  263 bits (672), Expect = 5e-69
 Identities = 117/135 (86%), Positives = 120/135 (88%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPVYKPPV KPP   PP+YKPPV KPP+YKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 48  VEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPP 107

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPP+EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 108 VYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPP 167

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPVEKPPVYKPP
Sbjct: 168 VYKPPVEKPPVYKPP 182

 Score =  259 bits (662), Expect = 7e-68
 Identities = 117/139 (84%), Positives = 120/139 (86%), Gaps = 5/139 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPV-----EKPPVYKPPV 172
           EKPP+YKPPV  PP Y PP+ KPPV KPPVYKPPVEKPPVYKPPV      KPPVYKPPV
Sbjct: 29  EKPPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPV 88

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           EKPPVYKPPV KPPVYKPPV KPP+ KPPV KPPVYKPPV KPPVYKPPV KPPVYKPPV
Sbjct: 89  EKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPV 148

Query: 353 EKPPVYKPPVEKPPVYKPP 409
           EKPPVYKPPV KPPVYKPP
Sbjct: 149 EKPPVYKPPVYKPPVYKPP 167

 Score =  248 bits (632), Expect = 2e-64
 Identities = 109/130 (83%), Positives = 114/130 (87%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPPV KPP Y PP+YKPPVEKPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 123 VYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPP 182

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPV KPPVYKPPVEKPP+YKPPV KPP+ KPPV KPPVYKPPV KPPVYKPPV+KPP
Sbjct: 183 VYKPPVYKPPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVKKPP 242

Query: 365 VYKPPVEKPP 394
           +YKPP  K P
Sbjct: 243 IYKPPYPKYP 252

[9][TOP]
>UniRef100_Q43564 Repetitive proline-rich cell wall protein 1 n=1 Tax=Medicago
           truncatula RepID=PRP1_MEDTR
          Length = 206

 Score =  267 bits (683), Expect = 2e-70
 Identities = 122/140 (87%), Positives = 123/140 (87%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPVYKPPVEKPP Y PP+YKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 49  VEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPP 108

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY-----KPPVEKPPVYKPPVEKPPVYKPP 349
           VYKPPV KPPV KPPV KPPVYKPPVEKPPVY     KPPV KPPVYKPPV KPPVYKPP
Sbjct: 109 VYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP 168

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V KPPVYKPPVEKPPVYKPP
Sbjct: 169 VYKPPVYKPPVEKPPVYKPP 188

 Score =  264 bits (675), Expect = 2e-69
 Identities = 119/135 (88%), Positives = 120/135 (88%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPVYKPPVEKPP Y PP+ KPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 39  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPP 98

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 99  VYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPP 158

Query: 365 VYKPPVEKPPVYKPP 409
           V KPPV KPPVYKPP
Sbjct: 159 VVKPPVYKPPVYKPP 173

 Score =  262 bits (669), Expect = 1e-68
 Identities = 118/135 (87%), Positives = 119/135 (88%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPVYKPPV KPP Y PP+YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPP
Sbjct: 69  VYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPP 128

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 129 VYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPP 188

Query: 365 VYKPPVEKPPVYKPP 409
           VYKPPVEKPPVY PP
Sbjct: 189 VYKPPVEKPPVYGPP 203

 Score =  261 bits (668), Expect = 1e-68
 Identities = 118/135 (87%), Positives = 119/135 (88%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPVYKPPV KPP Y PP+ KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 59  VEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 118

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V KPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 119 VVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPP 178

Query: 365 VYKPPVEKPPVYKPP 409
           V KPPV KPPVYKPP
Sbjct: 179 VEKPPVYKPPVYKPP 193

 Score =  261 bits (666), Expect = 2e-68
 Identities = 119/139 (85%), Positives = 121/139 (87%), Gaps = 5/139 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY-----KPPV 172
           EKPPVY+PPV KPP   PP+YKPPVEKPPVYKPPVEKPPVYKPPV KPPVY     KPPV
Sbjct: 25  EKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPV 84

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
            KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPV
Sbjct: 85  YKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPV 144

Query: 353 EKPPVYKPPVEKPPVYKPP 409
            KPPVYKPPV KPPV KPP
Sbjct: 145 VKPPVYKPPVYKPPVVKPP 163

[10][TOP]
>UniRef100_Q40376 Nodulin n=1 Tax=Medicago truncatula RepID=Q40376_MEDTR
          Length = 549

 Score =  263 bits (672), Expect = 5e-69
 Identities = 119/140 (85%), Positives = 129/140 (92%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEK PVYKPPVEKPP Y P     P++KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPP
Sbjct: 299 VEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPP 358

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPP
Sbjct: 359 VEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPP 418

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKPPVEKPPV+KPP
Sbjct: 419 VEKPPVYKPPVEKPPVHKPP 438

 Score =  261 bits (668), Expect = 1e-68
 Identities = 116/135 (85%), Positives = 127/135 (94%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPV+KPPVEKPP    P+YKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPP
Sbjct: 284 VEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPP 343

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V+KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPP
Sbjct: 344 VHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPP 403

Query: 365 VYKPPVEKPPVYKPP 409
           V+KPPVEK PVYKPP
Sbjct: 404 VHKPPVEKLPVYKPP 418

 Score =  259 bits (662), Expect = 7e-68
 Identities = 114/135 (84%), Positives = 127/135 (94%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEK P++KPPVEKPP + PP+ KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPP
Sbjct: 274 VEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPP 333

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPP
Sbjct: 334 VHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPP 393

Query: 365 VYKPPVEKPPVYKPP 409
           V+KPPVEKPPV+KPP
Sbjct: 394 VHKPPVEKPPVHKPP 408

 Score =  258 bits (658), Expect = 2e-67
 Identities = 116/139 (83%), Positives = 128/139 (92%), Gaps = 5/139 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKP VEKPP + PP+     +KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP 
Sbjct: 309 VEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPH 368

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKPP
Sbjct: 369 VEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPP 428

Query: 350 VEKPPVYKPPVEKPPVYKP 406
           VEKPPV+KPPVEKPP++KP
Sbjct: 429 VEKPPVHKPPVEKPPLHKP 447

 Score =  257 bits (656), Expect = 3e-67
 Identities = 115/140 (82%), Positives = 127/140 (90%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPV+KPPVEKPP + PP+     YKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPP
Sbjct: 329 VEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPP 388

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKPPVEKPPV+KPPVEKPP++KP 
Sbjct: 389 VEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEKPPLHKPQ 448

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKP  YKPP+EK PVYKPP
Sbjct: 449 VEKPTEYKPPIEKFPVYKPP 468

 Score =  256 bits (653), Expect = 7e-67
 Identities = 113/135 (83%), Positives = 125/135 (92%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPP++KPPVEK P + PP+ KPPV KPPV KPPVEK PVYKPPVEKPPVYKP VEKPP
Sbjct: 264 VEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPP 323

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           ++KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPP
Sbjct: 324 LHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPP 383

Query: 365 VYKPPVEKPPVYKPP 409
           V+KPPVEKPPV+KPP
Sbjct: 384 VHKPPVEKPPVHKPP 398

 Score =  256 bits (653), Expect = 7e-67
 Identities = 116/140 (82%), Positives = 126/140 (90%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVE-----KPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           V KPPV KPPVE     KPP   PP+YKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPP
Sbjct: 289 VHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPP 348

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPP
Sbjct: 349 VEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPP 408

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEK PVYKPPVEKPPVYKPP
Sbjct: 409 VEKLPVYKPPVEKPPVYKPP 428

 Score =  255 bits (651), Expect = 1e-66
 Identities = 116/140 (82%), Positives = 127/140 (90%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPV+KPPVEKPP + PP+     +KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP 
Sbjct: 94  VEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPS 153

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKPPVEKPP++KP VEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP 
Sbjct: 154 VEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPH 213

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPV KPPVEKPPV+KPP
Sbjct: 214 VEKPPVNKPPVEKPPVHKPP 233

 Score =  255 bits (651), Expect = 1e-66
 Identities = 116/140 (82%), Positives = 127/140 (90%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPV+KPPVEKPP + PP+     +KPPVEKPPV+KPPVEK PVYKP VEKPPVYKPP
Sbjct: 104 VEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPP 163

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPP++KP VEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPP
Sbjct: 164 VEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPP 223

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPV+KPPVEKPPV+KPP
Sbjct: 224 VEKPPVHKPPVEKPPVHKPP 243

 Score =  255 bits (651), Expect = 1e-66
 Identities = 114/140 (81%), Positives = 126/140 (90%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPP++KPPVEKPP + PP+ KPPV KPPV     YKPPVEKPPVYKP VEKPP++KPP
Sbjct: 319 VEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPP 378

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKPPVEKPPV+KPP
Sbjct: 379 VEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPP 438

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPP++KP VEKP  YKPP
Sbjct: 439 VEKPPLHKPQVEKPTEYKPP 458

 Score =  253 bits (645), Expect = 6e-66
 Identities = 116/139 (83%), Positives = 125/139 (89%), Gaps = 5/139 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPV+KPPVEKPP + PP+     YKP VEKPPVYKPPVEKPP++KP VEKPPV+KPP
Sbjct: 124 VEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPP 183

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPPVEKPPV+KPP
Sbjct: 184 VEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPP 243

Query: 350 VEKPPVYKPPVEKPPVYKP 406
           VEK PVYKP VEKPPVYKP
Sbjct: 244 VEKLPVYKPHVEKPPVYKP 262

 Score =  252 bits (644), Expect = 8e-66
 Identities = 113/140 (80%), Positives = 125/140 (89%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPP + PP+EKPP Y PP+     YKPPVE  PVYKP VEKPPV+KPPVEKPPV+KPP
Sbjct: 54  VEKPPTHHPPIEKPPIYKPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPPVEKPPVHKPP 113

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKPPVEKPP++KP 
Sbjct: 114 VEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPL 173

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPV+KPPVEKPPV+KPP
Sbjct: 174 VEKPPVHKPPVEKPPVHKPP 193

 Score =  252 bits (643), Expect = 1e-65
 Identities = 114/140 (81%), Positives = 125/140 (89%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEY-----TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           +EKPPV+KP VEKPP +      PPIYKPPVEKPP YKPPVE  PVYKP VEKPPV+KPP
Sbjct: 44  IEKPPVHKPLVEKPPTHHPPIEKPPIYKPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPP 103

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKPP
Sbjct: 104 VEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPP 163

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPP++KP VEKPPV+KPP
Sbjct: 164 VEKPPLHKPLVEKPPVHKPP 183

 Score =  252 bits (643), Expect = 1e-65
 Identities = 115/140 (82%), Positives = 126/140 (90%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKPPVEKPP + P     P++KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP 
Sbjct: 154 VEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPH 213

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPV KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKP VEKPP++KPP
Sbjct: 214 VEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPP 273

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEK P++KPPVEKPPV+KPP
Sbjct: 274 VEKTPMHKPPVEKPPVHKPP 293

 Score =  251 bits (642), Expect = 1e-65
 Identities = 117/160 (73%), Positives = 129/160 (80%), Gaps = 25/160 (15%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI---------------YKPPVEKPPVYKPPVEKPPVYKPP 139
           +EKPP+YKPPVEKPP Y PP+               +KPPVEKPPV+KPPVEKPPV+KPP
Sbjct: 64  IEKPPIYKPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPPVEKPPVHKPPVEKPPVHKPP 123

Query: 140 VEKPPVYKPPVEKPPVYKPPVEK----------PPVYKPPVEKPPVYKPPVEKPPVYKPP 289
           VEKPPV+KPPVEKPPV+KPPVEK          PPVYKPPVEKPP++KP VEKPPV+KPP
Sbjct: 124 VEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPP 183

Query: 290 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           VEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPP
Sbjct: 184 VEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPP 223

 Score =  251 bits (641), Expect = 2e-65
 Identities = 114/140 (81%), Positives = 125/140 (89%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEK PVYKPPVEKPP Y P     P++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPP
Sbjct: 349 VEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPP 408

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEK PVYKPPVEKPPVYKPPVEKPPV+KPPVEKPP++KP VEKP  YKPP+EK PVYKPP
Sbjct: 409 VEKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEKPPLHKPQVEKPTEYKPPIEKFPVYKPP 468

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKP V+KPPVEKPPV+K P
Sbjct: 469 VEKPQVHKPPVEKPPVHKSP 488

 Score =  251 bits (640), Expect = 2e-65
 Identities = 115/139 (82%), Positives = 124/139 (89%), Gaps = 5/139 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPV+KPPVEKPP + PP+ KPPV KPPV     YKP VEKPPVYKPPVEKPP++KP 
Sbjct: 114 VEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPL 173

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPP
Sbjct: 174 VEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPP 233

Query: 350 VEKPPVYKPPVEKPPVYKP 406
           VEKPPV+KPPVEK PVYKP
Sbjct: 234 VEKPPVHKPPVEKLPVYKP 252

 Score =  250 bits (639), Expect = 3e-65
 Identities = 113/140 (80%), Positives = 125/140 (89%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEK-----PPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPV+KPPVEK     PP   PP+YKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPP
Sbjct: 339 VEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPP 398

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPV+KPPVEK PVYKPPVEKPPVYKPPVEKPPV+KPPVEKPP++KP VEKP  YKPP
Sbjct: 399 VEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEKPPLHKPQVEKPTEYKPP 458

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           +EK PVYKPPVEKP V+KPP
Sbjct: 459 IEKFPVYKPPVEKPQVHKPP 478

 Score =  249 bits (637), Expect = 5e-65
 Identities = 115/140 (82%), Positives = 125/140 (89%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPV+KPPVEK P Y P     P+YKPPVEKPP++KP VEKPPV+KPPVEKPPV+KPP
Sbjct: 134 VEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPP 193

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEK PVYKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP 
Sbjct: 194 VEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPH 253

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPVYKP VEKPP++KPP
Sbjct: 254 VEKPPVYKPLVEKPPLHKPP 273

 Score =  249 bits (637), Expect = 5e-65
 Identities = 115/144 (79%), Positives = 127/144 (88%), Gaps = 10/144 (6%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPV+KPPVEKPP + PP+     YKP VEKPPVYKP VEKPP++KPPVEK P++KPP
Sbjct: 224 VEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPP 283

Query: 170 VEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
           VEKPPV+KPPVEKP     PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPP
Sbjct: 284 VEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPP 343

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKP 406
           V+KPPVEK PVYKPPVEKPPVYKP
Sbjct: 344 VHKPPVEKLPVYKPPVEKPPVYKP 367

 Score =  249 bits (636), Expect = 7e-65
 Identities = 116/144 (80%), Positives = 126/144 (87%), Gaps = 10/144 (6%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPV+KPPVEKPP + PP+     YKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPP
Sbjct: 174 VEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPP 233

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPV+KPPVEK PVYKP VEKPPVYKP VEKPP++KPPVEK P++KPPVEKPPV+KPP
Sbjct: 234 VEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPP 293

Query: 350 VEKP-----PVYKPPVEKPPVYKP 406
           VEKP     PVYKPPVEKPPVYKP
Sbjct: 294 VEKPPVEKLPVYKPPVEKPPVYKP 317

 Score =  249 bits (635), Expect = 9e-65
 Identities = 115/150 (76%), Positives = 126/150 (84%), Gaps = 15/150 (10%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPV---- 157
           VEKPPV+KPPVEKPP + PP+     YKPPVEKPPVYKPPVEKPPV+KPPVEKPP+    
Sbjct: 389 VEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEKPPLHKPQ 448

Query: 158 ------YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 319
                 YKPP+EK PVYKPPVEKP V+KPPVEKPPV+K PV+K PVYKPP EKPPVYKPP
Sbjct: 449 VEKPTEYKPPIEKFPVYKPPVEKPQVHKPPVEKPPVHKSPVKKLPVYKPPAEKPPVYKPP 508

Query: 320 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           VE PPV+KP VEKPPVYKPPVEKPPV+KPP
Sbjct: 509 VENPPVHKPLVEKPPVYKPPVEKPPVHKPP 538

 Score =  248 bits (634), Expect = 1e-64
 Identities = 115/145 (79%), Positives = 127/145 (87%), Gaps = 10/145 (6%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----P 154
           VEK PVYKP VEKPP Y P     P++KPPVEK P++KPPVEKPPV+KPPVEKP     P
Sbjct: 244 VEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLP 303

Query: 155 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
           VYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPP
Sbjct: 304 VYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPP 363

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKPP 409
           VYKP VEKPP++KPPVEKPPV+KPP
Sbjct: 364 VYKPHVEKPPLHKPPVEKPPVHKPP 388

 Score =  247 bits (631), Expect = 3e-64
 Identities = 114/145 (78%), Positives = 127/145 (87%), Gaps = 10/145 (6%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPV+KPPVEK P Y P     P+YKP VEKPP++KPPVEK P++KPPVEKPPV+KPP
Sbjct: 234 VEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPP 293

Query: 170 VEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
           VEKPPV     YKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEK P
Sbjct: 294 VEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLP 353

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKPP 409
           VYKPPVEKPPVYKP VEKPP++KPP
Sbjct: 354 VYKPPVEKPPVYKPHVEKPPLHKPP 378

 Score =  247 bits (631), Expect = 3e-64
 Identities = 111/140 (79%), Positives = 124/140 (88%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPP++KPPVEKPP + PP+     +KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKPP
Sbjct: 369 VEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPP 428

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPV+KPPVEKPP++KP VEKP  YKPP+EK PVYKPPVEKP V+KPPVEKPPV+K P
Sbjct: 429 VEKPPVHKPPVEKPPLHKPQVEKPTEYKPPIEKFPVYKPPVEKPQVHKPPVEKPPVHKSP 488

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           V+K PVYKPP EKPPVYKPP
Sbjct: 489 VKKLPVYKPPAEKPPVYKPP 508

 Score =  247 bits (630), Expect = 3e-64
 Identities = 115/145 (79%), Positives = 126/145 (86%), Gaps = 10/145 (6%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEK PVYKPPVEKPP Y P     P+ KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP 
Sbjct: 194 VEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPH 253

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPP 334
           VEKPPVYKP VEKPP++KPPVEK P++KPPVEKPPV+KPPVEKP     PVYKPPVEKPP
Sbjct: 254 VEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPP 313

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKPP 409
           VYKP VEKPP++KPPVEKPPV+KPP
Sbjct: 314 VYKPHVEKPPLHKPPVEKPPVHKPP 338

 Score =  247 bits (630), Expect = 3e-64
 Identities = 114/145 (78%), Positives = 126/145 (86%), Gaps = 10/145 (6%)
 Frame = +2

Query: 5   VEKPPVYKP-----PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEKPPVYKP     PV KPP   PP++KPPVEKPPV+KPPVEK PVYKP VEKPPVYKP 
Sbjct: 204 VEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPL 263

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPP 334
           VEKPP++KPPVEK P++KPPVEKPPV+KPPVEKPPV     YKPPVEKPPVYKP VEKPP
Sbjct: 264 VEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPP 323

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKPP 409
           ++KPPVEKPPV+KPPVEKPPV+KPP
Sbjct: 324 LHKPPVEKPPVHKPPVEKPPVHKPP 348

 Score =  246 bits (629), Expect = 4e-64
 Identities = 110/139 (79%), Positives = 120/139 (86%), Gaps = 5/139 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           EKPP YKPPVE P  Y P     P++KP VEKPP + PP+EKPP+YKPPVEKPP YKPPV
Sbjct: 25  EKPPEYKPPVENPQFYKPHIEKPPVHKPLVEKPPTHHPPIEKPPIYKPPVEKPPAYKPPV 84

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E  PVYKP VEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPV
Sbjct: 85  EHHPVYKPSVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPV 144

Query: 353 EKPPVYKPPVEKPPVYKPP 409
           EK PVYKP VEKPPVYKPP
Sbjct: 145 EKLPVYKPSVEKPPVYKPP 163

 Score =  246 bits (627), Expect = 7e-64
 Identities = 114/140 (81%), Positives = 123/140 (87%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPP-----VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEK PVYKP VEKPP Y PP+ KPP     VEKPPV+KPPVEKPPV+KPPVEK PVYKPP
Sbjct: 144 VEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPP 203

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPVYKP VEKPPV KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKP 
Sbjct: 204 VEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPL 263

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPP++KPPVEK P++KPP
Sbjct: 264 VEKPPLHKPPVEKTPMHKPP 283

 Score =  246 bits (627), Expect = 7e-64
 Identities = 112/140 (80%), Positives = 123/140 (87%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPV KPPV KPP   PP++KPPVEK PVYKP VEKPPVYKP VEKPP++KPPVEK P
Sbjct: 219 VNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTP 278

Query: 185 VYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           ++KPPVEKPPV+KPPVEKPPV     YKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPP
Sbjct: 279 MHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPP 338

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPV+KPPVEK PVYKPP
Sbjct: 339 VEKPPVHKPPVEKLPVYKPP 358

 Score =  243 bits (620), Expect = 5e-63
 Identities = 108/139 (77%), Positives = 120/139 (86%), Gaps = 5/139 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VE P  YKP +EKPP + P     P + PP+EKPP+YKPPVEKPP YKPPVE  PVYKP 
Sbjct: 34  VENPQFYKPHIEKPPVHKPLVEKPPTHHPPIEKPPIYKPPVEKPPAYKPPVEHHPVYKPS 93

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP 
Sbjct: 94  VEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPS 153

Query: 350 VEKPPVYKPPVEKPPVYKP 406
           VEKPPVYKPPVEKPP++KP
Sbjct: 154 VEKPPVYKPPVEKPPLHKP 172

 Score =  242 bits (617), Expect = 1e-62
 Identities = 109/140 (77%), Positives = 120/140 (85%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEY-----TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VEK PVYKPPVEKPP Y      PP++KPPVEKPP++KP VEKP  YKPP+EK PVYKPP
Sbjct: 409 VEKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEKPPLHKPQVEKPTEYKPPIEKFPVYKPP 468

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           VEKP V+KPPVEKPPV+K PV+K PVYKPP EKPPVYKPPVE PPV+KP VEKPPVYKPP
Sbjct: 469 VEKPQVHKPPVEKPPVHKSPVKKLPVYKPPAEKPPVYKPPVENPPVHKPLVEKPPVYKPP 528

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VEKPPV+KPP EKPP+Y PP
Sbjct: 529 VEKPPVHKPPFEKPPIYTPP 548

 Score =  218 bits (554), Expect = 2e-55
 Identities = 98/126 (77%), Positives = 109/126 (86%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPV+KPPVEK     PP++KP VEKP  YKPP+EK PVYKPPVEKP V+KPPVEKPP
Sbjct: 429 VEKPPVHKPPVEK-----PPLHKPQVEKPTEYKPPIEKFPVYKPPVEKPQVHKPPVEKPP 483

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V+K PV+K PVYKPP EKPPVYKPPVE PPV+KP VEKPPVYKPPVEKPPV+KPP EKPP
Sbjct: 484 VHKSPVKKLPVYKPPAEKPPVYKPPVENPPVHKPLVEKPPVYKPPVEKPPVHKPPFEKPP 543

Query: 365 VYKPPV 382
           +Y PP+
Sbjct: 544 IYTPPL 549

[11][TOP]
>UniRef100_C6TGK1 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TGK1_SOYBN
          Length = 161

 Score =  248 bits (632), Expect = 2e-64
 Identities = 111/134 (82%), Positives = 117/134 (87%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           EKPP+YKPPV     YTPP+YKPPVEKPPVY     KPPVYKPPVEKPPVYKPPV KPP+
Sbjct: 29  EKPPIYKPPV-----YTPPVYKPPVEKPPVY-----KPPVYKPPVEKPPVYKPPVYKPPI 78

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           YKPPV KPPV KPPV KPPVYKPPV KPPVYKPP+EKPPVYKPPV KPPVYKPPV KPPV
Sbjct: 79  YKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPV 138

Query: 368 YKPPVEKPPVYKPP 409
           YKPPV+KPP+YKPP
Sbjct: 139 YKPPVKKPPIYKPP 152

 Score =  232 bits (591), Expect = 1e-59
 Identities = 101/120 (84%), Positives = 106/120 (88%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PPVYKPPVEKPP Y PP+YKPPVEKPPVYKPPV KPP+YKPPV KPPV KPPV KPP
Sbjct: 38  VYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPP 97

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VYKPPV KPPVYKPP+EKPPVYKPPV KPPVYKPPV KPPVYKPPV+KPP+YKPP  K P
Sbjct: 98  VYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVKKPPIYKPPYPKYP 157

[12][TOP]
>UniRef100_A9PE91 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PE91_POPTR
          Length = 182

 Score =  213 bits (543), Expect = 4e-54
 Identities = 104/139 (74%), Positives = 116/139 (83%), Gaps = 6/139 (4%)
 Frame = +2

Query: 11  KPPVYKPP-VEKP-PEYTPPIYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           KPP +KPP VEKP PE+ PP+YKPP +EKPPVYKPP    PVYKPP+EKPPVYKPP    
Sbjct: 33  KPPYFKPPKVEKPFPEHKPPVYKPPKIEKPPVYKPP----PVYKPPIEKPPVYKPP---- 84

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP-VE 355
           PVYKPP+EKPPVYKPP    PVYKPP+EKPPVYKPP+EKPPVYKPP +EKPPVYKPP +E
Sbjct: 85  PVYKPPIEKPPVYKPP----PVYKPPIEKPPVYKPPIEKPPVYKPPKIEKPPVYKPPKIE 140

Query: 356 KPPVYKPP-VEKPPVYKPP 409
           KPPVYKPP +EKPP +  P
Sbjct: 141 KPPVYKPPKIEKPPPFHKP 159

 Score =  168 bits (425), Expect = 2e-40
 Identities = 81/117 (69%), Positives = 91/117 (77%), Gaps = 6/117 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP-IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           PPVYKPP+EKPP Y PP +YKPP+EKPPVYKPP    PVYKPP+EKPPVYKPP+EKPPVY
Sbjct: 68  PPVYKPPIEKPPVYKPPPVYKPPIEKPPVYKPP----PVYKPPIEKPPVYKPPIEKPPVY 123

Query: 191 KPP-VEKPPVYKPP-VEKPPVYKPP-VEKPPVYKPPVEKPPVY--KPPVEKPPVYKP 346
           KPP +EKPPVYKPP +EKPPVYKPP +EKPP +  P+     Y   PPVE     KP
Sbjct: 124 KPPKIEKPPVYKPPKIEKPPVYKPPKIEKPPPFHKPLPPYGHYPGHPPVENAEYIKP 180

 Score =  129 bits (323), Expect = 1e-28
 Identities = 64/99 (64%), Positives = 73/99 (73%), Gaps = 5/99 (5%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP-VEK 178
           V KPP+ KPPV KP    PP+YKPP+EKPPVYKPP+EKPPVYKPP +EKPPVYKPP +EK
Sbjct: 86  VYKPPIEKPPVYKP----PPVYKPPIEKPPVYKPPIEKPPVYKPPKIEKPPVYKPPKIEK 141

Query: 179 PPVYKPP-VEKPPVYKPPVEKPPVY--KPPVEKPPVYKP 286
           PPVYKPP +EKPP +  P+     Y   PPVE     KP
Sbjct: 142 PPVYKPPKIEKPPPFHKPLPPYGHYPGHPPVENAEYIKP 180

[13][TOP]
>UniRef100_Q2PET4 Putative uncharacterized protein n=1 Tax=Trifolium pratense
           RepID=Q2PET4_TRIPR
          Length = 478

 Score =  213 bits (542), Expect = 5e-54
 Identities = 86/106 (81%), Positives = 96/106 (90%)
 Frame = +2

Query: 77  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 256
           PVE PPVYKPPVEKPPVYKPPVEKPP+YKPP+E PP+YKPP EKPP+YKPP EKPPVYKP
Sbjct: 359 PVETPPVYKPPVEKPPVYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKP 418

Query: 257 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 394
           P+E+PP YKPP E PP+YKPP EKPP+YKPP EKPP+YKPP E+PP
Sbjct: 419 PIEEPPFYKPPFENPPIYKPPYEKPPLYKPPFEKPPLYKPPFEEPP 464

 Score =  210 bits (535), Expect = 3e-53
 Identities = 86/115 (74%), Positives = 99/115 (86%), Gaps = 2/115 (1%)
 Frame = +2

Query: 47  PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 226
           P  TPP+YKPPVEKPPVYKPPVEKPP+YKPP+E PP+YKPP EKPP+YKPP EKPPVYKP
Sbjct: 359 PVETPPVYKPPVEKPPVYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKP 418

Query: 227 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVE 385
           P+E+PP YKPP E PP+YKPP EKPP+YKPP EKPP+YKPP E+PP +   PP +
Sbjct: 419 PIEEPPFYKPPFENPPIYKPPYEKPPLYKPPFEKPPLYKPPFEEPPHHPKYPPAD 473

 Score =  206 bits (523), Expect = 9e-52
 Identities = 83/101 (82%), Positives = 92/101 (91%)
 Frame = +2

Query: 107 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 286
           PVE PPVYKPPVEKPPVYKPPVEKPP+YKPP+E PP+YKPP EKPP+YKPP EKPPVYKP
Sbjct: 359 PVETPPVYKPPVEKPPVYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKP 418

Query: 287 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           P+E+PP YKPP E PP+YKPP EKPP+YKPP EKPP+YKPP
Sbjct: 419 PIEEPPFYKPPFENPPIYKPPYEKPPLYKPPFEKPPLYKPP 459

 Score =  204 bits (519), Expect = 2e-51
 Identities = 86/119 (72%), Positives = 99/119 (83%), Gaps = 2/119 (1%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE PPVYKPPVEKPP     +YKPPVEKPP+YKPP+E PP+YKPP EKPP+YKPP EKPP
Sbjct: 360 VETPPVYKPPVEKPP-----VYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPP 414

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVE 355
           VYKPP+E+PP YKPP E PP+YKPP EKPP+YKPP EKPP+YKPP E+PP +   PP +
Sbjct: 415 VYKPPIEEPPFYKPPFENPPIYKPPYEKPPLYKPPFEKPPLYKPPFEEPPHHPKYPPAD 473

[14][TOP]
>UniRef100_Q39686 Proline-rich protein n=1 Tax=Daucus carota RepID=Q39686_DAUCA
          Length = 235

 Score =  186 bits (473), Expect = 5e-46
 Identities = 88/154 (57%), Positives = 107/154 (69%), Gaps = 28/154 (18%)
 Frame = +2

Query: 29  PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 208
           PP+ KPP YTPP++KPP+ KPPVY  PV KPP++KPPV  PPV+KPP+ KPPVY PPV K
Sbjct: 24  PPIHKPPVYTPPVHKPPIHKPPVYTSPVHKPPIHKPPVYTPPVHKPPIHKPPVYTPPVHK 83

Query: 209 PPV-YKPPVE-------------KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKP---- 331
           PP  YKPPVE             KPPVYKPPV+KP P +KPPV KPP++KPPV       
Sbjct: 84  PPSEYKPPVEATNSVTEDHYPIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVT 143

Query: 332 -------PVYKP-PVEKPPVYKPPVE-KPPVYKP 406
                  P++KP P+ +PPV+KPP E KPPV++P
Sbjct: 144 DDHYPAHPIHKPQPIHRPPVHKPPTEHKPPVHEP 177

 Score =  186 bits (472), Expect = 7e-46
 Identities = 93/165 (56%), Positives = 112/165 (67%), Gaps = 30/165 (18%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           + KPPVY PPV KPP + PP+Y  PV KPP++KPPV  PPV+KPP+ KPPVY PPV KPP
Sbjct: 26  IHKPPVYTPPVHKPPIHKPPVYTSPVHKPPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPP 85

Query: 185 -VYKPPVE-------------KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKP------ 301
             YKPPVE             KPPVYKPPV+KP P +KPPV KPP++KPPV         
Sbjct: 86  SEYKPPVEATNSVTEDHYPIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDD 145

Query: 302 -----PVYKP-PVEKPPVYKPPVE-KPPVYKPPVE-KP-PVYKPP 409
                P++KP P+ +PPV+KPP E KPPV++P  E KP PVY+PP
Sbjct: 146 HYPAHPIHKPQPIHRPPVHKPPTEHKPPVHEPATEHKPSPVYQPP 190

 Score =  174 bits (442), Expect = 2e-42
 Identities = 83/144 (57%), Positives = 99/144 (68%), Gaps = 27/144 (18%)
 Frame = +2

Query: 59  PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 238
           PPI+KPPV  PPV+KPP+ KPPVY  PV KPP++KPPV  PPV+KPP+ KPPVY PPV K
Sbjct: 24  PPIHKPPVYTPPVHKPPIHKPPVYTSPVHKPPIHKPPVYTPPVHKPPIHKPPVYTPPVHK 83

Query: 239 PPV-YKPPVE-------------KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKP---- 361
           PP  YKPPVE             KPPVYKPPV+KP P +KPPV KPP++KPPV       
Sbjct: 84  PPSEYKPPVEATNSVTEDHYPIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVT 143

Query: 362 -------PVYKP-PVEKPPVYKPP 409
                  P++KP P+ +PPV+KPP
Sbjct: 144 DDHYPAHPIHKPQPIHRPPVHKPP 167

 Score =  137 bits (344), Expect = 5e-31
 Identities = 84/194 (43%), Positives = 98/194 (50%), Gaps = 67/194 (34%)
 Frame = +2

Query: 5   VEKPPVY-----KPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPV-YKPPVE------- 145
           + KPPVY     KPP+ KPP YTPP++KPP+ KPPVY PPV KPP  YKPPVE       
Sbjct: 41  IHKPPVYTSPVHKPPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPPSEYKPPVEATNSVTE 100

Query: 146 ------KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVE----------------------K 238
                 KPPVYKPPV+KP P +KPPV KPP++KPPV                       +
Sbjct: 101 DHYPIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHR 160

Query: 239 PPVYKPPVE-KPPVY------------------------KPPVEKPPVYKPPVEKPPVYK 343
           PPV+KPP E KPPV+                        KPP   P V +PP    P   
Sbjct: 161 PPVHKPPTEHKPPVHEPATEHKPSPVYQPPKTEKPVPEHKPPHLPPIVVRPPPTHKP--N 218

Query: 344 PPVEKPPVYKPPVE 385
           PP    P + PPVE
Sbjct: 219 PPYGHHPGH-PPVE 231

[15][TOP]
>UniRef100_P93237 Proline-rich protein PRP2 n=1 Tax=Lupinus luteus RepID=P93237_LUPLU
          Length = 894

 Score =  185 bits (470), Expect = 1e-45
 Identities = 93/148 (62%), Positives = 109/148 (73%), Gaps = 14/148 (9%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPI-------YKPPVEKPPVYKPPVEKPP-VYKPPVEKPPV-Y 160
           EKPPVY+PP EKPP   PP        Y PP EKPPV++PP EKPP V+ PP +KPP+ Y
Sbjct: 549 EKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEY 608

Query: 161 KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEK 328
            PP EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPPVY+PP EK PPV+ PP EK
Sbjct: 609 HPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEK 668

Query: 329 PPV-YKPPVEKPPVYKPPVEKPPVYKPP 409
           PP+ Y PP+EKPPV++PP EKPP  +PP
Sbjct: 669 PPIEYPPPLEKPPVHEPPYEKPPPVQPP 696

 Score =  174 bits (442), Expect = 2e-42
 Identities = 93/149 (62%), Positives = 110/149 (73%), Gaps = 15/149 (10%)
 Frame = +2

Query: 8    EKPPV-YKPPVEKPP-EYTPPIYKPPVE------KPPVYKPPVEK-PPVYKPPVEKPPV- 157
            EKPP+ Y PP EKPP EY PP  KPP+E      KPPVY+PP EK PPV+ PP EKPP+ 
Sbjct: 613  EKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIE 672

Query: 158  YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEK 328
            Y PP+EKPPV++PP EK PPV  PP +KPP+ Y PP EKPPVY+PP E+ PPV+ P  EK
Sbjct: 673  YPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEK 732

Query: 329  PP-VYKPPVEKPPVYKPPVEK-PPVYKPP 409
            PP VY PP EK P+++PP EK PPV+ PP
Sbjct: 733  PPFVYPPPHEKSPMHEPPYEKAPPVHLPP 761

 Score =  172 bits (436), Expect = 1e-41
 Identities = 90/153 (58%), Positives = 108/153 (70%), Gaps = 19/153 (12%)
 Frame = +2

Query: 8   EKPPVYKPPVEK-PPEYTPPIYKPPV------EKPPVYKPPVEK-PPVYKPPVEKPPVYK 163
           EKPPVY+PP EK PP + PP  KPP+      EKPP+++PP EK PPV+ PPV  PP  K
Sbjct: 447 EKPPVYEPPYEKSPPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEK 506

Query: 164 PPVEKPPVY-KPPVE------KPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYK 313
           PP+E PP + KPP+E      KPP+ Y PP EKPP+ Y  P EKPPVY+PP EK PPV+ 
Sbjct: 507 PPIEYPPPHTKPPIEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHP 566

Query: 314 PPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPP 409
           PP EKPP+ Y PP EKPPV++PP EKPP+  PP
Sbjct: 567 PPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHPP 599

 Score =  171 bits (434), Expect = 2e-41
 Identities = 90/148 (60%), Positives = 107/148 (72%), Gaps = 14/148 (9%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYT-PPI-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVE 175
           EKPPV++PP +KPP +  PPI Y PP EKPPVY+PP EK PPV+ PP EKPP V+ PP E
Sbjct: 420 EKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYEKSPPVHPPPHEKPPIVHPPPHE 479

Query: 176 KPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVY-KPPVE------KPPV-YKPPVEK 328
           KPP+++PP EK PPV+ PPV  PP  KPP+E PP + KPP+E      KPP+ Y PP EK
Sbjct: 480 KPPLFEPPFEKPPPVHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHVKPPIQYPPPHEK 539

Query: 329 PPV-YKPPVEKPPVYKPPVEKPPVYKPP 409
           PP+ Y  P EKPPVY+PP EKPP   PP
Sbjct: 540 PPIEYPLPHEKPPVYEPPYEKPPPVHPP 567

 Score =  169 bits (429), Expect = 7e-41
 Identities = 86/145 (59%), Positives = 104/145 (71%), Gaps = 13/145 (8%)
 Frame = +2

Query: 14  PPVYKPPVEK------PPEYTPPIYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPP 169
           PPVY+PP EK      PP  TPPI  PP EKPP+++ P EK PPV+ PP +KP + Y PP
Sbjct: 219 PPVYEPPYEKSPPVHQPPYETPPIENPPHEKPPIHESPYEKPPPVHPPPHDKPSIEYPPP 278

Query: 170 VEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV- 337
            EKPPVY+PP +K PPV+ PP EKPP+ Y PP EKPPV++PP EK PP + PP +KPP+ 
Sbjct: 279 HEKPPVYEPPYDKPPPVHPPPHEKPPIEYPPPHEKPPVHEPPYEKPPPEHSPPHDKPPIE 338

Query: 338 YKPPVEKPPV-YKPPVEKPPVYKPP 409
           Y PP EKPP+ Y PP EKPP+  PP
Sbjct: 339 YHPPHEKPPIEYPPPHEKPPIEYPP 363

 Score =  168 bits (426), Expect = 2e-40
 Identities = 84/143 (58%), Positives = 103/143 (72%), Gaps = 8/143 (5%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK 178
           V +PP   PP+E PP   PPI++ P EK PPV+ PP +KP + Y PP EKPPVY+PP +K
Sbjct: 232 VHQPPYETPPIENPPHEKPPIHESPYEKPPPVHPPPHDKPSIEYPPPHEKPPVYEPPYDK 291

Query: 179 -PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV-YK 343
            PPV+ PP EKPP+ Y PP EKPPV++PP EK PP + PP +KPP+ Y PP EKPP+ Y 
Sbjct: 292 PPPVHPPPHEKPPIEYPPPHEKPPVHEPPYEKPPPEHSPPHDKPPIEYHPPHEKPPIEYP 351

Query: 344 PPVEKPPV-YKPPVEKPPVYKPP 409
           PP EKPP+ Y PP EKPP+  PP
Sbjct: 352 PPHEKPPIEYPPPHEKPPIEYPP 374

 Score =  167 bits (424), Expect = 3e-40
 Identities = 91/154 (59%), Positives = 104/154 (67%), Gaps = 19/154 (12%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPI-------YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-V 157
            +EKPPV++PP EKPP   PP        Y PP EKPPVY+PP E+ PPV+ P  EKPP V
Sbjct: 677  LEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEKPPFV 736

Query: 158  YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV------YKPPVEKP-PVY 310
            Y PP EK P+++PP EK PPV+ PP EKPP+ Y PP EKPPV       KPPVE P P  
Sbjct: 737  YPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAE 796

Query: 311  KPPV-EKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            KPP  EKPP+  PP EKPPVY+PP EKPP   PP
Sbjct: 797  KPPTHEKPPIEFPPHEKPPVYEPPYEKPPSVCPP 830

 Score =  166 bits (420), Expect = 8e-40
 Identities = 90/154 (58%), Positives = 104/154 (67%), Gaps = 20/154 (12%)
 Frame = +2

Query: 8   EKPPV-YKPPVEKPP-EYTPPIYKPPVEKPPV-------YKPPVEKPPVYKPPVEK---- 148
           EKPP+ Y PP EKPP EY PP  KPP+E PP        Y PP EK PVY+PP EK    
Sbjct: 344 EKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPSIEYPPPHEKSPVYEPPYEKSPPV 403

Query: 149 --PPVYKPPVEKPPVY-KPPVEKPPVYKPPV-EKPPV-YKPPVEKPPVYKPPVEK-PPVY 310
             PP  KPP+E PP + KPPV +PP  KPP  +KPP+ Y PP EKPPVY+PP EK PPV+
Sbjct: 404 HPPPDEKPPIEYPPPHEKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYEKSPPVH 463

Query: 311 KPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPP 409
            PP EKPP V+ PP EKPP+++PP EKPP   PP
Sbjct: 464 PPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPP 497

 Score =  164 bits (415), Expect = 3e-39
 Identities = 87/155 (56%), Positives = 106/155 (68%), Gaps = 20/155 (12%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEY-TPPIYKPPVEKPP-------VYKPPVEKPPVYKPPVEK-PPV 157
           V  PP  KPP+E PP +  PP+++PP +KPP        Y PP EKPPVY+PP EK PPV
Sbjct: 403 VHPPPDEKPPIEYPPPHEKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYEKSPPV 462

Query: 158 YKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVY-KPPVE- 325
           + PP EKPP V+ PP EKPP+++PP EK PPV+ PPV  PP  KPP+E PP + KPP+E 
Sbjct: 463 HPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEKPPIEYPPPHTKPPIEY 522

Query: 326 -----KPPV-YKPPVEKPPV-YKPPVEKPPVYKPP 409
                KPP+ Y PP EKPP+ Y  P EKPPVY+PP
Sbjct: 523 PPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPP 557

 Score =  164 bits (415), Expect = 3e-39
 Identities = 91/147 (61%), Positives = 105/147 (71%), Gaps = 14/147 (9%)
 Frame = +2

Query: 8    EKPPVY-----KP-PVEKPPEYTPPI-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-Y 160
            EKPPVY     KP PV  PP+  PPI Y PP+EKPPV++PP EK PPV  PP +KPP+ Y
Sbjct: 646  EKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEY 705

Query: 161  KPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKP 331
             PP EKPPVY+PP E+ PPV+ P  EKPP VY PP EK P+++PP EK PPV+ PP EKP
Sbjct: 706  PPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKP 765

Query: 332  PV-YKPPVEKPPV-YKPPVEKPPVYKP 406
            P+ Y PP EKPPV Y PP  KPPV  P
Sbjct: 766  PIEYAPPHEKPPVEYPPPHVKPPVEYP 792

 Score =  163 bits (412), Expect = 6e-39
 Identities = 86/149 (57%), Positives = 104/149 (69%), Gaps = 14/149 (9%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPP-EYTPPIYKPPVEKPPVYKPPVEKPPVY-KPPVE------KPPV- 157
           V  PP  KPP+ +PP E  PP++ PPV  PP  KPP+E PP + KPP+E      KPP+ 
Sbjct: 473 VHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHVKPPIQ 532

Query: 158 YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK 328
           Y PP EKPP+ Y  P EKPPVY+PP EK PPV+ PP EKPP+ Y PP EKPPV++PP EK
Sbjct: 533 YPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEK 592

Query: 329 PP-VYKPPVEKPPV-YKPPVEKPPVYKPP 409
           PP V+ PP +KPP+ Y PP EKPP+  PP
Sbjct: 593 PPLVHPPPHDKPPIEYHPPHEKPPIEYPP 621

 Score =  162 bits (409), Expect = 1e-38
 Identities = 84/156 (53%), Positives = 105/156 (67%), Gaps = 21/156 (13%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPP--EYTPPIYKPPVEKPP-VYKPPVEK-------------PPVYKP 136
           V +PP  KPP+  PP  E  PP+Y+ P EKPP V+ PP  K             PPVY+P
Sbjct: 165 VYEPPYEKPPILHPPPHEKPPPLYESPSEKPPHVHPPPPHKKPPIGYPPSYEKPPPVYEP 224

Query: 137 PVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV 307
           P EK PPV++PP E PP+  PP EKPP+++ P EK PPV+ PP +KP + Y PP EKPPV
Sbjct: 225 PYEKSPPVHQPPYETPPIENPPHEKPPIHESPYEKPPPVHPPPHDKPSIEYPPPHEKPPV 284

Query: 308 YKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPP 409
           Y+PP +K PPV+ PP EKPP+ Y PP EKPPV++PP
Sbjct: 285 YEPPYDKPPPVHPPPHEKPPIEYPPPHEKPPVHEPP 320

 Score =  161 bits (407), Expect = 2e-38
 Identities = 89/160 (55%), Positives = 105/160 (65%), Gaps = 25/160 (15%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEY-TPPIYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVE 175
            V  PP  KPP+E PP    PP+++PP EK PPV  PP +KPP+ Y PP EKPPVY+PP E
Sbjct: 661  VHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEKPPVYEPPYE 720

Query: 176  K-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV-- 337
            + PPV+ P  EKPP VY PP EK P+++PP EK PPV+ PP EKPP+ Y PP EKPPV  
Sbjct: 721  RSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEY 780

Query: 338  ----YKPPV------------EKPPVYKPPVEKPPVYKPP 409
                 KPPV            EKPP+  PP EKPPVY+PP
Sbjct: 781  PPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYEPP 820

 Score =  153 bits (386), Expect = 7e-36
 Identities = 82/157 (52%), Positives = 102/157 (64%), Gaps = 22/157 (14%)
 Frame = +2

Query: 5   VEKPPVYKP-PVEKPPEYTPPI-YKPPVEKP-PVYKPPVEKPPVYKPPVEK--PPVYKPP 169
           + +PP  KP P+  PP   PPI Y PP EKP PVY+PP EKPP+  PP  +  PP+Y+ P
Sbjct: 132 IYEPPNEKPPPLHPPPHEKPPIDYPPPHEKPSPVYEPPYEKPPILHPPPHEKPPPLYESP 191

Query: 170 VEKPP-VYKPPVEK-------------PPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPP 304
            EKPP V+ PP  K             PPVY+PP EK PPV++PP E PP+  PP EKPP
Sbjct: 192 SEKPPHVHPPPPHKKPPIGYPPSYEKPPPVYEPPYEKSPPVHQPPYETPPIENPPHEKPP 251

Query: 305 VYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPP 409
           +++ P EK PPV+ PP +KP + Y PP EKPPVY+PP
Sbjct: 252 IHESPYEKPPPVHPPPHDKPSIEYPPPHEKPPVYEPP 288

 Score =  141 bits (355), Expect = 3e-32
 Identities = 81/152 (53%), Positives = 97/152 (63%), Gaps = 18/152 (11%)
 Frame = +2

Query: 8   EKPPVY-----KPPVEKPP---EYTPPIYKPPVEK-PPVYKPPVEKP-PVYKPPVEK-PP 154
           E PPVY     KP +E PP   E  PP  KPP EK PP Y PP E+P P + P  EK PP
Sbjct: 50  EPPPVYHPPREKPSIENPPPSYEKPPPHEKPPHEKSPPEYSPPHEEPTPEFPPSHEKSPP 109

Query: 155 VYKPPVEKPPVYKPPV--EKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKP-PVYKPP 319
           +Y  P EKPP+  PP   + PP+Y+PP EK PP++ PP EKPP+ Y PP EKP PVY+PP
Sbjct: 110 LYPSPHEKPPIECPPPHDKLPPIYEPPNEKPPPLHPPPHEKPPIDYPPPHEKPSPVYEPP 169

Query: 320 VEKPPVYKPPVEK--PPVYKPPVEKPPVYKPP 409
            EKPP+  PP  +  PP+Y+ P EKPP   PP
Sbjct: 170 YEKPPILHPPPHEKPPPLYESPSEKPPHVHPP 201

 Score =  138 bits (348), Expect = 2e-31
 Identities = 81/158 (51%), Positives = 97/158 (61%), Gaps = 25/158 (15%)
 Frame = +2

Query: 11  KPPVYKPPV---EKPP-EYTPPIYKPPVEKPPVYKPPVEKPPVYKPP--VEKPPVY-KPP 169
           K P Y+PP    E PP E  PP+Y+PP    PVY PP EKP +  PP   EKPP + KPP
Sbjct: 26  KQPTYEPPTPIFEPPPFETLPPVYEPP----PVYHPPREKPSIENPPPSYEKPPPHEKPP 81

Query: 170 VEK-PPVYKPPVEK------------PPVYKPPVEKPPVYKPPV--EKPPVYKPPVEK-P 301
            EK PP Y PP E+            PP+Y  P EKPP+  PP   + PP+Y+PP EK P
Sbjct: 82  HEKSPPEYSPPHEEPTPEFPPSHEKSPPLYPSPHEKPPIECPPPHDKLPPIYEPPNEKPP 141

Query: 302 PVYKPPVEKPPV-YKPPVEKP-PVYKPPVEKPPVYKPP 409
           P++ PP EKPP+ Y PP EKP PVY+PP EKPP+  PP
Sbjct: 142 PLHPPPHEKPPIDYPPPHEKPSPVYEPPYEKPPILHPP 179

 Score =  137 bits (345), Expect = 4e-31
 Identities = 81/162 (50%), Positives = 98/162 (60%), Gaps = 30/162 (18%)
 Frame = +2

Query: 8    EKPPVYKPPVEKPPEYTPP-------IYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-Y 160
            EKPPVY+PP E+ P   PP       +Y PP EK P+++PP EK PPV+ PP EKPP+ Y
Sbjct: 710  EKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEY 769

Query: 161  KPPVEKPPV------YKPPVE------------KPPVYKPPVEKPPVYKPPVEKPP-VYK 283
             PP EKPPV       KPPVE            KPP+  PP EKPPVY+PP EKPP V  
Sbjct: 770  APPHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYEPPYEKPPSVCP 829

Query: 284  PPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKP-PVEKPPVYK 403
            PP EKPP ++   ++  +Y P   KPP  +KP P +KPP YK
Sbjct: 830  PPHEKPPHHE---KRSALYPPHHRKPPNHHKPLPYKKPPFYK 868

[16][TOP]
>UniRef100_Q06841 Early nodulin-75 (Fragment) n=1 Tax=Lupinus luteus RepID=NO75_LUPLU
          Length = 434

 Score =  185 bits (469), Expect = 2e-45
 Identities = 93/148 (62%), Positives = 109/148 (73%), Gaps = 14/148 (9%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPI-------YKPPVEKPPVYKPPVEKPP-VYKPPVEKPPV-Y 160
           EKPPVY+PP EKPP   PP        Y PP EKPPV++PP EKPP V+ PP +KPP+ Y
Sbjct: 91  EKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEY 150

Query: 161 KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEK 328
            PP EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPPVY+PP EK PPV+ PP EK
Sbjct: 151 HPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEK 210

Query: 329 PPV-YKPPVEKPPVYKPPVEKPPVYKPP 409
           PP+ Y PP+EKPPV++PP EKPP  +PP
Sbjct: 211 PPIEYPPPLEKPPVHEPPYEKPPPAQPP 238

 Score =  174 bits (440), Expect = 4e-42
 Identities = 92/156 (58%), Positives = 109/156 (69%), Gaps = 21/156 (13%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPP-------EYTPPIYKPPVEKPPVY-KPPV------EKPPVYKPPV 142
           V  PP  KPP+E PP       EY PP  KPP++ PP + KPP+      EKPPVY+PP 
Sbjct: 41  VHPPPHEKPPIEYPPPHTKPPIEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPY 100

Query: 143 EK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPV- 307
           EK PPV+ PP EKPP+ Y PP EKPPV++PP EKPP V+ PP +KPP+ Y PP EKPP+ 
Sbjct: 101 EKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEYHPPHEKPPIE 160

Query: 308 YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPP 409
           Y PP EKPP+ Y PP EKPP+ Y PP EKPPVY+PP
Sbjct: 161 YPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPP 196

 Score =  173 bits (438), Expect = 6e-42
 Identities = 92/149 (61%), Positives = 109/149 (73%), Gaps = 15/149 (10%)
 Frame = +2

Query: 8   EKPPV-YKPPVEKPP-EYTPPIYKPPVE------KPPVYKPPVEK-PPVYKPPVEKPPV- 157
           EKPP+ Y PP EKPP EY PP  KPP+E      KPPVY+PP EK PPV+ PP EKPP+ 
Sbjct: 155 EKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIE 214

Query: 158 YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEK 328
           Y PP+EKPPV++PP EK PP   PP +KPP+ Y PP EKPPVY+PP E+ PPV+ P  EK
Sbjct: 215 YPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEK 274

Query: 329 PP-VYKPPVEKPPVYKPPVEK-PPVYKPP 409
           PP VY PP EK P+++PP EK PPV+ PP
Sbjct: 275 PPFVYPPPHEKSPMHEPPYEKAPPVHLPP 303

 Score =  172 bits (436), Expect = 1e-41
 Identities = 87/143 (60%), Positives = 106/143 (74%), Gaps = 9/143 (6%)
 Frame = +2

Query: 8   EKPPVYKPPVEK-PPEYTPPIYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVE 175
           EKPP+++PP EK PP + PP++ PP EKPP+ Y PP  KPP+ Y PP  KPP+ Y PP E
Sbjct: 21  EKPPLFEPPFEKPPPAHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHVKPPIQYPPPHE 80

Query: 176 KPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP-VYK 343
           KPP+ Y  P EKPPVY+PP EK PPV+ PP EKPP+ Y PP EKPPV++PP EKPP V+ 
Sbjct: 81  KPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHP 140

Query: 344 PPVEKPPV-YKPPVEKPPVYKPP 409
           PP +KPP+ Y PP EKPP+  PP
Sbjct: 141 PPHDKPPIEYHPPHEKPPIEYPP 163

 Score =  164 bits (415), Expect = 3e-39
 Identities = 87/144 (60%), Positives = 102/144 (70%), Gaps = 10/144 (6%)
 Frame = +2

Query: 8   EKPPVYKPPV-EKPPEYTPPIYK-PPVEKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVE 175
           EKPP+  PP  EKPP + PP  K PP   PPV+ PP EKPP+ Y PP  KPP+ Y PP  
Sbjct: 10  EKPPIVHPPPHEKPPLFEPPFEKPPPAHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHV 69

Query: 176 KPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYK 343
           KPP+ Y PP EKPP+ Y  P EKPPVY+PP EK PPV+ PP EKPP+ Y PP EKPPV++
Sbjct: 70  KPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHE 129

Query: 344 PPVEKPP-VYKPPVEKPPV-YKPP 409
           PP EKPP V+ PP +KPP+ Y PP
Sbjct: 130 PPYEKPPLVHPPPHDKPPIEYHPP 153

 Score =  163 bits (413), Expect = 5e-39
 Identities = 95/175 (54%), Positives = 109/175 (62%), Gaps = 41/175 (23%)
 Frame = +2

Query: 8   EKPPVY-----KP-PVEKPPEYTPPI-YKPPVEKPPVYKPPVEKPP------------VY 130
           EKPPVY     KP PV  PP+  PPI Y PP+EKPPV++PP EKPP             Y
Sbjct: 188 EKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEY 247

Query: 131 KPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKP 301
            PP EKPPVY+PP E+ PPV+ P  EKPP VY PP EK P+++PP EK PPV+ PP EKP
Sbjct: 248 PPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKP 307

Query: 302 PV-YKPPVEKPPV------YKPPV------------EKPPVYKPPVEKPPVYKPP 409
           P+ Y PP EKPPV       KPPV            EKPP+  PP EKPPVY+PP
Sbjct: 308 PIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYEPP 362

 Score =  163 bits (412), Expect = 6e-39
 Identities = 85/144 (59%), Positives = 100/144 (69%), Gaps = 12/144 (8%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEK------PPVYKPPVEKPPV-YKPPV 172
           PPV+ PP EKPP   PP    P EKPP+++PP EK      PPV+ PP EKPP+ Y PP 
Sbjct: 2   PPVHPPPHEKPPIVHPP----PHEKPPLFEPPFEKPPPAHPPPVHPPPHEKPPIEYPPPH 57

Query: 173 EKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV- 337
            KPP+ Y PP  KPP+ Y PP EKPP+ Y  P EKPPVY+PP EK PPV+ PP EKPP+ 
Sbjct: 58  TKPPIEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIE 117

Query: 338 YKPPVEKPPVYKPPVEKPPVYKPP 409
           Y PP EKPPV++PP EKPP+  PP
Sbjct: 118 YSPPHEKPPVHEPPYEKPPLVHPP 141

 Score =  152 bits (383), Expect = 1e-35
 Identities = 78/131 (59%), Positives = 95/131 (72%), Gaps = 13/131 (9%)
 Frame = +2

Query: 56  TPPIYKPPVEKPP-VYKPPVEKPPVYKPPVEK------PPVYKPPVEKPPV-YKPPVEKP 211
           +PP++ PP EKPP V+ PP EKPP+++PP EK      PPV+ PP EKPP+ Y PP  KP
Sbjct: 1   SPPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPAHPPPVHPPPHEKPPIEYPPPHTKP 60

Query: 212 PV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKP 376
           P+ Y PP  KPP+ Y PP EKPP+ Y  P EKPPVY+PP EK PPV+ PP EKPP+ Y P
Sbjct: 61  PIEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSP 120

Query: 377 PVEKPPVYKPP 409
           P EKPPV++PP
Sbjct: 121 PHEKPPVHEPP 131

 Score =  152 bits (383), Expect = 1e-35
 Identities = 92/194 (47%), Positives = 106/194 (54%), Gaps = 59/194 (30%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPI-------YKPPVEKPPVYKPPVEKPP------------V 127
           +EKPPV++PP EKPP   PP        Y PP EKPPVY+PP E+ P            V
Sbjct: 219 LEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEKPPFV 278

Query: 128 YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV------YKPPVE------ 265
           Y PP EK P+++PP EK PPV+ PP EKPP+ Y PP EKPPV       KPPVE      
Sbjct: 279 YPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAE 338

Query: 266 ------KPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPP-------VYKP--------- 376
                 KPP+  PP EKPPVY+PP EKPP V  PP EKPP       +Y P         
Sbjct: 339 KPPTHEKPPIEFPPHEKPPVYEPPYEKPPSVCPPPHEKPPHHEKRSALYPPHHRKPPNHH 398

Query: 377 ---PVEKPPVYKPP 409
              P +KPP YK P
Sbjct: 399 KPLPYKKPPFYKSP 412

 Score =  137 bits (345), Expect = 4e-31
 Identities = 86/179 (48%), Positives = 100/179 (55%), Gaps = 49/179 (27%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPP-------IYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-Y 160
           EKPPVY+PP E+ P   PP       +Y PP EK P+++PP EK PPV+ PP EKPP+ Y
Sbjct: 252 EKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEY 311

Query: 161 KPPVEKPPV------YKPPVE------------KPPVYKPPVEKPPVYKPPVEKPP-VYK 283
            PP EKPPV       KPPVE            KPP+  PP EKPPVY+PP EKPP V  
Sbjct: 312 APPHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYEPPYEKPPSVCP 371

Query: 284 PPVEKPP-------VYKP------------PVEKPPVYK-PPVEKPPVYK-PPVEKPPV 397
           PP EKPP       +Y P            P +KPP YK PPVEKP  Y+  P  + PV
Sbjct: 372 PPHEKPPHHEKRSALYPPHHRKPPNHHKPLPYKKPPFYKSPPVEKPSSYESQPYGRLPV 430

[17][TOP]
>UniRef100_O24443 Cell wall type 2 proline rich protein PvPRP2-37 (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=O24443_PHAVU
          Length = 81

 Score =  183 bits (464), Expect = 6e-45
 Identities = 80/81 (98%), Positives = 80/81 (98%)
 Frame = +2

Query: 86  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 265
           KPPVY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 266 KPPVYKPPVEKPPVYKPPVEK 328
           KPPVYKPPVEKPPVYKPPVEK
Sbjct: 61  KPPVYKPPVEKPPVYKPPVEK 81

 Score =  183 bits (464), Expect = 6e-45
 Identities = 80/81 (98%), Positives = 80/81 (98%)
 Frame = +2

Query: 116 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 295
           KPPVY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 296 KPPVYKPPVEKPPVYKPPVEK 358
           KPPVYKPPVEKPPVYKPPVEK
Sbjct: 61  KPPVYKPPVEKPPVYKPPVEK 81

 Score =  183 bits (464), Expect = 6e-45
 Identities = 80/81 (98%), Positives = 80/81 (98%)
 Frame = +2

Query: 146 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 325
           KPPVY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 326 KPPVYKPPVEKPPVYKPPVEK 388
           KPPVYKPPVEKPPVYKPPVEK
Sbjct: 61  KPPVYKPPVEKPPVYKPPVEK 81

 Score =  181 bits (458), Expect = 3e-44
 Identities = 78/80 (97%), Positives = 79/80 (98%)
 Frame = +2

Query: 59  PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 238
           PP+Y PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK
Sbjct: 2   PPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 61

Query: 239 PPVYKPPVEKPPVYKPPVEK 298
           PPVYKPPVEKPPVYKPPVEK
Sbjct: 62  PPVYKPPVEKPPVYKPPVEK 81

 Score =  177 bits (450), Expect = 2e-43
 Identities = 77/78 (98%), Positives = 77/78 (98%)
 Frame = +2

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
           KPPVY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 356 KPPVYKPPVEKPPVYKPP 409
           KPPVYKPPVEKPPVYKPP
Sbjct: 61  KPPVYKPPVEKPPVYKPP 78

 Score =  176 bits (447), Expect = 6e-43
 Identities = 79/86 (91%), Positives = 80/86 (93%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPPVY PPVEKPP     +YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY
Sbjct: 1   KPPVYNPPVEKPP-----VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 55

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEK 268
           KPPVEKPPVYKPPVEKPPVYKPPVEK
Sbjct: 56  KPPVEKPPVYKPPVEKPPVYKPPVEK 81

 Score =  159 bits (403), Expect = 7e-38
 Identities = 72/78 (92%), Positives = 73/78 (93%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKPPVYKPPVEK     PP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 9   VEKPPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 63

Query: 185 VYKPPVEKPPVYKPPVEK 238
           VYKPPVEKPPVYKPPVEK
Sbjct: 64  VYKPPVEKPPVYKPPVEK 81

[18][TOP]
>UniRef100_UPI0001983482 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983482
          Length = 329

 Score =  181 bits (460), Expect = 2e-44
 Identities = 105/146 (71%), Positives = 118/146 (80%), Gaps = 13/146 (8%)
 Frame = +2

Query: 11  KPPVYKPPVE-KPP-EYTPPIYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVE 175
           KPPV KPP E KPP E  PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVE
Sbjct: 38  KPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVE 97

Query: 176 K-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPV 337
           K PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP 
Sbjct: 98  KPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPE 157

Query: 338 YKPPVEK-PPVYKPPVEK-PPVYKPP 409
           +KPPVEK PP +KPPVEK PP++KPP
Sbjct: 158 HKPPVEKPPPEHKPPVEKPPPLHKPP 183

 Score =  177 bits (449), Expect = 3e-43
 Identities = 103/148 (69%), Positives = 114/148 (77%), Gaps = 16/148 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPP 184
           PP +KPPVEKPP    P +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP
Sbjct: 34  PPEHKPPVEKPP----PEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPP 89

Query: 185 V-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKP 346
             +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KP
Sbjct: 90  PEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKP 149

Query: 347 PVEKP------PVYKPPVE-KPPVYKPP 409
           PVEKP      PV KPP E KPPV KPP
Sbjct: 150 PVEKPPPEHKPPVEKPPPEHKPPVEKPP 177

 Score =  172 bits (437), Expect = 8e-42
 Identities = 100/145 (68%), Positives = 114/145 (78%), Gaps = 18/145 (12%)
 Frame = +2

Query: 29  PPVEKPP-EYTPPI------YKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK 178
           PP EKPP E+ PP+      +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK
Sbjct: 28  PPFEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEK 87

Query: 179 -PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVY 340
            PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +
Sbjct: 88  PPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEH 147

Query: 341 KPPVEK-PPVYKPPVEK-PPVYKPP 409
           KPPVEK PP +KPPVEK PP +KPP
Sbjct: 148 KPPVEKPPPEHKPPVEKPPPEHKPP 172

 Score =  154 bits (390), Expect = 2e-36
 Identities = 96/147 (65%), Positives = 107/147 (72%), Gaps = 17/147 (11%)
 Frame = +2

Query: 5   VEKPPV-YKPPVEKPP-------EYTPPIYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-P 151
           VEKPP  +KPPVEKPP       E  PP +KPPVEK PP +KPPVEK PP++KPPVEK P
Sbjct: 129 VEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPLHKPPVEKPP 188

Query: 152 PVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPP 319
           P +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEKPP     
Sbjct: 189 PEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPP--PEH 246

Query: 320 VEKP-PVYKPPVEKPPVYKPPV-EKPP 394
            EKP P +KPP    PV KPP  EKPP
Sbjct: 247 KEKPLPEHKPPT---PVGKPPKGEKPP 270

 Score =  133 bits (335), Expect = 5e-30
 Identities = 91/174 (52%), Positives = 104/174 (59%), Gaps = 39/174 (22%)
 Frame = +2

Query: 5   VEKPPV-YKPPVEKPP-------EYTPPIYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-P 151
           VEKPP  +KPPVEKPP       E  PP++KPPVEK PP +KPPVEK PP +KPPVEK P
Sbjct: 151 VEKPPPEHKPPVEKPPPEHKPPVEKPPPLHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPP 210

Query: 152 PVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPV 322
           P +KPPVEK PP +KPPVEK PP +KPPVEKPP      EKP P +KPP    PV KPP 
Sbjct: 211 PEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPP--PEHKEKPLPEHKPPT---PVGKPPK 265

Query: 323 -EKPP----------------VYKPPVEKPPVYKPPVEKP--------PVYKPP 409
            EKPP                 YKPP +  P   P  ++P        P +KPP
Sbjct: 266 GEKPPHCGHNPGHPPAENAEDSYKPPRKIKPPSTPAEKQPGPGKKLPTPPHKPP 319

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 68/146 (46%), Positives = 77/146 (52%), Gaps = 11/146 (7%)
 Frame = +2

Query: 5   VEKPPV-YKPPVEKPP-------EYTPPIYKPPVEK-PPVYKPPVEKPPVYKPPVEKP-P 154
           VEKPP  +KPPVEKPP       E  PP +KPPVEK PP +KPPVEKPP      EKP P
Sbjct: 195 VEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPP--PEHKEKPLP 252

Query: 155 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKP 331
            +KPP    PV KPP  + P   P     P + P       YKPP + KPP    P EK 
Sbjct: 253 EHKPPT---PVGKPPKGEKP---PHCGHNPGHPPAENAEDSYKPPRKIKPP--STPAEKQ 304

Query: 332 PVYKPPVEKPPVYKPPVEKPPVYKPP 409
           P     +  PP +KPP  KPP    P
Sbjct: 305 PGPGKKLPTPP-HKPP-HKPPTPTHP 328

[19][TOP]
>UniRef100_Q41402 Nodulin n=1 Tax=Sesbania rostrata RepID=Q41402_SESRO
          Length = 330

 Score =  177 bits (450), Expect = 2e-43
 Identities = 95/145 (65%), Positives = 97/145 (66%), Gaps = 13/145 (8%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PPVY PP EKPP   PP Y+  PP EKPP  KPP EKPP  KPP EKPP  KPP EKPP 
Sbjct: 175 PPVYPPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYEKPPHEKPPHEKPPYDKPPYEKPPH 234

Query: 188 YKPPVEK------PPVYKPPVEK-PPVYKPPVEKPPVY-KPPVEK-PPVYKPPVEK--PP 334
            KPP EK      PP YKPP EK PP YKPP EKPP Y KPP EK PP YKPP EK  PP
Sbjct: 235 EKPPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPHEKPPPP 294

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKPP 409
            Y P V+ PP YKPP EKPP Y PP
Sbjct: 295 EYPPYVKPPPEYKPPHEKPPGYNPP 319

 Score =  171 bits (433), Expect = 2e-41
 Identities = 97/157 (61%), Positives = 100/157 (63%), Gaps = 25/157 (15%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-------EYTPPIYKPPVEKPPVYKPP-VEKPPVY-KPPVEKPPVYKP 166
           PP Y+PP EKPP       E  PP+Y PP EKPP  KPP  EKPP Y KPP EKPP  KP
Sbjct: 153 PPEYQPPHEKPPPEYQPPQEKPPPVYPPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYEKP 212

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVY 340
           P EKPP  KPP +KPP  KPP EKPP  KPP EK PP YKPP EK PP YKPP EKPP Y
Sbjct: 213 PHEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPPPY 272

Query: 341 -KPPVEK-PPVYKPPVEK------------PPVYKPP 409
            KPP EK PP YKPP EK            PP YKPP
Sbjct: 273 EKPPHEKPPPEYKPPHEKPPPPEYPPYVKPPPEYKPP 309

 Score =  169 bits (428), Expect = 9e-41
 Identities = 98/159 (61%), Positives = 107/159 (67%), Gaps = 24/159 (15%)
 Frame = +2

Query: 5   VEKPPVYKPP--VEKPPE-YTPPIYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKP 166
           +EKPP Y+PP   EKPP  Y PPI+ PP EK PPVY PP EK PPVY PP EK PPVY P
Sbjct: 33  IEKPPTYEPPPTYEKPPPVYKPPIFPPPYEKPPPVYSPPYEKPPPVYPPPYEKPPPVYPP 92

Query: 167 PVEK-PPVYKPPVEK------------PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK- 298
           P EK PP Y+PP EK            PP Y+PP EK PP Y+PP EK PP Y+PP EK 
Sbjct: 93  PYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKP 152

Query: 299 PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPP 409
           PP Y+PP EK PP Y+PP EK PPVY PP EKPP  KPP
Sbjct: 153 PPEYQPPHEKPPPEYQPPQEKPPPVYPPPYEKPPHEKPP 191

 Score =  164 bits (414), Expect = 4e-39
 Identities = 94/149 (63%), Positives = 102/149 (68%), Gaps = 17/149 (11%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-------EYTPPIYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYK 163
           PPVY PP EKPP       E  PP+Y PP EK PP Y+PP EK PP Y+PP E  PP Y+
Sbjct: 65  PPVYSPPYEKPPPVYPPPYEKPPPVYPPPYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQ 124

Query: 164 PPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK 328
           PP EK PP Y+PP EK PP Y+PP EK PP Y+PP EK PP Y+PP EK PPVY PP EK
Sbjct: 125 PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPPVYPPPYEK 184

Query: 329 PPVYKPP-VEKPPVY-KPPVEKPPVYKPP 409
           PP  KPP  EKPP Y KPP EKPP  KPP
Sbjct: 185 PPHEKPPSYEKPPPYEKPPHEKPPYEKPP 213

 Score =  160 bits (406), Expect = 3e-38
 Identities = 94/158 (59%), Positives = 101/158 (63%), Gaps = 26/158 (16%)
 Frame = +2

Query: 14  PPVYKPPVEK-----PPEY--TPPIYKPPVEK------------PPVYKPPVEK-PPVYK 133
           PPVY PP EK     PP Y   PP Y+PP EK            PP Y+PP EK PP Y+
Sbjct: 76  PPVYPPPYEKPPPVYPPPYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQ 135

Query: 134 PPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPP-VEK 298
           PP EK PP Y+PP EK PP Y+PP EK PP Y+PP EK PPVY PP EKPP  KPP  EK
Sbjct: 136 PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPPVYPPPYEKPPHEKPPSYEK 195

Query: 299 PPVY-KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PP Y KPP EKPP  KPP EKPP  KPP +KPP  KPP
Sbjct: 196 PPPYEKPPHEKPPYEKPPHEKPPHEKPPYDKPPYEKPP 233

 Score =  159 bits (402), Expect = 9e-38
 Identities = 90/140 (64%), Positives = 101/140 (72%), Gaps = 13/140 (9%)
 Frame = +2

Query: 29  PPVEKPPEYTPP-IYK--PPVEKPPVYKPPVEKPP-VYKPPVEK-PPVYKPPVEK-PPVY 190
           PP+EKPP Y PP  Y+  PPV KPP++ PP EKPP VY PP EK PPVY PP EK PPVY
Sbjct: 31  PPIEKPPTYEPPPTYEKPPPVYKPPIFPPPYEKPPPVYSPPYEKPPPVYPPPYEKPPPVY 90

Query: 191 KPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVE 355
            PP EK PP Y+PP EK PP Y+PP E  PP Y+PP EK PP Y+PP EK PP Y+PP E
Sbjct: 91  PPPYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHE 150

Query: 356 K-PPVYKPPVEK-PPVYKPP 409
           K PP Y+PP EK PP Y+PP
Sbjct: 151 KPPPEYQPPHEKPPPEYQPP 170

 Score =  156 bits (395), Expect = 6e-37
 Identities = 86/138 (62%), Positives = 89/138 (64%), Gaps = 4/138 (2%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-P 181
           EKPP  KPP EKPP   PP  KPP +KPP  KPP EKPP  KPP EK PP YKPP EK P
Sbjct: 200 EKPPHEKPPYEKPPHEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPPPEYKPPHEKPP 259

Query: 182 PVYKPPVEKPPVY-KPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
           P YKPP EKPP Y KPP EK PP YKPP EKPP        PP Y P V+ PP YKPP E
Sbjct: 260 PEYKPPHEKPPPYEKPPHEKPPPEYKPPHEKPP--------PPEYPPYVKPPPEYKPPHE 311

Query: 356 KPPVYKPPVEKPPVYKPP 409
           KPP Y PP   P  + PP
Sbjct: 312 KPPGYNPP---PYGHYPP 326

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 4/50 (8%)
 Frame = +2

Query: 272 PVYKPPVEKPPVYKPPV-EKPPVYK--PPVEKPPVYKPPVEK-PPVYKPP 409
           PV     E PP+ KPP  E PP Y+  PPV KPP++ PP EK PPVY PP
Sbjct: 22  PVLANYYEPPPIEKPPTYEPPPTYEKPPPVYKPPIFPPPYEKPPPVYSPP 71

[20][TOP]
>UniRef100_A9VE05 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9VE05_MONBE
          Length = 1536

 Score =  176 bits (446), Expect = 7e-43
 Identities = 73/127 (57%), Positives = 89/127 (70%)
 Frame = +2

Query: 26   KPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 205
            KPPV +PP   PP+ +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  
Sbjct: 1244 KPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAA 1303

Query: 206  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 385
            KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP  
Sbjct: 1304 KPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAA 1363

Query: 386  KPPVYKP 406
            KPPV +P
Sbjct: 1364 KPPVVEP 1370

 Score =  168 bits (425), Expect = 2e-40
 Identities = 70/124 (56%), Positives = 86/124 (69%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V +PP  KPPV +PP   PP+ +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPP
Sbjct: 1247 VVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPP 1306

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP  KPP
Sbjct: 1307 VVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPP 1366

Query: 365  VYKP 376
            V +P
Sbjct: 1367 VVEP 1370

 Score =  167 bits (423), Expect = 3e-40
 Identities = 69/127 (54%), Positives = 85/127 (66%)
 Frame = +2

Query: 29   PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 208
            P  +      PP+ +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  K
Sbjct: 1235 PTADSSAAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAK 1294

Query: 209  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 388
            PP+ +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  K
Sbjct: 1295 PPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAK 1354

Query: 389  PPVYKPP 409
            PPV +PP
Sbjct: 1355 PPVVEPP 1361

 Score =  159 bits (401), Expect = 1e-37
 Identities = 69/130 (53%), Positives = 82/130 (63%)
 Frame = +2

Query: 20   VYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 199
            V KP  E      P        KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP
Sbjct: 1222 VAKPKTEPVDAEAPTADSSAAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPP 1281

Query: 200  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 379
              KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP
Sbjct: 1282 AAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPP 1341

Query: 380  VEKPPVYKPP 409
              KPPV +PP
Sbjct: 1342 AAKPPVVEPP 1351

 Score =  139 bits (349), Expect = 1e-31
 Identities = 66/136 (48%), Positives = 79/136 (58%), Gaps = 5/136 (3%)
 Frame = +2

Query: 17   PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV-----EKP 181
            PV KP  E P      + KP  E      P  +     KPPV +PP  KPPV      KP
Sbjct: 1209 PVAKPRPEAPAS---EVAKPKTEPVDAEAPTADSSAAAKPPVVEPPAAKPPVVEPPAAKP 1265

Query: 182  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
            PV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP  KP
Sbjct: 1266 PVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKP 1325

Query: 362  PVYKPPVEKPPVYKPP 409
            PV +PP  KPP+ +PP
Sbjct: 1326 PVVEPPAAKPPLVEPP 1341

[21][TOP]
>UniRef100_Q9ZQI0 Putative uncharacterized protein At2g27380 n=1 Tax=Arabidopsis
           thaliana RepID=Q9ZQI0_ARATH
          Length = 761

 Score =  175 bits (443), Expect = 2e-42
 Identities = 80/165 (48%), Positives = 106/165 (64%), Gaps = 30/165 (18%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEK-------PPVYKPPVEKP--PVYKPPVEKPPV 157
           +  PP+Y PP++KPP Y+PPIY PP++K       PP+Y PP++KP  P Y PP+  PP+
Sbjct: 62  IYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPI 121

Query: 158 YKPPVE--KPPVYKPPVEKPPV--YKPPVEKPPV-------YKPPVEKPPVYKPPVE--- 295
            KPP     PP+Y PP++KPP   Y PPV+ PPV       Y PP++ PPV+KPP     
Sbjct: 122 QKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYS 181

Query: 296 ---KPPVYKP--PVEKPPVYKPPVEKP--PVYKPPVEKPPVYKPP 409
              KPPV+KP  P+  PP+  PPV KP  P+Y PP++ PPV+KPP
Sbjct: 182 PPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPP 226

 Score =  164 bits (415), Expect = 3e-39
 Identities = 79/150 (52%), Positives = 100/150 (66%), Gaps = 15/150 (10%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKP--PEYTPPIYKPPVEKP--PVYKPPVEKPPVYKP--PVEKPPVYKP 166
           +  PP+  PPV KP  P Y+PP+  PPV KP  P+Y PP++ PPV+KP  P+  PPV  P
Sbjct: 212 IYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPP 271

Query: 167 PVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE- 325
           PV+ P  P+Y PPV+ PPV+KPP     PPV  PPV+KP  P Y PP++ PPV KPP   
Sbjct: 272 PVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPT 331

Query: 326 -KPPVYKPPVEKP-PVYKPPVEKPPVYKPP 409
             PP+  PPV+ P P+Y PPV+ PPV+KPP
Sbjct: 332 YSPPIKPPPVKPPTPIYSPPVKPPPVHKPP 361

 Score =  164 bits (414), Expect = 4e-39
 Identities = 78/165 (47%), Positives = 102/165 (61%), Gaps = 33/165 (20%)
 Frame = +2

Query: 14  PPVYKPP----VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVE 175
           PP+Y  P       PP Y+PPIY PP++KPP Y PP+  PP+ KPP     PP+Y PP++
Sbjct: 46  PPIYGAPPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQ 105

Query: 176 K-------PPVYKPPVEK-------PPVYKPPVEKPPV--YKPPVEKPPV-------YKP 286
           K       PP+Y PP++K       PP+Y PP++KPP   Y PPV+ PPV       Y P
Sbjct: 106 KPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSP 165

Query: 287 PVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPP 409
           P++ PPV+KPP     PP+ KPPV KP  P+Y PP++ PPV+KPP
Sbjct: 166 PIKPPPVHKPPTPTYSPPI-KPPVHKPPTPIYSPPIKPPPVHKPP 209

 Score =  164 bits (414), Expect = 4e-39
 Identities = 80/146 (54%), Positives = 98/146 (67%), Gaps = 11/146 (7%)
 Frame = +2

Query: 5   VEKPP--VYKPPVEKPPEYTPP--IYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVY 160
           V KPP  +Y PPV+ PP  TPP  IY PPV+ PPV+KPP     PPV  PPV+KP  P Y
Sbjct: 256 VHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTY 315

Query: 161 KPPVEKPPVYKPPVE--KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
            PP++ PPV KPP     PP+  PPV+ P P+Y PPV+ PPV+KPP    P+Y PPV+ P
Sbjct: 316 SPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPT---PIYSPPVKPP 372

Query: 332 PVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PV+KPP    P+Y PPV+ PP+ KPP
Sbjct: 373 PVHKPPT---PIYSPPVKPPPIQKPP 395

 Score =  161 bits (407), Expect = 2e-38
 Identities = 82/160 (51%), Positives = 102/160 (63%), Gaps = 25/160 (15%)
 Frame = +2

Query: 5   VEKPPV--YKPPVEKPPEYTPP--IYKPPVEKPPVYKP--PVEKPPVYKPPVEKP--PVY 160
           V KPP   Y PPV+ PP + PP  IY PP++ PPV+KP  P+  PPV  PPV+ P  P+Y
Sbjct: 222 VHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIY 281

Query: 161 KPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPV-------YKPPVEKPPV 307
            PPV+ PPV+KPP     PPV  PPV+KP  P Y PP++ PPV       Y PP++ PPV
Sbjct: 282 SPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPV 341

Query: 308 ------YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
                 Y PPV+ PPV+KPP    P+Y PPV+ PPV+KPP
Sbjct: 342 KPPTPIYSPPVKPPPVHKPPT---PIYSPPVKPPPVHKPP 378

 Score =  160 bits (406), Expect = 3e-38
 Identities = 77/145 (53%), Positives = 99/145 (68%), Gaps = 10/145 (6%)
 Frame = +2

Query: 5   VEKPPV--YKPPVEKPPEYTP-PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP--P 169
           V+KPP   Y PP++ PP   P PIY PPV+ PPV+KPP    P+Y PPV+ PPV+KP  P
Sbjct: 324 VQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPT---PIYSPPVKPPPVHKPPTP 380

Query: 170 VEKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP-PVYKPPVEKPP 334
           +  PPV  PP++KP  P Y PP++ PP+ KPP     PP+  PPV+ P P+Y PPV+ PP
Sbjct: 381 IYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPP 440

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKPP 409
           V+KPP    P+Y PPV+ PPV+KPP
Sbjct: 441 VHKPPT---PIYSPPVKPPPVHKPP 462

 Score =  158 bits (400), Expect = 2e-37
 Identities = 77/152 (50%), Positives = 96/152 (63%), Gaps = 17/152 (11%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKP--PEYTPPIYKPPVEKP-PVYKPPVEKPPVYKPPVE--KPPVYKPP 169
           +  PPV  PPV KP  P Y+PPI  PPV+ P P Y PPV+ PPV KPP     PPV  PP
Sbjct: 448 IYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPP 507

Query: 170 VEKP--PVYKPPVEKPPV------YKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYK 313
           ++KP  P Y PP++ PPV      Y PP++ PPV+KPP     PP+  PP+ KP  P Y 
Sbjct: 508 IQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYS 567

Query: 314 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PP++ PPV+KPP    P Y PP++ PPV+KPP
Sbjct: 568 PPIKPPPVHKPPT---PTYSPPIKPPPVHKPP 596

 Score =  155 bits (393), Expect = 1e-36
 Identities = 77/156 (49%), Positives = 96/156 (61%), Gaps = 21/156 (13%)
 Frame = +2

Query: 5   VEKPPV--YKPPVEKPPEYTP-PIYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYK 163
           V KPP   Y PP++ PP   P P Y PPV+ PPV KPP     PPV  PP++KP  P Y 
Sbjct: 458 VHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYS 517

Query: 164 PPVEKPPV------YKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYK 313
           PP++ PPV      Y PP++ PPV+KPP     PP+  PP+ KP  P Y PP++ PPV+K
Sbjct: 518 PPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHK 577

Query: 314 PPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPP 409
           PP     PP+  PPV KP  P Y PP++ PPV+KPP
Sbjct: 578 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 613

 Score =  155 bits (393), Expect = 1e-36
 Identities = 72/146 (49%), Positives = 94/146 (64%), Gaps = 11/146 (7%)
 Frame = +2

Query: 5   VEKPPV--YKPPVEKPPEYTP-PIYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYK 163
           ++KPP   Y PP++ PP   P P Y PP++ PPV+KPP     PP+  PP+ KP  P Y 
Sbjct: 508 IQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYS 567

Query: 164 PPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
           PP++ PPV+KPP     PP+  PPV KP  P Y PP++ PPV+KPP    P Y PP++ P
Sbjct: 568 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPT---PTYSPPIKPP 624

Query: 332 PVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PV+KPP    P Y PP++ PPV+KPP
Sbjct: 625 PVHKPPT---PTYSPPIKPPPVHKPP 647

 Score =  155 bits (391), Expect = 2e-36
 Identities = 77/151 (50%), Positives = 96/151 (63%), Gaps = 20/151 (13%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPP--IYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEK 178
           P+Y PPV+ PP + PP  IY PPV+ PPV+KPP     PP+ KPP  KP  P Y PPV+ 
Sbjct: 430 PIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPI-KPPPVKPPTPTYSPPVQP 488

Query: 179 PPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPV------YKPPVEKPPVYKPPVE- 325
           PPV KPP     PPV  PP++KP  P Y PP++ PPV      Y PP++ PPV+KPP   
Sbjct: 489 PPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPT 548

Query: 326 -KPPVYKPPVEKP--PVYKPPVEKPPVYKPP 409
             PP+  PP+ KP  P Y PP++ PPV+KPP
Sbjct: 549 YSPPIKPPPIHKPPTPTYSPPIKPPPVHKPP 579

 Score =  155 bits (391), Expect = 2e-36
 Identities = 76/151 (50%), Positives = 93/151 (61%), Gaps = 19/151 (12%)
 Frame = +2

Query: 14  PPVYKPPVEKPPE--YTPPIYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKPPVE 175
           PP+  PPV KPP   Y+PPI  PP+ KPP   Y PP++ PPV+KPP     PP+  PPV 
Sbjct: 534 PPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVH 593

Query: 176 KPPV--YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPV 337
           KPP   Y PP++ PPV+KPP     PP+  PPV KPP   Y PP++ PPV+KPP    P 
Sbjct: 594 KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPT---PT 650

Query: 338 YKPPVEKPPV-------YKPPVEKPPVYKPP 409
           Y PP++ PPV       Y PPV+ PPV  PP
Sbjct: 651 YSPPIKPPPVQKPPTPTYSPPVKPPPVQLPP 681

 Score =  144 bits (362), Expect = 4e-33
 Identities = 77/161 (47%), Positives = 92/161 (57%), Gaps = 29/161 (18%)
 Frame = +2

Query: 14   PPVYKPPVEKPPE--YTPPIYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
            PP+  PPV KPP   Y+PPI  PPV KPP   Y PP++ PPV+KPP    P Y PP++ P
Sbjct: 585  PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPT---PTYSPPIKPP 641

Query: 182  PVYKPPVE--KPPVYKPPVEKPPV--YKPPVEKPPV-------YKPPVEKPPV------- 307
            PV+KPP     PP+  PPV+KPP   Y PPV+ PPV       Y PPV+ PPV       
Sbjct: 642  PVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPT 701

Query: 308  YKPPVEKPPV-------YKPPVEKPPVYKPPVEKPPVYKPP 409
            Y PPV+ PPV       Y PP++ PPV  PP    P   PP
Sbjct: 702  YSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTP--SPP 740

 Score =  115 bits (287), Expect = 2e-24
 Identities = 63/134 (47%), Positives = 71/134 (52%), Gaps = 5/134 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPE--YTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PP+  PPV KPP   Y+PPI  PPV+KPP         P Y PPV+ PPV  PP    P 
Sbjct: 636 PPIKPPPVHKPPTPTYSPPIKPPPVQKPPT--------PTYSPPVKPPPVQLPPT---PT 684

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           Y PPV+ PPV  PP    P Y PPV+ PPV  PP    P Y PP++ PPV  PP    P 
Sbjct: 685 YSPPVKPPPVQVPPT---PTYSPPVKPPPVQVPPT---PTYSPPIKPPPVQVPPTPTTP- 737

Query: 368 YKPP---VEKPPVY 400
             PP      PP Y
Sbjct: 738 -SPPQGGYGTPPPY 750

[22][TOP]
>UniRef100_O49151 Early nodulin (Fragment) n=1 Tax=Maackia amurensis
           RepID=O49151_9FABA
          Length = 447

 Score =  174 bits (440), Expect = 4e-42
 Identities = 97/146 (66%), Positives = 107/146 (73%), Gaps = 12/146 (8%)
 Frame = +2

Query: 8   EKPPVY-KPPVEKPP-EYTPPIYKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPV 172
           EKPP+   PP EKPP E  PP Y+PP EK PP+Y PP EKPP+ Y PP EK PPVY+PP 
Sbjct: 236 EKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPY 295

Query: 173 EKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PP 334
           EKPP+ Y PP EK PPVY+PP EK PPVY PP EKPP+ Y PP EK PPVY+PP EK PP
Sbjct: 296 EKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPP 355

Query: 335 VYKPPVEKPPV-YKPPVEKPPVYKPP 409
            Y PP EKPP+ Y PP EKPP  KPP
Sbjct: 356 TYPPPHEKPPIEYPPPHEKPPYEKPP 381

 Score =  172 bits (435), Expect = 1e-41
 Identities = 95/149 (63%), Positives = 105/149 (70%), Gaps = 17/149 (11%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-EYTPPIYKPPVE-------KPPVYKPPVEK-PPVYKPPVEKPPV-YK 163
           PP Y+PP EKPP EY PP  KPP E        PP Y+PP EK PP+Y PP EKPP+ Y 
Sbjct: 96  PPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYP 155

Query: 164 PPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEK 328
           PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP EKPP+ Y PP EK
Sbjct: 156 PPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEK 215

Query: 329 -PPVYKPPVEK-PPVYKPPVEKPPVYKPP 409
            PPVY+PP EK PP Y PP EKPP+  PP
Sbjct: 216 LPPVYQPPYEKPPPTYPPPHEKPPIEYPP 244

 Score =  172 bits (435), Expect = 1e-41
 Identities = 96/153 (62%), Positives = 108/153 (70%), Gaps = 18/153 (11%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPP--EYTPPIYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV----- 157
           V  PP  KPP+E PP  E  PP+Y+PP EK PP Y PP EKPP+ Y PP EKPP      
Sbjct: 197 VYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPP 256

Query: 158 -YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPP 319
            Y+PP EK PP+Y PP EKPP+ Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP
Sbjct: 257 EYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPP 316

Query: 320 VEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPP 409
            EK PPVY PP EKPP+ Y PP EK PPVY+PP
Sbjct: 317 YEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPP 349

 Score =  171 bits (433), Expect = 2e-41
 Identities = 95/151 (62%), Positives = 104/151 (68%), Gaps = 17/151 (11%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYT--PPIYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPPV-YKPPV 172
           EKPP  KPP E  P Y   PP+Y PP EKPP+ Y PP EKPP VY+PP EKPP+ Y PP 
Sbjct: 247 EKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPH 306

Query: 173 EKPP-VYKPPVEKPP-VYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPV 337
           EKPP VY+PP EKPP VY PP EKPP+ Y PP EK PPVY+PP EKPP  Y PP EKPP+
Sbjct: 307 EKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPI 366

Query: 338 -YKPPVEK------PPVYKPPVEKPPVYKPP 409
            Y PP EK      PP+Y PP EKPP   PP
Sbjct: 367 EYPPPHEKPPYEKPPPLYPPPYEKPPPLYPP 397

 Score =  171 bits (432), Expect = 3e-41
 Identities = 94/147 (63%), Positives = 104/147 (70%), Gaps = 15/147 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPV-YKPPVEKPPV------YKPPVEK-PPVYKPP 169
           PPVY+PP EKPP    P Y PP EKPP+ Y PP EKPP       Y+PP EK PP+Y PP
Sbjct: 217 PPVYQPPYEKPP----PTYPPPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPP 272

Query: 170 VEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPP 334
            EKPP+ Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP EKPP
Sbjct: 273 HEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPP 332

Query: 335 V-YKPPVEK-PPVYKPPVEKPPVYKPP 409
           + Y PP EK PPVY+PP EKPP   PP
Sbjct: 333 IEYPPPHEKLPPVYQPPYEKPPPTYPP 359

 Score =  170 bits (431), Expect = 4e-41
 Identities = 93/142 (65%), Positives = 103/142 (72%), Gaps = 10/142 (7%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-P 181
           PP Y+PP EKPP    P+Y PP EKPP+ Y PP EK PPVY+PP EKPP+ Y PP EK P
Sbjct: 129 PPEYQPPYEKPP----PLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPP 184

Query: 182 PVYKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKP 346
           PVY+PP EK PPVY PP EKPP+ Y PP EK PPVY+PP EK PP Y PP EKPP+ Y P
Sbjct: 185 PVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPP 244

Query: 347 PVEKPPVYKPPVE-KPPVYKPP 409
           P EKPP  KPP E +PP  KPP
Sbjct: 245 PHEKPPYEKPPPEYQPPYEKPP 266

 Score =  170 bits (430), Expect = 5e-41
 Identities = 96/172 (55%), Positives = 106/172 (61%), Gaps = 40/172 (23%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-------EYTPPIYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP-VYK 163
           PP+Y PP EKPP       E  PP+Y+PP EKPP+ Y PP EKPP VY+PP EKPP VY 
Sbjct: 266 PPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYP 325

Query: 164 PPVEKPPV-YKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPV--- 322
           PP EKPP+ Y PP EK PPVY+PP EKPP  Y PP EKPP+ Y PP EKPP  KPP    
Sbjct: 326 PPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYP 385

Query: 323 ---------------------EKPPVYKPPVEKPPVYK--PPVEKPPVYKPP 409
                                EKPP YKPPV +PP  +  PPVEKPP YKPP
Sbjct: 386 PPYEKPPPLYPPPHHHKPPHHEKPPFYKPPVYEPPPLEKPPPVEKPPSYKPP 437

 Score =  168 bits (426), Expect = 2e-40
 Identities = 94/149 (63%), Positives = 104/149 (69%), Gaps = 17/149 (11%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-EYTPPIYKPPVE-------KPPVYKPPVEK-PPVYKPPVEK-PPVYK 163
           PP Y+PP EKPP EY PP  KPP E        PP + PP EK PP Y+PP EK PP+Y 
Sbjct: 85  PPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYP 144

Query: 164 PPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEK 328
           PP EKPP+ Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP EK
Sbjct: 145 PPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEK 204

Query: 329 PPV-YKPPVEK-PPVYKPPVEKPPVYKPP 409
           PP+ Y PP EK PPVY+PP EKPP   PP
Sbjct: 205 PPIEYPPPHEKLPPVYQPPYEKPPPTYPP 233

 Score =  167 bits (423), Expect = 3e-40
 Identities = 95/152 (62%), Positives = 106/152 (69%), Gaps = 18/152 (11%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPP-EYTPPIYKPPVE-------KPPVYKPPVEK-PPVYKPPVEK-PPV 157
           + PP Y+PP EKPP EY PP  KPP E        PP Y PP EK PP + PP EK PP 
Sbjct: 72  QPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPE 131

Query: 158 YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPV 322
           Y+PP EK PP+Y PP EKPP+ Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP 
Sbjct: 132 YQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPY 191

Query: 323 EK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPP 409
           EK PPVY PP EKPP+ Y PP EK PPVY+PP
Sbjct: 192 EKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPP 223

 Score =  164 bits (416), Expect = 2e-39
 Identities = 93/153 (60%), Positives = 104/153 (67%), Gaps = 18/153 (11%)
 Frame = +2

Query: 5   VEKPPVYKPPVE--KPPEYTPPIYKPPVE-------KPPVYKPPVEK-PPVYKPPVEK-P 151
           V+ PP Y+PP E   PPEY PP  KPP E        PP Y+PP EK PP Y PP EK P
Sbjct: 59  VKPPPEYEPPPEYQPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPP 118

Query: 152 PVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKP 316
           P + PP EK PP Y+PP EK PP+Y PP EKPP+ Y PP EK PPVY+PP EKPP+ Y P
Sbjct: 119 PEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPP 178

Query: 317 PVEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPP 409
           P EK PPVY+PP EK PPVY PP EKPP+  PP
Sbjct: 179 PHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPP 211

 Score =  159 bits (401), Expect = 1e-37
 Identities = 94/161 (58%), Positives = 106/161 (65%), Gaps = 27/161 (16%)
 Frame = +2

Query: 8   EKPPVYKPP-VEKPP--------EYTPPIYKPPVE--------KPPVYKPPVEK-PPVYK 133
           EKPP Y+PP +EKPP         Y PP  KPP E         PP Y+PP EK PP Y+
Sbjct: 30  EKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQPPHEKPPPEYQ 89

Query: 134 PPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK 298
           PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK PP+Y PP EK
Sbjct: 90  PPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEK 149

Query: 299 PPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPP 409
           PP+ Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP
Sbjct: 150 PPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPP 190

 Score =  157 bits (398), Expect = 3e-37
 Identities = 90/159 (56%), Positives = 105/159 (66%), Gaps = 26/159 (16%)
 Frame = +2

Query: 11  KPPVYKPP-VEKPPEY-------TPPIYKPP--------VEKPPVYKPPVE--KPPVYKP 136
           KPP+Y+PP  EKPP Y        PP+Y+PP        V+ PP Y+PP E   PP Y+P
Sbjct: 20  KPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQP 79

Query: 137 PVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK- 298
           P EK PP Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK 
Sbjct: 80  PHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKP 139

Query: 299 PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPVYKPP 409
           PP+Y PP EKPP+ Y PP EK PPVY+PP EKPP+  PP
Sbjct: 140 PPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPP 178

 Score =  150 bits (380), Expect = 3e-35
 Identities = 87/157 (55%), Positives = 96/157 (61%), Gaps = 35/157 (22%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-------EYTPPIYKPPVEKPP-VYKPPVEKPPV-YKPPVEK-PPVYK 163
           PPVY+PP EKPP       E  PP+Y+PP EKPP VY PP EKPP+ Y PP EK PPVY+
Sbjct: 288 PPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQ 347

Query: 164 PPVEKPP-VYKPPVEKPPV-YKPPVEKPP------VYKPPVEKPPVYKPPV--------E 295
           PP EKPP  Y PP EKPP+ Y PP EKPP      +Y PP EKPP   PP         E
Sbjct: 348 PPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHE 407

Query: 296 KPPVYKPPV-------EKPPVYKPPVEKPPVYK--PP 379
           KPP YKPPV       + PPV KPP  KPP Y+  PP
Sbjct: 408 KPPFYKPPVYEPPPLEKPPPVEKPPSYKPPPYRHYPP 444

 Score =  141 bits (356), Expect = 2e-32
 Identities = 81/138 (58%), Positives = 94/138 (68%), Gaps = 19/138 (13%)
 Frame = +2

Query: 53  YTPPIYKPP-VEKPPVYKPP-VEK-PPVYKPP--------VEKPPVYKPPVE--KPPVYK 193
           Y PPIY+PP  EKPP Y+PP +EK PPVY+PP        V+ PP Y+PP E   PP Y+
Sbjct: 19  YKPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQ 78

Query: 194 PPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK 358
           PP EK PP Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK
Sbjct: 79  PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEK 138

Query: 359 -PPVYKPPVEKPPVYKPP 409
            PP+Y PP EKPP+  PP
Sbjct: 139 PPPLYPPPHEKPPIEYPP 156

 Score =  108 bits (271), Expect = 1e-22
 Identities = 65/118 (55%), Positives = 73/118 (61%), Gaps = 3/118 (2%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVY-KPPVEK-PPVYKPPVEKPPVYKPPVEK 178
           V +PP  KP    PP Y PP  KPP+E PP + KPP EK PP+Y PP EKPP   PP   
Sbjct: 345 VYQPPYEKP----PPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPP--- 397

Query: 179 PPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           P  +KPP  EKPP YKPPV +P    PP+EKP    PPVEKPP YKPP   P  + PP
Sbjct: 398 PHHHKPPHHEKPPFYKPPVYEP----PPLEKP----PPVEKPPSYKPP---PYRHYPP 444

[23][TOP]
>UniRef100_P06600 Proline-rich 33 kDa extensin-related protein (Fragment) n=1
           Tax=Daucus carota RepID=PRP33_DAUCA
          Length = 211

 Score =  173 bits (439), Expect = 5e-42
 Identities = 91/159 (57%), Positives = 108/159 (67%), Gaps = 32/159 (20%)
 Frame = +2

Query: 29  PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVE---------- 175
           PP+ KPP YTPP++KPP+ KPPVY PPV KPPVY PPV KPP  YKPPVE          
Sbjct: 20  PPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHY 79

Query: 176 ---KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKP-----------PVYKP-PVEKPPV 307
              KPPVYKPPV+KP P +KPPV KPP++KPPV              P++KP P+ +PPV
Sbjct: 80  PIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPV 139

Query: 308 YKPPVE-KPPVYKPPVE-KP-PVYKPP-VEKP-PVYKPP 409
           +KPP E KPPV++P  E KP PVY+PP  EKP P +KPP
Sbjct: 140 HKPPTEHKPPVHEPATEHKPSPVYQPPKTEKPVPEHKPP 178

 Score =  169 bits (429), Expect = 7e-41
 Identities = 92/167 (55%), Positives = 109/167 (65%), Gaps = 32/167 (19%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPP-VYKPPVE------------ 145
           + KPPVY PPV KPP + PP+Y PPV KPPVY PPV KPP  YKPPVE            
Sbjct: 22  IHKPPVYTPPVHKPPIHKPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHYPI 81

Query: 146 -KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKP-----------PVYKP-PVEKPPVYK 283
            KPPVYKPPV+KP P +KPPV KPP++KPPV              P++KP P+ +PPV+K
Sbjct: 82  HKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPVHK 141

Query: 284 PPVE-KPPVYKPPVE-KP-PVYKPP-VEKP-PVYKPPVEKPPVYKPP 409
           PP E KPPV++P  E KP PVY+PP  EKP P +KPP   P V +PP
Sbjct: 142 PPTEHKPPVHEPATEHKPSPVYQPPKTEKPVPEHKPPHLPPIVVRPP 188

 Score =  105 bits (262), Expect = 2e-21
 Identities = 68/174 (39%), Positives = 80/174 (45%), Gaps = 67/174 (38%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVE-------------------KPPVYKPPVEKP-P 124
           + KPPVY PPV KPP YTPP++KPP E                   KPPVYKPPV+KP P
Sbjct: 37  IHKPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHYPIHKPPVYKPPVQKPAP 96

Query: 125 VYKPPVEKPPVYKPPVE----------------------KPPVYKPPVE-KPPVY----- 220
            +KPPV KPP++KPPV                       +PPV+KPP E KPPV+     
Sbjct: 97  EHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPVHKPPTEHKPPVHEPATE 156

Query: 221 -------------------KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 325
                              KPP   P V +PP    P   PP    P + PPVE
Sbjct: 157 HKPSPVYQPPKTEKPVPEHKPPHLPPIVVRPPPTHKP--NPPYGHHPRH-PPVE 207

[24][TOP]
>UniRef100_Q9FUR6 ENOD2 (Fragment) n=1 Tax=Cladrastis kentukea RepID=Q9FUR6_CLALU
          Length = 244

 Score =  173 bits (438), Expect = 6e-42
 Identities = 99/154 (64%), Positives = 110/154 (71%), Gaps = 19/154 (12%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPV-EKPP-VYKPPVEKPP-VYKPPVEK--PPVYKPP 169
           V+ PPVY+PP    P   PP+Y+PP  EKPP VY PP EKPP VY+PP  +  PPVY PP
Sbjct: 84  VKPPPVYQPPPHVKP---PPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPVYPPP 140

Query: 170 VEKPP-VYKPPVEK--PPVYKPPVEKPP-VYKPPVEK--PPVYKPPVEKPP-VYKPPV-E 325
            EKPP VY+PP  +  PPVY PP EKPP VY+PP  +  PPVY PP EKPP VY+PP  E
Sbjct: 141 HEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHE 200

Query: 326 KPPVYKPP------VEKPPVYKPPVEKPPVYKPP 409
           KPPVYKPP      VEKPPVYKPPVEKPP YKPP
Sbjct: 201 KPPVYKPPGYEPPPVEKPPVYKPPVEKPPSYKPP 234

 Score =  164 bits (415), Expect = 3e-39
 Identities = 96/158 (60%), Positives = 111/158 (70%), Gaps = 24/158 (15%)
 Frame = +2

Query: 8   EKPPVYK-------PPVEKPPEYTPPIYKPPVEK-PPVYKPPVEK-PPVYKPPVEK--PP 154
           EKPP Y+       PPV KPP Y PP++ PP EK PPVY PP EK PPVY+PP  +  PP
Sbjct: 17  EKPPTYEPPPTEKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPP 76

Query: 155 VYKPP--VEKPPVYKPP--VEKPPVYKPPV-EKPP-VYKPPVEK-PPVYKPPVEK--PPV 307
           VY+PP  V+ PPVY+PP  V+ PPVY+PP  EKPP VY PP EK PPVY+PP  +  PPV
Sbjct: 77  VYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPV 136

Query: 308 YKPPVEK-PPVYKPPVEK--PPVYKPPVEK-PPVYKPP 409
           Y PP EK PPVY+PP  +  PPVY PP EK PPVY+PP
Sbjct: 137 YPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPP 174

 Score =  163 bits (412), Expect = 6e-39
 Identities = 94/157 (59%), Positives = 109/157 (69%), Gaps = 24/157 (15%)
 Frame = +2

Query: 11  KPPVYKPPV-EKPPEYTPP-------IYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVY 160
           KPP Y+PP  EKPP Y PP       +YKPP+  PPV+ PP EK PPVY PP EK PPVY
Sbjct: 7   KPPTYEPPATEKPPTYEPPPTEKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVY 66

Query: 161 KPPVEK--PPVYKPP--VEKPPVYKPP--VEKPPVYKPPV-EKPP-VYKPPVEK-PPVYK 313
           +PP  +  PPVY+PP  V+ PPVY+PP  V+ PPVY+PP  EKPP VY PP EK PPVY+
Sbjct: 67  QPPPHEKPPPVYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQ 126

Query: 314 PPVEK--PPVYKPPVEK-PPVYKPPVEK--PPVYKPP 409
           PP  +  PPVY PP EK PPVY+PP  +  PPVY PP
Sbjct: 127 PPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPP 163

 Score =  154 bits (388), Expect = 4e-36
 Identities = 90/149 (60%), Positives = 101/149 (67%), Gaps = 24/149 (16%)
 Frame = +2

Query: 5   VEKPPVYKPPV-EKPP-------EYTPPIYKPPVEK--PPVYKPPVEKPP-VYKPPVEK- 148
           V+ PPVY+PP  EKPP       E  PP+Y+PP  +  PPVY PP EKPP VY+PP  + 
Sbjct: 96  VKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEK 155

Query: 149 -PPVYKPPVEKPP-VYKPPVEK--PPVYKPPVEKPP-VYKPPV-EKPPVYKPP------V 292
            PPVY PP EKPP VY+PP  +  PPVY PP EKPP VY+PP  EKPPVYKPP      V
Sbjct: 156 PPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPVYKPPGYEPPPV 215

Query: 293 EKPPVYKPPVEKPPVYKPPVEKPPVYKPP 379
           EKPPVYKPPVEKPP YKPP   P  + PP
Sbjct: 216 EKPPVYKPPVEKPPSYKPP---PYGHYPP 241

 Score =  149 bits (375), Expect = 1e-34
 Identities = 85/135 (62%), Positives = 98/135 (72%), Gaps = 16/135 (11%)
 Frame = +2

Query: 53  YTPPIYKPP-VEKPPVYK-PPVEK-PPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPV 217
           Y PP Y+PP  EKPP Y+ PP EK PPVYKPP+  PPV+ PP EK PPVY PP EK PPV
Sbjct: 6   YKPPTYEPPATEKPPTYEPPPTEKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPV 65

Query: 218 YKPPVEK--PPVYKPP--VEKPPVYKPP--VEKPPVYKPPV-EKPP-VYKPPVEK-PPVY 370
           Y+PP  +  PPVY+PP  V+ PPVY+PP  V+ PPVY+PP  EKPP VY PP EK PPVY
Sbjct: 66  YQPPPHEKPPPVYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVY 125

Query: 371 KPPVEK--PPVYKPP 409
           +PP  +  PPVY PP
Sbjct: 126 QPPPHEKPPPVYPPP 140

[25][TOP]
>UniRef100_Q9LIE8 Similarity to cell wall-plasma membrane linker protein n=1
            Tax=Arabidopsis thaliana RepID=Q9LIE8_ARATH
          Length = 1480

 Score =  172 bits (436), Expect = 1e-41
 Identities = 75/135 (55%), Positives = 87/135 (64%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+ KPPV  PP  TPPI KPPV  PP+ KPPV  PPV  PP+ KPPV   P+E PP
Sbjct: 1176 VATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPP 1235

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PP
Sbjct: 1236 VAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPP 1295

Query: 365  VYKPPVEKPPVYKPP 409
            V   P+ KPPV  PP
Sbjct: 1296 VATSPIAKPPVATPP 1310

 Score =  171 bits (433), Expect = 2e-41
 Identities = 72/135 (53%), Positives = 86/135 (63%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            + KPP+  PP   PP   PPI K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPP
Sbjct: 1126 IAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPP 1185

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+E PPV KPPV  PP
Sbjct: 1186 VASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPP 1245

Query: 365  VYKPPVEKPPVYKPP 409
            V  PP+ KPP+  PP
Sbjct: 1246 VATPPIVKPPIVTPP 1260

 Score =  171 bits (432), Expect = 3e-41
 Identities = 72/135 (53%), Positives = 86/135 (63%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+ KPP+  PP  T PI KPP+  PP   PPV  PP+ K P+ KPP+  PP   P 
Sbjct: 1106 VSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPS 1165

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPP
Sbjct: 1166 IATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPP 1225

Query: 365  VYKPPVEKPPVYKPP 409
            V   P+E PPV KPP
Sbjct: 1226 VATSPIETPPVAKPP 1240

 Score =  170 bits (430), Expect = 5e-41
 Identities = 74/135 (54%), Positives = 86/135 (63%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+  PP+ KPP  TPPI KPPV  PPV  PP+ KPPV   P+E PPV KPPV  PP
Sbjct: 1186 VASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPP 1245

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPP
Sbjct: 1246 VATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPP 1305

Query: 365  VYKPPVEKPPVYKPP 409
            V  PP   PPV KPP
Sbjct: 1306 VATPPPATPPVAKPP 1320

 Score =  169 bits (429), Expect = 7e-41
 Identities = 71/135 (52%), Positives = 87/135 (64%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            + K P+ KPP+  PP   P I  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP
Sbjct: 1146 IAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPP 1205

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            + KPPV  PPV  PP+ KPPV   P+E PPV KPPV  PPV  PP+ KPP+  PP+  PP
Sbjct: 1206 ITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPP 1265

Query: 365  VYKPPVEKPPVYKPP 409
            + K P+  PP+  PP
Sbjct: 1266 IAKSPIAPPPIGTPP 1280

 Score =  169 bits (429), Expect = 7e-41
 Identities = 72/135 (53%), Positives = 87/135 (64%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            + KPP+  PP   P   TPPI KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPP
Sbjct: 1151 IAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPP 1210

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PPV  PP+ KPPV   P+  PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P
Sbjct: 1211 VATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSP 1270

Query: 365  VYKPPVEKPPVYKPP 409
            +  PP+  PP+ KPP
Sbjct: 1271 IAPPPIGTPPIAKPP 1285

 Score =  168 bits (426), Expect = 2e-40
 Identities = 72/135 (53%), Positives = 87/135 (64%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            + KPPV  PP+ KPP  +PPI  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P
Sbjct: 1171 IGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSP 1230

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            +  PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP
Sbjct: 1231 IETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPP 1290

Query: 365  VYKPPVEKPPVYKPP 409
               PPV   P+ KPP
Sbjct: 1291 TATPPVATSPIAKPP 1305

 Score =  168 bits (425), Expect = 2e-40
 Identities = 72/133 (54%), Positives = 84/133 (63%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            KPPV  PP+ KPP  TPP+  PP+ KPPV   P+E PPV KPPV  PPV  PP+ KPP+ 
Sbjct: 1198 KPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIV 1257

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
             PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV 
Sbjct: 1258 TPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVA 1317

Query: 371  KPPVEKPPVYKPP 409
            KPPV  PP   PP
Sbjct: 1318 KPPVATPPTVTPP 1330

 Score =  167 bits (424), Expect = 3e-40
 Identities = 72/135 (53%), Positives = 83/135 (61%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            + KPPV  PP   PP  TPP+ KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP
Sbjct: 800  IAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPP 859

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            +  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPP
Sbjct: 860  ITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPP 919

Query: 365  VYKPPVEKPPVYKPP 409
            V  PP+  PPV KPP
Sbjct: 920  VAIPPIATPPVAKPP 934

 Score =  167 bits (424), Expect = 3e-40
 Identities = 72/135 (53%), Positives = 85/135 (62%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PPV   P+ KPP  TPP   PPV  PP+ K P+ KPP+  PP   P +  PP+ KPP
Sbjct: 1116 IATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPP 1175

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+E PP
Sbjct: 1176 VATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPP 1235

Query: 365  VYKPPVEKPPVYKPP 409
            V KPPV  PPV  PP
Sbjct: 1236 VAKPPVTTPPVATPP 1250

 Score =  167 bits (423), Expect = 3e-40
 Identities = 70/135 (51%), Positives = 85/135 (62%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PP+ KPPV  PP   PP+  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPP
Sbjct: 1166 IATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPP 1225

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   P+E PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPP
Sbjct: 1226 VATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPP 1285

Query: 365  VYKPPVEKPPVYKPP 409
            V  PP   PPV   P
Sbjct: 1286 VATPPTATPPVATSP 1300

 Score =  167 bits (422), Expect = 4e-40
 Identities = 71/135 (52%), Positives = 86/135 (63%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+ K P+ KPP  TPP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPP
Sbjct: 1141 VANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPP 1200

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP+ KPPV  PPV  PP+ KPPV   P+  PPV KPPV  PPV  PP+ KPP+  PP
Sbjct: 1201 VATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPP 1260

Query: 365  VYKPPVEKPPVYKPP 409
            +  PP+ K P+  PP
Sbjct: 1261 IATPPIAKSPIAPPP 1275

 Score =  167 bits (422), Expect = 4e-40
 Identities = 70/132 (53%), Positives = 85/132 (64%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            P +  PP+ KPP  TPP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ K
Sbjct: 1164 PSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAK 1223

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PPV   P+  PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ K
Sbjct: 1224 PPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAK 1283

Query: 374  PPVEKPPVYKPP 409
            PPV  PP   PP
Sbjct: 1284 PPVATPPTATPP 1295

 Score =  167 bits (422), Expect = 4e-40
 Identities = 76/140 (54%), Positives = 86/140 (61%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
            V  PP+ KPPV  PP  TPPI KPPV     E PPV KPPV  PPV  PP+ KPP+  PP
Sbjct: 1201 VATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPP 1260

Query: 170  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
            +  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPP
Sbjct: 1261 IATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPP 1320

Query: 350  VEKPPVYKPPVEKPPVYKPP 409
            V  PP   PPV  PP+ KPP
Sbjct: 1321 VATPPTVTPPVATPPIAKPP 1340

 Score =  166 bits (421), Expect = 6e-40
 Identities = 70/135 (51%), Positives = 85/135 (62%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V   P+ KPP+  PP   PP+  PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP
Sbjct: 1121 VATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPP 1180

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            + KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+  PPV KPP
Sbjct: 1181 MAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPP 1240

Query: 365  VYKPPVEKPPVYKPP 409
            V  PPV  PP+ KPP
Sbjct: 1241 VTTPPVATPPIVKPP 1255

 Score =  166 bits (420), Expect = 8e-40
 Identities = 73/132 (55%), Positives = 81/132 (61%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PPV KPPV  PP  TPPI  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   
Sbjct: 758  PPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTAT 817

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  
Sbjct: 818  PPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIAT 877

Query: 374  PPVEKPPVYKPP 409
            PP+ KPPV  PP
Sbjct: 878  PPIAKPPVATPP 889

 Score =  166 bits (419), Expect = 1e-39
 Identities = 73/135 (54%), Positives = 80/135 (59%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V KPPV  PP   PP  TPPI K PV  PP   PPV  PP+ KPPV  PP   PP   PP
Sbjct: 760  VAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPP 819

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP
Sbjct: 820  VAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPP 879

Query: 365  VYKPPVEKPPVYKPP 409
            + KPPV  PP   PP
Sbjct: 880  IAKPPVATPPTATPP 894

 Score =  166 bits (419), Expect = 1e-39
 Identities = 69/132 (52%), Positives = 84/132 (63%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP+ K P+  PP  TPPI KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ K
Sbjct: 1094 PPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAK 1153

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  
Sbjct: 1154 PPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVAT 1213

Query: 374  PPVEKPPVYKPP 409
            PPV  PP+ KPP
Sbjct: 1214 PPVATPPIAKPP 1225

 Score =  165 bits (418), Expect = 1e-39
 Identities = 74/137 (54%), Positives = 83/137 (60%), Gaps = 5/137 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PPV  PP+EKPP  TPP   PP   PPV KPPVE PP+  PP  KPP+  PP+ KPPV  
Sbjct: 423 PPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVAT 482

Query: 194 PPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP   PP+      KPPV  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   
Sbjct: 483 PPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTAT 542

Query: 359 PPVYKPPVEKPPVYKPP 409
           PPV  PP+ KPPV  PP
Sbjct: 543 PPVATPPIAKPPVVTPP 559

 Score =  165 bits (418), Expect = 1e-39
 Identities = 76/150 (50%), Positives = 85/150 (56%), Gaps = 15/150 (10%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--------- 157
           +EKPPV  PP   PP  TPP+ KPPVE PP+  PP  KPP+  PP+ KPPV         
Sbjct: 430 IEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPP 489

Query: 158 ------YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 319
                  KPPV  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP
Sbjct: 490 ITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPP 549

Query: 320 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           + KPPV  PP   PP   PPV KPPV  PP
Sbjct: 550 IAKPPVVTPPTTTPPTATPPVAKPPVATPP 579

 Score =  165 bits (418), Expect = 1e-39
 Identities = 71/135 (52%), Positives = 82/135 (60%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           + KPPV  PP   PP  TPP+ KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP
Sbjct: 550 IAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPP 609

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           +  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPP
Sbjct: 610 ITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPP 669

Query: 365 VYKPPVEKPPVYKPP 409
           V  PP+  PPV KPP
Sbjct: 670 VAIPPIATPPVAKPP 684

 Score =  165 bits (418), Expect = 1e-39
 Identities = 73/135 (54%), Positives = 84/135 (62%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +E PPV KPPV  PP  TPPI KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP
Sbjct: 1231 IETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPP 1290

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
               PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ KPP  +PPV  PP
Sbjct: 1291 TATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPPVATPP 1350

Query: 365  VYKPPVEKPPVYKPP 409
            V  PP+ K PV  PP
Sbjct: 1351 VATPPIAKSPVATPP 1365

 Score =  165 bits (417), Expect = 2e-39
 Identities = 70/135 (51%), Positives = 81/135 (60%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PP+  PPV KPP  TPP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP
Sbjct: 750  IATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPP 809

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
               PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPP
Sbjct: 810  TTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPP 869

Query: 365  VYKPPVEKPPVYKPP 409
            V  PP+  PP+ KPP
Sbjct: 870  VATPPIATPPIAKPP 884

 Score =  165 bits (417), Expect = 2e-39
 Identities = 68/135 (50%), Positives = 84/135 (62%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+  PP+ K P  TPP+  PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP
Sbjct: 1086 VTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPP 1145

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            + K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP
Sbjct: 1146 IAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPP 1205

Query: 365  VYKPPVEKPPVYKPP 409
            + KPPV  PPV  PP
Sbjct: 1206 ITKPPVATPPVATPP 1220

 Score =  164 bits (416), Expect = 2e-39
 Identities = 72/132 (54%), Positives = 80/132 (60%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PPV KPPV  PP  TPPI  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   
Sbjct: 508 PPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTAT 567

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  
Sbjct: 568 PPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIAT 627

Query: 374 PPVEKPPVYKPP 409
           PP+ KPPV  PP
Sbjct: 628 PPIAKPPVATPP 639

 Score =  164 bits (415), Expect = 3e-39
 Identities = 70/135 (51%), Positives = 81/135 (60%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+ KPP   PP  TPP+  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP
Sbjct: 715  VATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPP 774

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            +  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP
Sbjct: 775  IATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPP 834

Query: 365  VYKPPVEKPPVYKPP 409
              KPP+  PP+ KPP
Sbjct: 835  TAKPPILTPPISKPP 849

 Score =  164 bits (414), Expect = 4e-39
 Identities = 72/132 (54%), Positives = 80/132 (60%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP   PPV KPP  TPPI  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  
Sbjct: 813  PPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVAT 872

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PPV K
Sbjct: 873  PPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAK 932

Query: 374  PPVEKPPVYKPP 409
            PPV  PP   PP
Sbjct: 933  PPVATPPTATPP 944

 Score =  163 bits (413), Expect = 5e-39
 Identities = 73/135 (54%), Positives = 80/135 (59%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE PP+  PP  KPP  TPPI KPPV  PP   PP+  P   KPPV  PP+  PPV KPP
Sbjct: 455 VETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPP 514

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPP
Sbjct: 515 VVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPP 574

Query: 365 VYKPPVEKPPVYKPP 409
           V  PP+  PP  KPP
Sbjct: 575 VATPPIATPPTAKPP 589

 Score =  163 bits (413), Expect = 5e-39
 Identities = 74/136 (54%), Positives = 84/136 (61%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+  PPVEKPP  TPPI KPP   PP+ KPPVE  P   PP   PPV  PPV KPP
Sbjct: 1000 VATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPP 1059

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
            V  PP+ KPPV  PPV  PP   PP V  PP+  PP+ K P+  PPV  PP+ KPP+  P
Sbjct: 1060 VAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATP 1119

Query: 362  PVYKPPVEKPPVYKPP 409
            PV   P+ KPP+  PP
Sbjct: 1120 PVATTPIAKPPIATPP 1135

 Score =  163 bits (412), Expect = 6e-39
 Identities = 71/135 (52%), Positives = 82/135 (60%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP+ KPPV  PP  TPP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP
Sbjct: 545 VATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPP 604

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
              PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP
Sbjct: 605 AATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPP 664

Query: 365 VYKPPVEKPPVYKPP 409
             KPPV  PP+  PP
Sbjct: 665 PAKPPVAIPPIATPP 679

 Score =  163 bits (412), Expect = 6e-39
 Identities = 71/135 (52%), Positives = 80/135 (59%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PPV KPPV  PP  TPPI  PP+  PPV  PP   PPV  PP+ KPP   PP   PP
Sbjct: 675  IATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPP 734

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PP
Sbjct: 735  VAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPP 794

Query: 365  VYKPPVEKPPVYKPP 409
            V  PP+ KPPV  PP
Sbjct: 795  VATPPIAKPPVATPP 809

 Score =  163 bits (412), Expect = 6e-39
 Identities = 72/135 (53%), Positives = 80/135 (59%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+  PP  KPP  TPPI  PPV KPPV  PP   PP+  PP+ K PV  PP   PP
Sbjct: 735  VAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPP 794

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP
Sbjct: 795  VATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPP 854

Query: 365  VYKPPVEKPPVYKPP 409
               PP+  PP  KPP
Sbjct: 855  AATPPITTPPPAKPP 869

 Score =  163 bits (412), Expect = 6e-39
 Identities = 71/132 (53%), Positives = 80/132 (60%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PPV  PP+ KPP  TPP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  
Sbjct: 793  PPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVAT 852

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  
Sbjct: 853  PPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKT 912

Query: 374  PPVEKPPVYKPP 409
            PP  KPPV  PP
Sbjct: 913  PPPAKPPVAIPP 924

 Score =  163 bits (412), Expect = 6e-39
 Identities = 70/135 (51%), Positives = 83/135 (61%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PP+ KPPV  PP   PP+  PPV  PP+ KPPV   P+  PPV KPPV  PPV  PP
Sbjct: 1191 IATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPP 1250

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            + KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP
Sbjct: 1251 IVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPP 1310

Query: 365  VYKPPVEKPPVYKPP 409
               PPV KPPV  PP
Sbjct: 1311 PATPPVAKPPVATPP 1325

 Score =  163 bits (412), Expect = 6e-39
 Identities = 72/135 (53%), Positives = 83/135 (61%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PPV  PP+ KPP  T PI  PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P
Sbjct: 1211 VATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSP 1270

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            +  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PP
Sbjct: 1271 IAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPP 1330

Query: 365  VYKPPVEKPPVYKPP 409
            V  PP+ KPP  +PP
Sbjct: 1331 VATPPIAKPPGARPP 1345

 Score =  163 bits (412), Expect = 6e-39
 Identities = 71/135 (52%), Positives = 83/135 (61%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+ KPPV   P  TPP+ KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP
Sbjct: 1216 VATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPP 1275

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            +  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP
Sbjct: 1276 IGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPP 1335

Query: 365  VYKPPVEKPPVYKPP 409
            + KPP  +PPV  PP
Sbjct: 1336 IAKPPGARPPVATPP 1350

 Score =  162 bits (411), Expect = 8e-39
 Identities = 70/135 (51%), Positives = 81/135 (60%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP+ K P+  PP  TPP+  PP+EKPPV  PP   PP   PPV KPPV  PP+  PP
Sbjct: 405 VATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPP 464

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
             KPP+  PP+ KPPV  PP   PP+  P   KPPV  PP+  PPV KPPV  PP   PP
Sbjct: 465 TAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPP 524

Query: 365 VYKPPVEKPPVYKPP 409
           +  PP+ K PV  PP
Sbjct: 525 IATPPIAKSPVATPP 539

 Score =  162 bits (411), Expect = 8e-39
 Identities = 71/135 (52%), Positives = 80/135 (59%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            + K PV  PP   PP  TPPI KPPV  PP   PP   PPV KPPV  PP+  PP  KPP
Sbjct: 780  IAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPP 839

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            +  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   P
Sbjct: 840  ILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSP 899

Query: 365  VYKPPVEKPPVYKPP 409
            V KPPV  PP+  PP
Sbjct: 900  VAKPPVAIPPIKTPP 914

 Score =  162 bits (411), Expect = 8e-39
 Identities = 71/135 (52%), Positives = 82/135 (60%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP
Sbjct: 795  VATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPP 854

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
               PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP
Sbjct: 855  AATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPP 914

Query: 365  VYKPPVEKPPVYKPP 409
              KPPV  PP+  PP
Sbjct: 915  PAKPPVAIPPIATPP 929

 Score =  162 bits (411), Expect = 8e-39
 Identities = 76/151 (50%), Positives = 87/151 (57%), Gaps = 16/151 (10%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+ KPP   PP  TPP+  PP+  PP  KPPV  PP+  PPVEKPPV  PP+ KPP
Sbjct: 965  VATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPP 1024

Query: 185  VYKPPVEKPPV----------YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP----- 319
               PP+ KPPV            PPV  PPV KPPV  PP+ KPPV  PPV  PP     
Sbjct: 1025 TVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPP 1084

Query: 320  -VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
             V  PP+  PP+ K P+  PPV  PP+ KPP
Sbjct: 1085 IVTPPPIVTPPIAKSPIATPPVSTPPIAKPP 1115

 Score =  162 bits (410), Expect = 1e-38
 Identities = 71/132 (53%), Positives = 81/132 (61%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PPV KPPV  PP  TPP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  
Sbjct: 568 PPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIAT 627

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  
Sbjct: 628 PPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVAT 687

Query: 374 PPVEKPPVYKPP 409
           PP   PP+  PP
Sbjct: 688 PPTATPPIATPP 699

 Score =  162 bits (410), Expect = 1e-38
 Identities = 70/135 (51%), Positives = 81/135 (60%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PP+ K PV  PP  TPP+  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP
Sbjct: 775  IATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPP 834

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
              KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP
Sbjct: 835  TAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPP 894

Query: 365  VYKPPVEKPPVYKPP 409
            +   PV KPPV  PP
Sbjct: 895  IATSPVAKPPVAIPP 909

 Score =  162 bits (409), Expect = 1e-38
 Identities = 72/135 (53%), Positives = 79/135 (58%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPV  PP   PP  TPPI K PV  PP   PPV  PP+ KPPV  PP   PP   PP
Sbjct: 510 VAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPP 569

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP
Sbjct: 570 VAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPP 629

Query: 365 VYKPPVEKPPVYKPP 409
           + KPPV  PP   PP
Sbjct: 630 IAKPPVATPPTATPP 644

 Score =  162 bits (409), Expect = 1e-38
 Identities = 71/135 (52%), Positives = 81/135 (60%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           +  PP+ K PV  PP  TPPI  PP  KPPV  PP+  PP+ KPPV  PP   PP+   P
Sbjct: 590 ISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSP 649

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP
Sbjct: 650 VAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPP 709

Query: 365 VYKPPVEKPPVYKPP 409
              PPV  PP+ KPP
Sbjct: 710 TATPPVATPPIAKPP 724

 Score =  162 bits (409), Expect = 1e-38
 Identities = 69/132 (52%), Positives = 79/132 (59%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP+  PP+ K P  TPP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  
Sbjct: 773  PPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIAT 832

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   
Sbjct: 833  PPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTAT 892

Query: 374  PPVEKPPVYKPP 409
            PP+   PV KPP
Sbjct: 893  PPIATSPVAKPP 904

 Score =  162 bits (409), Expect = 1e-38
 Identities = 72/135 (53%), Positives = 79/135 (58%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PPV KPPV  PP  TPPI   P+  PPV  PP    PV  PP+ KPP   PP   PP
Sbjct: 925  IATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPP 984

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP+  PP  KPPV  PP+  PPVEKPPV  PP+ KPP   PP+ KPPV   P   PP
Sbjct: 985  VAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPP 1044

Query: 365  VYKPPVEKPPVYKPP 409
               PPV  PPV KPP
Sbjct: 1045 TATPPVAIPPVVKPP 1059

 Score =  161 bits (408), Expect = 2e-38
 Identities = 69/135 (51%), Positives = 80/135 (59%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           +  PP+ K PV  PP  TPP+  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP
Sbjct: 525 IATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPP 584

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
             KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP
Sbjct: 585 TAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPP 644

Query: 365 VYKPPVEKPPVYKPP 409
           +   PV KPPV  PP
Sbjct: 645 IATSPVAKPPVATPP 659

 Score =  161 bits (408), Expect = 2e-38
 Identities = 70/135 (51%), Positives = 81/135 (60%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PP+ KPPV  PP  TPPI   PV KPPV  PP++ PP  KPPV  PP+  PPV KPP
Sbjct: 625  IATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPP 684

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP
Sbjct: 685  VATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPP 744

Query: 365  VYKPPVEKPPVYKPP 409
              KPP+  PP+  PP
Sbjct: 745  TAKPPIATPPIAIPP 759

 Score =  161 bits (408), Expect = 2e-38
 Identities = 69/135 (51%), Positives = 79/135 (58%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PP  KPP+  PP   PP+ KPPV  PP   PP+  PP+ K PV  PP   PPV  PP
Sbjct: 740  IATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPP 799

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            + KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP
Sbjct: 800  IAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPP 859

Query: 365  VYKPPVEKPPVYKPP 409
            +  PP  KPPV  PP
Sbjct: 860  ITTPPPAKPPVATPP 874

 Score =  161 bits (408), Expect = 2e-38
 Identities = 71/131 (54%), Positives = 79/131 (60%)
 Frame = +2

Query: 17   PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
            P+  PPV  PP  T P+  PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  P
Sbjct: 949  PIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANP 1008

Query: 197  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
            PVEKPPV  PP+ KPP   PP+ KPPV   P   PP   PPV  PPV KPPV  PP+ KP
Sbjct: 1009 PVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKP 1068

Query: 377  PVEKPPVYKPP 409
            PV  PPV  PP
Sbjct: 1069 PVATPPVTNPP 1079

 Score =  161 bits (408), Expect = 2e-38
 Identities = 73/135 (54%), Positives = 79/135 (58%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PPV  PP    P  TPPI KPP   PP   PPV  PP+  PP  KPPV  PP+  PP
Sbjct: 950  IATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPP 1009

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V KPPV  PP+ KPP   PP+ KPPVE  P   PP   PPV  PPV KPPV  PP+ KPP
Sbjct: 1010 VEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPP 1069

Query: 365  VYKPPVEKPPVYKPP 409
            V  PPV  PP   PP
Sbjct: 1070 VATPPVTNPPTAMPP 1084

 Score =  161 bits (407), Expect = 2e-38
 Identities = 71/132 (53%), Positives = 79/132 (59%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP   PPV KPP  TPPI  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  
Sbjct: 563 PPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVAT 622

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PPV K
Sbjct: 623 PPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAK 682

Query: 374 PPVEKPPVYKPP 409
           PPV  PP   PP
Sbjct: 683 PPVATPPTATPP 694

 Score =  161 bits (407), Expect = 2e-38
 Identities = 71/135 (52%), Positives = 81/135 (60%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP+  PP  KPP  TPPI K PV  PP   PP+  PP  KPPV  PP+  PP+ KPP
Sbjct: 575 VATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPP 634

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP
Sbjct: 635 VATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPP 694

Query: 365 VYKPPVEKPPVYKPP 409
           +  PP+  PPV  PP
Sbjct: 695 IATPPIATPPVVTPP 709

 Score =  160 bits (406), Expect = 3e-38
 Identities = 70/135 (51%), Positives = 80/135 (59%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP+  PPV KPP  TPP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP
Sbjct: 500 VATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPP 559

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
              PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPP
Sbjct: 560 TTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPP 619

Query: 365 VYKPPVEKPPVYKPP 409
           V  PP+  PP+ KPP
Sbjct: 620 VATPPIATPPIAKPP 634

 Score =  160 bits (406), Expect = 3e-38
 Identities = 70/132 (53%), Positives = 79/132 (59%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PPV  PP+ KPP  TPP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  
Sbjct: 543 PPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVAT 602

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  
Sbjct: 603 PPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKT 662

Query: 374 PPVEKPPVYKPP 409
           PP  KPPV  PP
Sbjct: 663 PPPAKPPVAIPP 674

 Score =  160 bits (406), Expect = 3e-38
 Identities = 71/135 (52%), Positives = 81/135 (60%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+  PP  KPP  TPPI KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPP
Sbjct: 825  VATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPP 884

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP
Sbjct: 885  VATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPP 944

Query: 365  VYKPPVEKPPVYKPP 409
            +   P+  PPV  PP
Sbjct: 945  IATSPIATPPVVTPP 959

 Score =  160 bits (405), Expect = 4e-38
 Identities = 69/133 (51%), Positives = 79/133 (59%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP+  PP+ KPP  TPP   PP+  P   KPPV  PP+  PPV KPPV  PP   PP+ 
Sbjct: 467 KPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIA 526

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  
Sbjct: 527 TPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTA 586

Query: 371 KPPVEKPPVYKPP 409
           KPP+  PP+ K P
Sbjct: 587 KPPISTPPISKSP 599

 Score =  160 bits (405), Expect = 4e-38
 Identities = 69/135 (51%), Positives = 79/135 (58%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PP+  PPV  PP  TPP+  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP
Sbjct: 695  IATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPP 754

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            +  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP
Sbjct: 755  IAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPP 814

Query: 365  VYKPPVEKPPVYKPP 409
               PPV KPPV  PP
Sbjct: 815  TATPPVAKPPVATPP 829

 Score =  160 bits (405), Expect = 4e-38
 Identities = 69/132 (52%), Positives = 78/132 (59%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   
Sbjct: 713  PPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTAT 772

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  
Sbjct: 773  PPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIAT 832

Query: 374  PPVEKPPVYKPP 409
            PP  KPP+  PP
Sbjct: 833  PPTAKPPILTPP 844

 Score =  160 bits (405), Expect = 4e-38
 Identities = 70/132 (53%), Positives = 78/132 (59%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP   PPV  PP  TPP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  
Sbjct: 728  PPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVAT 787

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K
Sbjct: 788  PPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISK 847

Query: 374  PPVEKPPVYKPP 409
            PPV  PP   PP
Sbjct: 848  PPVATPPAATPP 859

 Score =  160 bits (405), Expect = 4e-38
 Identities = 69/132 (52%), Positives = 78/132 (59%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PPV  PP+  PP   PPI  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   
Sbjct: 733  PPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTAT 792

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  
Sbjct: 793  PPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVAT 852

Query: 374  PPVEKPPVYKPP 409
            PP   PP+  PP
Sbjct: 853  PPAATPPITTPP 864

 Score =  160 bits (405), Expect = 4e-38
 Identities = 71/132 (53%), Positives = 81/132 (61%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PPV KPPV  PP  TPP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  
Sbjct: 818  PPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIAT 877

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  
Sbjct: 878  PPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVAT 937

Query: 374  PPVEKPPVYKPP 409
            PP   PP+   P
Sbjct: 938  PPTATPPIATSP 949

 Score =  160 bits (405), Expect = 4e-38
 Identities = 74/146 (50%), Positives = 83/146 (56%), Gaps = 11/146 (7%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+  PP  KPP  TPPI  PPVEKPPV  PP+ KPP   PP+ KPPV   P   PP
Sbjct: 985  VAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPP 1044

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-----------VEKP 331
               PPV  PPV KPPV  PP+ KPPV  PPV  PP   PP+  PP           +  P
Sbjct: 1045 TATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATP 1104

Query: 332  PVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PV  PP+ KPP+  PPV   P+ KPP
Sbjct: 1105 PVSTPPIAKPPIATPPVATTPIAKPP 1130

 Score =  160 bits (405), Expect = 4e-38
 Identities = 70/146 (47%), Positives = 85/146 (58%), Gaps = 11/146 (7%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPE-----------YTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKP 151
            + KPPV  PPV  PP             TPPI K P+  PPV  PP+ KPP+  PPV   
Sbjct: 1065 ITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATT 1124

Query: 152  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
            P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KP
Sbjct: 1125 PIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKP 1184

Query: 332  PVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PV  PP+  PP+ KPPV  PP+ KPP
Sbjct: 1185 PVASPPIATPPIIKPPVATPPITKPP 1210

 Score =  160 bits (404), Expect = 5e-38
 Identities = 70/135 (51%), Positives = 80/135 (59%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPPV  PP+  PP   PPI  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP
Sbjct: 570 VAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPP 629

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           + KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP
Sbjct: 630 IAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPP 689

Query: 365 VYKPPVEKPPVYKPP 409
              PP+  PP+  PP
Sbjct: 690 TATPPIATPPIATPP 704

 Score =  160 bits (404), Expect = 5e-38
 Identities = 69/133 (51%), Positives = 80/133 (60%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP+  PP+ K P  TPP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+ 
Sbjct: 587 KPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIA 646

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
             PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV 
Sbjct: 647 TSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVV 706

Query: 371 KPPVEKPPVYKPP 409
            PP   PPV  PP
Sbjct: 707 TPPTATPPVATPP 719

 Score =  160 bits (404), Expect = 5e-38
 Identities = 70/135 (51%), Positives = 80/135 (59%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            + KPPV  PP   PP  T P+ KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP
Sbjct: 630  IAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPP 689

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
               PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP
Sbjct: 690  TATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPP 749

Query: 365  VYKPPVEKPPVYKPP 409
            +  PP+  PPV KPP
Sbjct: 750  IATPPIAIPPVAKPP 764

 Score =  160 bits (404), Expect = 5e-38
 Identities = 69/135 (51%), Positives = 82/135 (60%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            + KPPV   P+E PP   PP+  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP
Sbjct: 1221 IAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPP 1280

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            + KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ KPP
Sbjct: 1281 IAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPP 1340

Query: 365  VYKPPVEKPPVYKPP 409
              +PPV  PPV  PP
Sbjct: 1341 GARPPVATPPVATPP 1355

 Score =  160 bits (404), Expect = 5e-38
 Identities = 69/135 (51%), Positives = 82/135 (60%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V   P+  PPV KPP  TPP+  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPP
Sbjct: 1226 VATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPP 1285

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ KPP  +PP
Sbjct: 1286 VATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPP 1345

Query: 365  VYKPPVEKPPVYKPP 409
            V  PPV  PP+ K P
Sbjct: 1346 VATPPVATPPIAKSP 1360

 Score =  160 bits (404), Expect = 5e-38
 Identities = 71/135 (52%), Positives = 82/135 (60%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+ KPP+  PP  TPPI K P+  PP+  PP+ KPPV  PP   PPV   P+ KPP
Sbjct: 1246 VATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPP 1305

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP   PPV KPPV  PP   PPV  PP+ KPP  +PPV  PPV  PP+ K PV  PP
Sbjct: 1306 VATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPPVATPPVATPPIAKSPVATPP 1365

Query: 365  VYKPPVEKPPVYKPP 409
            + KPPV   P+  PP
Sbjct: 1366 MTKPPVASSPIATPP 1380

 Score =  159 bits (403), Expect = 7e-38
 Identities = 71/135 (52%), Positives = 80/135 (59%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           +  PP+ KPPV  PP  TPPI  P   KPPV  PP+  PPV KPPV  PP   PP+  PP
Sbjct: 470 ISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPP 529

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           + K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP
Sbjct: 530 IAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPP 589

Query: 365 VYKPPVEKPPVYKPP 409
           +  PP+ K PV  PP
Sbjct: 590 ISTPPISKSPVATPP 604

 Score =  159 bits (403), Expect = 7e-38
 Identities = 70/135 (51%), Positives = 79/135 (58%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           + K PV  PP   PP  TPPI KPPV  PP   PP   PPV KPPV  PP+  PP  KPP
Sbjct: 530 IAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPP 589

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           +  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   P
Sbjct: 590 ISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSP 649

Query: 365 VYKPPVEKPPVYKPP 409
           V KPPV  PP+  PP
Sbjct: 650 VAKPPVATPPIKTPP 664

 Score =  159 bits (403), Expect = 7e-38
 Identities = 70/132 (53%), Positives = 79/132 (59%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP+  PP  KPP  TPPI  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  K
Sbjct: 608  PPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAK 667

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   
Sbjct: 668  PPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTI 727

Query: 374  PPVEKPPVYKPP 409
            PP   PPV  PP
Sbjct: 728  PPTATPPVAMPP 739

 Score =  159 bits (403), Expect = 7e-38
 Identities = 70/135 (51%), Positives = 80/135 (59%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V KPPV  PP+  PP   PPI  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP
Sbjct: 820  VAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPP 879

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            + KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP
Sbjct: 880  IAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPP 939

Query: 365  VYKPPVEKPPVYKPP 409
               PP+   P+  PP
Sbjct: 940  TATPPIATSPIATPP 954

 Score =  159 bits (402), Expect = 9e-38
 Identities = 70/135 (51%), Positives = 78/135 (57%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PPV  PP   PP  TPPI KPP   PP   PPV  PP+  PP  KPP+  PP+  PP
Sbjct: 700  IATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPP 759

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PP
Sbjct: 760  VAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPP 819

Query: 365  VYKPPVEKPPVYKPP 409
            V KPPV  PP+  PP
Sbjct: 820  VAKPPVATPPIATPP 834

 Score =  159 bits (402), Expect = 9e-38
 Identities = 73/132 (55%), Positives = 80/132 (60%), Gaps = 1/132 (0%)
 Frame = +2

Query: 17   PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
            PV  PP+ KPP  TPP   PPV  PP+  PP  KPPV  PP+  PPV KPPV  PP+ KP
Sbjct: 964  PVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKP 1023

Query: 197  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
            P   PP+ KPPVE  P   PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP   P
Sbjct: 1024 PTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMP 1083

Query: 377  P-VEKPPVYKPP 409
            P V  PP+  PP
Sbjct: 1084 PIVTPPPIVTPP 1095

 Score =  159 bits (401), Expect = 1e-37
 Identities = 70/135 (51%), Positives = 80/135 (59%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           + K PV  PP   PP  TPP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPP
Sbjct: 595 ISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPP 654

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PP
Sbjct: 655 VATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPP 714

Query: 365 VYKPPVEKPPVYKPP 409
           V  PP+ KPP   PP
Sbjct: 715 VATPPIAKPPTTIPP 729

 Score =  159 bits (401), Expect = 1e-37
 Identities = 70/131 (53%), Positives = 78/131 (59%)
 Frame = +2

Query: 17   PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
            PV KPPV  PP  TPP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  P
Sbjct: 649  PVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTP 708

Query: 197  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
            P   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  P
Sbjct: 709  PTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTP 768

Query: 377  PVEKPPVYKPP 409
            P   PP+  PP
Sbjct: 769  PTATPPIATPP 779

 Score =  159 bits (401), Expect = 1e-37
 Identities = 69/135 (51%), Positives = 80/135 (59%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V KPPV  PP++ PP   PP+  PP+  PPV KPPV  PP   PP+   P+  PPV  PP
Sbjct: 900  VAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPP 959

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
                PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPV KPPV  PP
Sbjct: 960  TATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPP 1019

Query: 365  VYKPPVEKPPVYKPP 409
            + KPP   PP+ KPP
Sbjct: 1020 IAKPPTVLPPIAKPP 1034

 Score =  159 bits (401), Expect = 1e-37
 Identities = 70/146 (47%), Positives = 87/146 (59%), Gaps = 11/146 (7%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPP------VEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
            V KPPV  PP+ KPP  TPP+  PP      V  PP+  PP+ K P+  PPV  PP+ KP
Sbjct: 1055 VVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKP 1114

Query: 167  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-----VYKPPVEKP 331
            P+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP     +  PP+ KP
Sbjct: 1115 PIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKP 1174

Query: 332  PVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PV  PP+ KPPV  PP+  PP+ KPP
Sbjct: 1175 PVATPPMAKPPVASPPIATPPIIKPP 1200

 Score =  158 bits (400), Expect = 2e-37
 Identities = 70/135 (51%), Positives = 79/135 (58%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           ++ PP  KPPV  PP    PI  PP   PPV  PP+EKPPV  PP   PP   PPV KPP
Sbjct: 395 IKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPP 454

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V  PP+  PP  KPP+  PP+ KPPV  PP   PP+  P   KPPV  PP+  PPV KPP
Sbjct: 455 VETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPP 514

Query: 365 VYKPPVEKPPVYKPP 409
           V  PP   PP+  PP
Sbjct: 515 VVTPPTATPPIATPP 529

 Score =  158 bits (400), Expect = 2e-37
 Identities = 71/135 (52%), Positives = 79/135 (58%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PP  KPPV  PP  TPPI KPPV  PP   PP+   PV KPPV  PP+  PP  KPP
Sbjct: 610  ITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPP 669

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP
Sbjct: 670  VAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPP 729

Query: 365  VYKPPVEKPPVYKPP 409
               PPV  PP+  PP
Sbjct: 730  TATPPVAMPPIATPP 744

 Score =  158 bits (400), Expect = 2e-37
 Identities = 69/135 (51%), Positives = 79/135 (58%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+  PP+ KPP  TPP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PP
Sbjct: 620  VATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPP 679

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP
Sbjct: 680  VAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPP 739

Query: 365  VYKPPVEKPPVYKPP 409
            +  PP  KPP+  PP
Sbjct: 740  IATPPTAKPPIATPP 754

 Score =  158 bits (400), Expect = 2e-37
 Identities = 68/135 (50%), Positives = 80/135 (59%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V KPPV  PP++ PP   PP+  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP
Sbjct: 650  VAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPP 709

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
               PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP
Sbjct: 710  TATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPP 769

Query: 365  VYKPPVEKPPVYKPP 409
               PP+  PP+ K P
Sbjct: 770  TATPPIATPPIAKSP 784

 Score =  158 bits (400), Expect = 2e-37
 Identities = 71/135 (52%), Positives = 78/135 (57%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V KPPV  PP   PP  TPPI  PPV  PP   PPV  PP+ KPP   PP   PPV  PP
Sbjct: 680  VAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPP 739

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            +  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP
Sbjct: 740  IATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPP 799

Query: 365  VYKPPVEKPPVYKPP 409
            + KPPV  PP   PP
Sbjct: 800  IAKPPVATPPTTAPP 814

 Score =  158 bits (400), Expect = 2e-37
 Identities = 74/145 (51%), Positives = 83/145 (57%), Gaps = 10/145 (6%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PP+ KPPV  PP  TPPI   PV KPPV  PP++ PP  KPPV  PP+  PPV KPP
Sbjct: 875  IATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPP 934

Query: 185  VYKP----------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
            V  P          P+  PPV  PP    PV  PP+ KPP   PP   PPV  PP+  PP
Sbjct: 935  VATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPP 994

Query: 335  VYKPPVEKPPVYKPPVEKPPVYKPP 409
              KPPV  PP+  PPVEKPPV  PP
Sbjct: 995  TAKPPVATPPIANPPVEKPPVATPP 1019

 Score =  158 bits (400), Expect = 2e-37
 Identities = 71/131 (54%), Positives = 78/131 (59%)
 Frame = +2

Query: 17   PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
            PV KPPV  PP  TPP  KPPV  PP+  PPV KPPV  PP   PP+   P+  PPV  P
Sbjct: 899  PVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTP 958

Query: 197  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
            P    PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPVEKPPV  P
Sbjct: 959  PTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATP 1018

Query: 377  PVEKPPVYKPP 409
            P+ KPP   PP
Sbjct: 1019 PIAKPPTVLPP 1029

 Score =  158 bits (399), Expect = 2e-37
 Identities = 68/132 (51%), Positives = 78/132 (59%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP+  PP+ K P  TPP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  
Sbjct: 523 PPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIAT 582

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   
Sbjct: 583 PPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTAT 642

Query: 374 PPVEKPPVYKPP 409
           PP+   PV KPP
Sbjct: 643 PPIATSPVAKPP 654

 Score =  158 bits (399), Expect = 2e-37
 Identities = 69/135 (51%), Positives = 78/135 (57%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP+  PP  KPP   PPI  PPV KPPV  PP   PP+  PP+  PPV  PP   PP
Sbjct: 655  VATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPP 714

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP
Sbjct: 715  VATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPP 774

Query: 365  VYKPPVEKPPVYKPP 409
            +  PP+ K PV  PP
Sbjct: 775  IATPPIAKSPVATPP 789

 Score =  158 bits (399), Expect = 2e-37
 Identities = 68/132 (51%), Positives = 78/132 (59%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP+  PPV KPP  TPP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   
Sbjct: 673  PPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTAT 732

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   
Sbjct: 733  PPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTAT 792

Query: 374  PPVEKPPVYKPP 409
            PPV  PP+ KPP
Sbjct: 793  PPVATPPIAKPP 804

 Score =  157 bits (398), Expect = 3e-37
 Identities = 68/135 (50%), Positives = 79/135 (58%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP    P++ PP   PP+  PP+ K P+  PP   PPV  PP+EKPPV  PP   PP
Sbjct: 385 VATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPP 444

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
              PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  P   KPPV  PP
Sbjct: 445 TATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPP 504

Query: 365 VYKPPVEKPPVYKPP 409
           +  PPV KPPV  PP
Sbjct: 505 LAIPPVAKPPVVTPP 519

 Score =  157 bits (398), Expect = 3e-37
 Identities = 70/132 (53%), Positives = 78/132 (59%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP+   PV KPP  TPPI  PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  
Sbjct: 643  PPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIAT 702

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV K
Sbjct: 703  PPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAK 762

Query: 374  PPVEKPPVYKPP 409
            PPV  PP   PP
Sbjct: 763  PPVVTPPTATPP 774

 Score =  157 bits (398), Expect = 3e-37
 Identities = 68/132 (51%), Positives = 77/132 (58%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP+  PP+  PP  TPP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  
Sbjct: 693  PPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIAT 752

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   
Sbjct: 753  PPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTA 812

Query: 374  PPVEKPPVYKPP 409
            PP   PPV KPP
Sbjct: 813  PPTATPPVAKPP 824

 Score =  157 bits (398), Expect = 3e-37
 Identities = 69/135 (51%), Positives = 79/135 (58%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V  PP   PPV  PP   PP+  PP   PP   PPV KPPV  PP+  PP  KPP+  PP
Sbjct: 785  VATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPP 844

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            + KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPP
Sbjct: 845  ISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPP 904

Query: 365  VYKPPVEKPPVYKPP 409
            V  PP++ PP  KPP
Sbjct: 905  VAIPPIKTPPPAKPP 919

 Score =  157 bits (398), Expect = 3e-37
 Identities = 69/132 (52%), Positives = 77/132 (58%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP+  PP  KPP   PPI  PPV KPPV  PP   PP+   P+  PPV  PP    PV  
Sbjct: 908  PPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVAT 967

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPVEKPPV  PP+ KPP   
Sbjct: 968  PPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVL 1027

Query: 374  PPVEKPPVYKPP 409
            PP+ KPPV   P
Sbjct: 1028 PPIAKPPVETSP 1039

 Score =  157 bits (398), Expect = 3e-37
 Identities = 70/132 (53%), Positives = 78/132 (59%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP+   P+  PP  TPP    PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  
Sbjct: 943  PPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVAT 1002

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PP+  PPV KPPV  PP+ KPP   PP+ KPPVE  P   PP   PPV  PPV KPPV  
Sbjct: 1003 PPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAI 1062

Query: 374  PPVEKPPVYKPP 409
            PP+ KPPV  PP
Sbjct: 1063 PPITKPPVATPP 1074

 Score =  157 bits (397), Expect = 3e-37
 Identities = 67/135 (49%), Positives = 79/135 (58%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           + +PPV  PP   PP  TPPI  PP  K P+  PP+ + PV  PP    P+  PP  KPP
Sbjct: 345 IAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPP 404

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V  PP+ K P+  PP   PPV  PP+EKPPV  PP   PP   PPV KPPV  PP+  PP
Sbjct: 405 VATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPP 464

Query: 365 VYKPPVEKPPVYKPP 409
             KPP+  PP+ KPP
Sbjct: 465 TAKPPISTPPISKPP 479

 Score =  157 bits (397), Expect = 3e-37
 Identities = 71/140 (50%), Positives = 82/140 (58%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           +  PP+ + PV  PP  T PI  PP  KPPV  PP+ K P+  PP   PPV  PP+EKPP
Sbjct: 375 ISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPP 434

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--- 355
           V  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+    
Sbjct: 435 VATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPT 494

Query: 356 --KPPVYKPPVEKPPVYKPP 409
             KPPV  PP+  PPV KPP
Sbjct: 495 PVKPPVATPPLAIPPVAKPP 514

 Score =  157 bits (397), Expect = 3e-37
 Identities = 70/132 (53%), Positives = 79/132 (59%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP+ KPPV  PP  TPPI  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV K
Sbjct: 843  PPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAK 902

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PPV  PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP   
Sbjct: 903  PPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTAT 962

Query: 374  PPVEKPPVYKPP 409
             PV  PP+ KPP
Sbjct: 963  SPVATPPIAKPP 974

 Score =  157 bits (396), Expect = 5e-37
 Identities = 68/135 (50%), Positives = 78/135 (57%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP   PPV  PP   PP+  PP   PP   PPV KPPV  PP+  PP  KPP+  PP
Sbjct: 535 VATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPP 594

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           + K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPP
Sbjct: 595 ISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPP 654

Query: 365 VYKPPVEKPPVYKPP 409
           V  PP++ PP  KPP
Sbjct: 655 VATPPIKTPPPAKPP 669

 Score =  157 bits (396), Expect = 5e-37
 Identities = 69/135 (51%), Positives = 79/135 (58%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            ++ PP  KPPV  PP  TPP+ KPPV  PP   PP+   P+  PPV  PP    PV  PP
Sbjct: 910  IKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPP 969

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            + KPP   PP   PPV  PP+  PP  KPPV  PP+  PPV KPPV  PP+ KPP   PP
Sbjct: 970  IAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPP 1029

Query: 365  VYKPPVEKPPVYKPP 409
            + KPPVE  P   PP
Sbjct: 1030 IAKPPVETSPTATPP 1044

 Score =  156 bits (395), Expect = 6e-37
 Identities = 68/135 (50%), Positives = 79/135 (58%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP   PPV  PP  TPP  K P+  PP+ + PV  PP    P++ PP  KPPV  PP
Sbjct: 350 VATPPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPP 409

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           + K P+  PP   PPV  PP+ KPPV  PP   PP   PPV KPPVE PP+  PP  KPP
Sbjct: 410 IAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPP 469

Query: 365 VYKPPVEKPPVYKPP 409
           +  PP+ KPPV  PP
Sbjct: 470 ISTPPISKPPVATPP 484

 Score =  156 bits (395), Expect = 6e-37
 Identities = 68/135 (50%), Positives = 79/135 (58%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            ++ PP  KPPV  PP  TPP+ KPPV  PP   PP+  PP+  PPV  PP   PPV  PP
Sbjct: 660  IKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPP 719

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            + KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP
Sbjct: 720  IAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPP 779

Query: 365  VYKPPVEKPPVYKPP 409
            + K PV  PP   PP
Sbjct: 780  IAKSPVATPPTATPP 794

 Score =  156 bits (394), Expect = 8e-37
 Identities = 68/132 (51%), Positives = 77/132 (58%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP+  P   KPP  TPP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  
Sbjct: 488 PPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVAT 547

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   
Sbjct: 548 PPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAAT 607

Query: 374 PPVEKPPVYKPP 409
           PP+  PP  KPP
Sbjct: 608 PPITTPPPAKPP 619

 Score =  156 bits (394), Expect = 8e-37
 Identities = 67/133 (50%), Positives = 77/133 (57%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPPV  PP+  PP   PP+  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV 
Sbjct: 497 KPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVV 556

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  
Sbjct: 557 TPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPA 616

Query: 371 KPPVEKPPVYKPP 409
           KPPV  PP+  PP
Sbjct: 617 KPPVATPPIATPP 629

 Score =  155 bits (393), Expect = 1e-36
 Identities = 69/135 (51%), Positives = 79/135 (58%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            + KPPV  PP   PP  TPP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPP
Sbjct: 845  ISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPP 904

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP    P
Sbjct: 905  VAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSP 964

Query: 365  VYKPPVEKPPVYKPP 409
            V  PP+ KPP   PP
Sbjct: 965  VATPPIAKPPTTTPP 979

 Score =  155 bits (393), Expect = 1e-36
 Identities = 69/138 (50%), Positives = 82/138 (59%), Gaps = 6/138 (4%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPP------VEKPPVYKPPVEKPPVYKPPVE 175
            PPV  PPV KPP   PPI KPPV  PPV  PP      V  PP+  PP+ K P+  PPV 
Sbjct: 1048 PPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVS 1107

Query: 176  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
             PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   P + 
Sbjct: 1108 TPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIA 1167

Query: 356  KPPVYKPPVEKPPVYKPP 409
             PP+ KPPV  PP+ KPP
Sbjct: 1168 TPPIGKPPVATPPMAKPP 1185

 Score =  155 bits (392), Expect = 1e-36
 Identities = 69/132 (52%), Positives = 77/132 (58%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP+   PV KPP   PPI  PP  KPPV  PP+  PPV KPPV  PP   PP+   P+  
Sbjct: 893  PPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIAT 952

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PPV  PP    PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPV K
Sbjct: 953  PPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEK 1012

Query: 374  PPVEKPPVYKPP 409
            PPV  PP+ KPP
Sbjct: 1013 PPVATPPIAKPP 1024

 Score =  154 bits (390), Expect = 2e-36
 Identities = 68/135 (50%), Positives = 77/135 (57%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           +  P   KPPV  PP   PP+ KPPV  PP   PP+  PP+ K PV  PP   PPV  PP
Sbjct: 490 ITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPP 549

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           + KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP
Sbjct: 550 IAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPP 609

Query: 365 VYKPPVEKPPVYKPP 409
           +  PP  KPPV  PP
Sbjct: 610 ITTPPPAKPPVATPP 624

 Score =  154 bits (389), Expect = 3e-36
 Identities = 67/134 (50%), Positives = 78/134 (58%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP+  PP  K P  TPPI + PV  PP    P++ PP  KPPV  PP+ K P+  PP
Sbjct: 360 VATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPP 419

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
              PPV  PP+ KPPV  PP   PP   PPV KPPVE PP+  PP  KPP+  PP+ KPP
Sbjct: 420 TATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPP 479

Query: 365 VYKPPVEKPPVYKP 406
           V  PP   PP+  P
Sbjct: 480 VATPPAATPPITTP 493

 Score =  154 bits (389), Expect = 3e-36
 Identities = 66/133 (49%), Positives = 76/133 (57%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            KPPV  PP+  PP   PP+  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP  
Sbjct: 667  KPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTT 726

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
             PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV 
Sbjct: 727  IPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVA 786

Query: 371  KPPVEKPPVYKPP 409
             PP   PPV  PP
Sbjct: 787  TPPTATPPVATPP 799

 Score =  154 bits (388), Expect = 4e-36
 Identities = 74/166 (44%), Positives = 86/166 (51%), Gaps = 31/166 (18%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEK---------------PPVYKPPVEKPPVYKPP 139
            VEKPPV  PP+ KPP   PPI KPPVE                PPV KPPV  PP+ KPP
Sbjct: 1010 VEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPP 1069

Query: 140  VEKPPVYKPPVEKPPVYKPP----------------VEKPPVYKPPVEKPPVYKPPVEKP 271
            V  PPV  PP   PP+  PP                V  PP+ KPP+  PPV   P+ KP
Sbjct: 1070 VATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKP 1129

Query: 272  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            P+  PP   PPV  PP+ K P+ KPP+  PP   P +  PP+ KPP
Sbjct: 1130 PIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPP 1175

 Score =  153 bits (387), Expect = 5e-36
 Identities = 66/133 (49%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           K P+  PP+ + P  TPP    P++ PP  KPPV  PP+ K P+  PP   PPV  PP+ 
Sbjct: 372 KSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIE 431

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           KPPV  PP   PP   PPV KPPVE PP+  PP  KPP+  PP+ KPPV  PP   PP+ 
Sbjct: 432 KPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPIT 491

Query: 371 KPPVEKPPVYKPP 409
            P   KPPV  PP
Sbjct: 492 TPTPVKPPVATPP 504

 Score =  153 bits (387), Expect = 5e-36
 Identities = 68/132 (51%), Positives = 77/132 (58%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP+  PP  KPP  TPPI  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  K
Sbjct: 858  PPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAK 917

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP   
Sbjct: 918  PPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTT 977

Query: 374  PPVEKPPVYKPP 409
            PP   PPV  PP
Sbjct: 978  PPTATPPVAMPP 989

 Score =  153 bits (386), Expect = 7e-36
 Identities = 64/131 (48%), Positives = 78/131 (59%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P+ +PPV  PP  TPP+  PP+  PP  K P+  PP+ + PV  PP    P++ PP  KP
Sbjct: 344 PIAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKP 403

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
           PV  PP+ K P+  PP   PPV  PP+ KPPV  PP   PP   PPV KPPVE PP+  P
Sbjct: 404 PVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATP 463

Query: 377 PVEKPPVYKPP 409
           P  KPP+  PP
Sbjct: 464 PTAKPPISTPP 474

 Score =  152 bits (383), Expect = 1e-35
 Identities = 68/134 (50%), Positives = 79/134 (58%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            +  PP+ K P+  PP  TPPI KPPV  PP   PPV   P+ KPPV  PP   PPV KPP
Sbjct: 1261 IATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPP 1320

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V  PP   PPV  PP+ KPP  +PPV  PPV  PP+ K PV  PP+ KPPV   P+  PP
Sbjct: 1321 VATPPTVTPPVATPPIAKPPGARPPVATPPVATPPIAKSPVATPPMTKPPVASSPIATPP 1380

Query: 365  VYKPPVEKPPVYKP 406
            + K P+  PP   P
Sbjct: 1381 IAKTPIATPPTTMP 1394

 Score =  150 bits (380), Expect = 3e-35
 Identities = 62/132 (46%), Positives = 76/132 (57%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PPV  PP+  PP   PPI  PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  
Sbjct: 200 PPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIAN 259

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP+  PP+  PPV  PP+  PP+ KPPV  PP   PP+ KPP+  PP+  PP   PP   
Sbjct: 260 PPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAAT 319

Query: 374 PPVEKPPVYKPP 409
           PP+   P  KPP
Sbjct: 320 PPITTLPPAKPP 331

 Score =  150 bits (378), Expect = 6e-35
 Identities = 61/135 (45%), Positives = 79/135 (58%), Gaps = 2/135 (1%)
 Frame = +2

Query: 11  KPPVYKPP--VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           +PP +KPP     PP  +PP+  PP + PP+  PP+ K PV  PP+  PP   PP+  PP
Sbjct: 187 QPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPP 246

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V  PP+  PP+  PP+  PP+  PPV  PP+  PP+ KPPV  PP   PP+ KPP+  PP
Sbjct: 247 VATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPP 306

Query: 365 VYKPPVEKPPVYKPP 409
           +  PP   PP   PP
Sbjct: 307 ISTPPAATPPAATPP 321

 Score =  150 bits (378), Expect = 6e-35
 Identities = 63/135 (46%), Positives = 77/135 (57%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP+  PP + PP  TPPI K PV  PP+  PP   PP+  PPV  PP+  PP+  PP
Sbjct: 202 VASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPP 261

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           +  PP+  PPV  PP+  PP+ KPPV  PP   PP+ KPP+  PP+  PP   PP   PP
Sbjct: 262 IIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPP 321

Query: 365 VYKPPVEKPPVYKPP 409
           +   P  KPPV   P
Sbjct: 322 ITTLPPAKPPVAISP 336

 Score =  147 bits (371), Expect = 4e-34
 Identities = 66/143 (46%), Positives = 80/143 (55%), Gaps = 8/143 (5%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           + K PV  PP+  PP  TPPI  PPV  PP+  PP+  PP+  PP+  PPV  PP+  PP
Sbjct: 222 IAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPP 281

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPP 349
           + KPPV  PP   PP+ KPP+  PP+  PP   PP   PP+      KPPV   P+  PP
Sbjct: 282 ISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPPVAISPIVTPP 341

Query: 350 V---EKPPVYKPPVEKPPVYKPP 409
           V    +PPV  PP   PPV  PP
Sbjct: 342 VTPIAQPPVATPPTATPPVATPP 364

 Score =  146 bits (368), Expect = 8e-34
 Identities = 64/142 (45%), Positives = 80/142 (56%), Gaps = 8/142 (5%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           + PP+  PP+ K P  TPPI  PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV
Sbjct: 213 QMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPV 272

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPV 352
             PP+  PP+ KPPV  PP   PP+ KPP+  PP+  PP   PP   PP+      KPPV
Sbjct: 273 AAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPPV 332

Query: 353 EKPPVYKPPV---EKPPVYKPP 409
              P+  PPV    +PPV  PP
Sbjct: 333 AISPIVTPPVTPIAQPPVATPP 354

 Score =  144 bits (362), Expect = 4e-33
 Identities = 65/139 (46%), Positives = 79/139 (56%), Gaps = 6/139 (4%)
 Frame = +2

Query: 11  KPPVYKPP--VEKPPEYTPP--IYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPV 172
           KPP  KPP    KPP   PP    +PP  KPP     PPV  PP+  PP + PP+  PP+
Sbjct: 163 KPPSVKPPPSTPKPPTTNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPI 222

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
            K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV  PP+  PP+
Sbjct: 223 AKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPI 282

Query: 353 EKPPVYKPPVEKPPVYKPP 409
            KPPV  PP   PP+ KPP
Sbjct: 283 SKPPVTTPPTTTPPIAKPP 301

 Score =  139 bits (350), Expect = 1e-31
 Identities = 65/139 (46%), Positives = 78/139 (56%), Gaps = 6/139 (4%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPP--IYKPPVEKPP--VYKPPVEKPP--VYKPPVEKPPVYKPPV 172
           KPP  KPP  KPP   PP    KPP   PP    +PP  KPP     PPV  PP+  PP 
Sbjct: 154 KPPTIKPP-PKPPSVKPPPSTPKPPTTNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPT 212

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           + PP+  PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV
Sbjct: 213 QMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPV 272

Query: 353 EKPPVYKPPVEKPPVYKPP 409
             PP+  PP+ KPPV  PP
Sbjct: 273 AAPPITNPPISKPPVTTPP 291

 Score =  132 bits (332), Expect = 1e-29
 Identities = 64/138 (46%), Positives = 75/138 (54%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPPV   P+  PP    PI +PPV  PP   PPV  PP+  PP  K P+  PP+ + PV 
Sbjct: 329 KPPVAISPIVTPP--VTPIAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVA 386

Query: 191 KPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
            PP    P+  PP  KP     P+ K P+  PP   PPV  PP+ KPPV  PP   PP  
Sbjct: 387 TPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTA 446

Query: 356 KPPVYKPPVEKPPVYKPP 409
            PPV KPPVE PP+  PP
Sbjct: 447 TPPVAKPPVETPPIATPP 464

 Score =  129 bits (325), Expect = 8e-29
 Identities = 62/137 (45%), Positives = 74/137 (54%), Gaps = 6/137 (4%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP--VEK 178
           P  KPP +  P   PP  KPP  KPP  KPP    KPP   PP    +PP +KPP     
Sbjct: 141 PHPKPPTKHHPHPKPPTIKPP-PKPPSVKPPPSTPKPPTTNPPPSTPQPPTHKPPPCTPT 199

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PPV  PP+  PP   PP+  PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  
Sbjct: 200 PPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIAN 259

Query: 359 PPVYKPPVEKPPVYKPP 409
           PP+  PP+  PPV  PP
Sbjct: 260 PPIIMPPIATPPVAAPP 276

 Score =  128 bits (322), Expect = 2e-28
 Identities = 65/164 (39%), Positives = 79/164 (48%), Gaps = 31/164 (18%)
 Frame = +2

Query: 11  KPPVYKP-PVEKPPEYTPPIYKPPVE-----KPPVYKPP--------------------- 109
           KPP  KP P  KPP    P  KPP +     KPP  KPP                     
Sbjct: 123 KPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPPPKPPSVKPPPSTPKPPTTNPP 182

Query: 110 --VEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 277
               +PP +KPP     PPV  PP+  PP   PP+  PP+ K PV  PP+  PP   PP+
Sbjct: 183 PSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPI 242

Query: 278 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
             PPV  PP+  PP+  PP+  PP+  PPV  PP+  PP+ KPP
Sbjct: 243 TIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPP 286

 Score =  110 bits (276), Expect = 4e-23
 Identities = 69/163 (42%), Positives = 76/163 (46%), Gaps = 30/163 (18%)
 Frame = +2

Query: 11  KPPVYKP-PVEKPPEYTPPIYKPPVE-----KPPVYKPPVE-------KPPVYKP----- 136
           KPP  KP P  KPP    P  KPP +     KPP  KPP         KPP  KP     
Sbjct: 75  KPPTVKPHPHPKPPTKPHPHPKPPTKPHPHPKPPTIKPPPHPKPRPHPKPPNVKPHPHPK 134

Query: 137 ------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP--VEKPPVYKPP--VEKPPVYKP 286
                 P  KPP    P  KPP  KPP  KPP  KPP    KPP   PP    +PP +KP
Sbjct: 135 PPTKPHPHPKPPTKHHPHPKPPTIKPP-PKPPSVKPPPSTPKPPTTNPPPSTPQPPTHKP 193

Query: 287 P--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           P     PPV  PP+  PP   PP+  PP+ K PV  PP+  PP
Sbjct: 194 PPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPP 236

 Score =  104 bits (259), Expect = 4e-21
 Identities = 68/149 (45%), Positives = 70/149 (46%), Gaps = 16/149 (10%)
 Frame = +2

Query: 11  KPPVYKPPVEKP-PEYTPPIYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--- 175
           KPP  KPP  K  P   PP  KP P  KPP    P  KPP    P  KPP  KPP     
Sbjct: 59  KPPTIKPPPPKRHPHPKPPTVKPHPHPKPPTKPHPHPKPPTKPHPHPKPPTIKPPPHPKP 118

Query: 176 ----KPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP--VEKPP 334
               KPP  KP P  KPP    P  KPP    P  KPP  KPP  KPP  KPP    KPP
Sbjct: 119 RPHPKPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPP-PKPPSVKPPPSTPKPP 177

Query: 335 VYKPP--VEKPPVYKPP--VEKPPVYKPP 409
              PP    +PP +KPP     PPV  PP
Sbjct: 178 TTNPPPSTPQPPTHKPPPCTPTPPVASPP 206

 Score =  101 bits (251), Expect = 3e-20
 Identities = 66/143 (46%), Positives = 69/143 (48%), Gaps = 11/143 (7%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKP-PVYKPPVEKPPVYKP-PVEKPPVYKP-PVEKPP 184
           PP   P   KPP+++    KPP  KP P  KPP  KPP  K  P  KPP  KP P  KPP
Sbjct: 29  PPKPSPKPHKPPKHSVVPPKPPAVKPHPHPKPPTIKPPPPKRHPHPKPPTVKPHPHPKPP 88

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVE-------KPPVYKP-PVEKPPVYKPPVEKPPVY 340
               P  KPP    P  KPP  KPP         KPP  KP P  KPP    P  KPP  
Sbjct: 89  TKPHPHPKPPTKPHPHPKPPTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTK 148

Query: 341 KPPVEKPPVYKPPVEKPPVYKPP 409
             P  KPP  KPP  KPP  KPP
Sbjct: 149 HHPHPKPPTIKPP-PKPPSVKPP 170

 Score =  101 bits (251), Expect = 3e-20
 Identities = 67/140 (47%), Positives = 72/140 (51%), Gaps = 7/140 (5%)
 Frame = +2

Query: 11  KPPVYKP-PVEKPPEYTPPIYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPP 184
           KPP  KP P  KPP   PP    P ++ P  KPP  KP P  KPP +  P  KPP +  P
Sbjct: 48  KPPAVKPHPHPKPPTIKPP----PPKRHPHPKPPTVKPHPHPKPPTKPHPHPKPPTKPHP 103

Query: 185 VYKPPVEKPPVY-KP-PVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
             KPP  KPP + KP P  KPP  KP P  KPP    P  KPP    P  KPP  KPP  
Sbjct: 104 HPKPPTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPP-P 162

Query: 356 KPPVYKPP--VEKPPVYKPP 409
           KPP  KPP    KPP   PP
Sbjct: 163 KPPSVKPPPSTPKPPTTNPP 182

[26][TOP]
>UniRef100_Q9FUR5 ENOD2f (Fragment) n=1 Tax=Maackia amurensis RepID=Q9FUR5_9FABA
          Length = 308

 Score =  172 bits (436), Expect = 1e-41
 Identities = 96/149 (64%), Positives = 105/149 (70%), Gaps = 17/149 (11%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-EYTPPIYKPPVE-------KPPVYKPPVEK-PPVYKPPVEKPPV-YK 163
           PP Y+PP EKPP EY PP  KPP E        PP Y+PP EK PP+Y PP EKPPV Y 
Sbjct: 83  PPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPVEYP 142

Query: 164 PPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEK 328
           PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP EKPP+ Y PP EK
Sbjct: 143 PPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEK 202

Query: 329 -PPVYKPPVEK-PPVYKPPVEKPPVYKPP 409
            PPVY+PP EK PP Y PP EKPP+  PP
Sbjct: 203 PPPVYQPPYEKPPPTYPPPHEKPPIEYPP 231

 Score =  170 bits (430), Expect = 5e-41
 Identities = 94/147 (63%), Positives = 103/147 (70%), Gaps = 15/147 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP 184
           PP Y+PP EKPP    P+Y PP EKPPV Y PP EKPP VY+PP EKPP+ Y PP EKPP
Sbjct: 116 PPEYQPPYEKPP----PLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPP 171

Query: 185 -VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPV-YKP 346
            VY+PP EKPP VY PP EKPP+ Y PP EKPP VY+PP EKPP  Y PP EKPP+ Y P
Sbjct: 172 PVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPPTYPPPHEKPPIEYPP 231

Query: 347 PVEK------PPVYKPPVEKPPVYKPP 409
           P EK      PP+Y PP EKPP   PP
Sbjct: 232 PHEKPPYEKPPPLYPPPYEKPPPLYPP 258

 Score =  170 bits (430), Expect = 5e-41
 Identities = 96/172 (55%), Positives = 106/172 (61%), Gaps = 40/172 (23%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-------EYTPPIYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP-VYK 163
           PP+Y PP EKPP       E  PP+Y+PP EKPP+ Y PP EKPP VY+PP EKPP VY 
Sbjct: 127 PPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYP 186

Query: 164 PPVEKPPV-YKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPV--- 322
           PP EKPP+ Y PP EKPP VY+PP EKPP  Y PP EKPP+ Y PP EKPP  KPP    
Sbjct: 187 PPHEKPPIEYPPPHEKPPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYP 246

Query: 323 ---------------------EKPPVYKPPVEKPPVYK--PPVEKPPVYKPP 409
                                EKPP YKPPV +PP  +  PPVEKPP YKPP
Sbjct: 247 PPYEKPPPLYPPPHHHKPPHHEKPPFYKPPVYEPPPLEKPPPVEKPPSYKPP 298

 Score =  169 bits (427), Expect = 1e-40
 Identities = 95/149 (63%), Positives = 104/149 (69%), Gaps = 17/149 (11%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-EYTPPIYKPPVE-------KPPVYKPPVEK-PPVYKPPVEK-PPVYK 163
           PP Y+PP EKPP EY PP  KPP E        PP + PP EK PP Y+PP EK PP+Y 
Sbjct: 72  PPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYP 131

Query: 164 PPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEK 328
           PP EKPPV Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP EK
Sbjct: 132 PPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEK 191

Query: 329 PPV-YKPPVEK-PPVYKPPVEKPPVYKPP 409
           PP+ Y PP EK PPVY+PP EKPP   PP
Sbjct: 192 PPIEYPPPHEKPPPVYQPPYEKPPPTYPP 220

 Score =  165 bits (418), Expect = 1e-39
 Identities = 94/153 (61%), Positives = 104/153 (67%), Gaps = 18/153 (11%)
 Frame = +2

Query: 5   VEKPPVYKPP--VEKPPEYTPPIYKPPVE-------KPPVYKPPVEK-PPVYKPPVEK-P 151
           V+ PP Y+PP   E PPEY PP  KPP E        PP Y+PP EK PP Y PP EK P
Sbjct: 46  VKPPPEYEPPPEYEPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPP 105

Query: 152 PVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKP 316
           P + PP EK PP Y+PP EK PP+Y PP EKPPV Y PP EK PPVY+PP EKPP+ Y P
Sbjct: 106 PEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPP 165

Query: 317 PVEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPP 409
           P EK PPVY+PP EK PPVY PP EKPP+  PP
Sbjct: 166 PHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPP 198

 Score =  159 bits (403), Expect = 7e-38
 Identities = 95/161 (59%), Positives = 106/161 (65%), Gaps = 27/161 (16%)
 Frame = +2

Query: 8   EKPPVYKPP-VEKPP--------EYTPPIYKPP--------VEKPPVYKPPVEK-PPVYK 133
           EKPP Y+PP +EKPP         Y PP  KPP         E PP Y+PP EK PP Y+
Sbjct: 17  EKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEPPPEYQPPHEKPPPEYQ 76

Query: 134 PPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK 298
           PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK PP+Y PP EK
Sbjct: 77  PPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEK 136

Query: 299 PPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPP 409
           PPV Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP
Sbjct: 137 PPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPP 177

 Score =  158 bits (400), Expect = 2e-37
 Identities = 91/159 (57%), Positives = 105/159 (66%), Gaps = 26/159 (16%)
 Frame = +2

Query: 11  KPPVYKPP-VEKPPEY-------TPPIYKPP--------VEKPPVYKPP--VEKPPVYKP 136
           KPP+Y+PP  EKPP Y        PP+Y+PP        V+ PP Y+PP   E PP Y+P
Sbjct: 7   KPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEPPPEYQP 66

Query: 137 PVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK- 298
           P EK PP Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK 
Sbjct: 67  PHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKP 126

Query: 299 PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPVYKPP 409
           PP+Y PP EKPPV Y PP EK PPVY+PP EKPP+  PP
Sbjct: 127 PPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPP 165

 Score =  150 bits (380), Expect = 3e-35
 Identities = 87/157 (55%), Positives = 96/157 (61%), Gaps = 35/157 (22%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-------EYTPPIYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP-VYK 163
           PPVY+PP EKPP       E  PP+Y+PP EKPP VY PP EKPP+ Y PP EKPP VY+
Sbjct: 149 PPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQ 208

Query: 164 PPVEKPP-VYKPPVEKPPV-YKPPVEKPP------VYKPPVEKPPVYKPPV--------E 295
           PP EKPP  Y PP EKPP+ Y PP EKPP      +Y PP EKPP   PP         E
Sbjct: 209 PPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHE 268

Query: 296 KPPVYKPPV-------EKPPVYKPPVEKPPVYK--PP 379
           KPP YKPPV       + PPV KPP  KPP Y+  PP
Sbjct: 269 KPPFYKPPVYEPPPLEKPPPVEKPPSYKPPPYRHYPP 305

 Score =  142 bits (358), Expect = 1e-32
 Identities = 82/138 (59%), Positives = 94/138 (68%), Gaps = 19/138 (13%)
 Frame = +2

Query: 53  YTPPIYKPP-VEKPPVYKPP-VEK-PPVYKPP--------VEKPPVYKPP--VEKPPVYK 193
           Y PPIY+PP  EKPP Y+PP +EK PPVY+PP        V+ PP Y+PP   E PP Y+
Sbjct: 6   YKPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEPPPEYQ 65

Query: 194 PPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK 358
           PP EK PP Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK
Sbjct: 66  PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEK 125

Query: 359 -PPVYKPPVEKPPVYKPP 409
            PP+Y PP EKPPV  PP
Sbjct: 126 PPPLYPPPHEKPPVEYPP 143

 Score =  108 bits (271), Expect = 1e-22
 Identities = 65/118 (55%), Positives = 73/118 (61%), Gaps = 3/118 (2%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVY-KPPVEK-PPVYKPPVEKPPVYKPPVEK 178
           V +PP  KP    PP Y PP  KPP+E PP + KPP EK PP+Y PP EKPP   PP   
Sbjct: 206 VYQPPYEKP----PPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPP--- 258

Query: 179 PPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           P  +KPP  EKPP YKPPV +P    PP+EKP    PPVEKPP YKPP   P  + PP
Sbjct: 259 PHHHKPPHHEKPPFYKPPVYEP----PPLEKP----PPVEKPPSYKPP---PYRHYPP 305

[27][TOP]
>UniRef100_P08297 Early nodulin-75 n=1 Tax=Glycine max RepID=NO75_SOYBN
          Length = 309

 Score =  169 bits (427), Expect = 1e-40
 Identities = 92/154 (59%), Positives = 106/154 (68%), Gaps = 22/154 (14%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-------EYTPPIYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPV-YKP 166
           PP Y+PP EKPP       E  PP Y+PP EKPP  ++PP EKPP ++PP EKPP  Y+P
Sbjct: 145 PPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEHQPPHEKPPEHQPPHEKPPPEYQP 204

Query: 167 PVEKPPV-YKPPVEKPPVYKPPVE-------KPPVYKPPVEKPP-VYKPPVEKPP-VYKP 316
           P EKPP  Y+PP EKPP  KPP E        PP ++PP EKPP VY PP EKPP VY+P
Sbjct: 205 PHEKPPPEYQPPQEKPPHEKPPPEYQPPHEKPPPEHQPPHEKPPPVYPPPYEKPPPVYEP 264

Query: 317 PVEKPP--VYKPPVEKPPVYK-PPVEKPPVYKPP 409
           P EKPP  VY PP EKPP+Y+ PP+EKPPVY PP
Sbjct: 265 PYEKPPPVVYPPPHEKPPIYEPPPLEKPPVYNPP 298

 Score =  158 bits (399), Expect = 2e-37
 Identities = 87/141 (61%), Positives = 103/141 (73%), Gaps = 9/141 (6%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-EYTPPIYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-P 181
           PP Y+PP EKPP E  PP ++PP EKPP ++PP EK PP Y+PP EK PP Y+PP EK P
Sbjct: 97  PPEYQPPHEKPPHENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPHEKPPPEYQPPHEKPP 156

Query: 182 PVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPP 349
           P Y+PP EK PP Y+PP EK PP ++PP EKPP ++PP EK PP Y+PP EK PP Y+PP
Sbjct: 157 PEYQPPHEKPPPEYQPPHEKPPPEHQPPHEKPPEHQPPHEKPPPEYQPPHEKPPPEYQPP 216

Query: 350 VEKPPVYKPPVE-KPPVYKPP 409
            EKPP  KPP E +PP  KPP
Sbjct: 217 QEKPPHEKPPPEYQPPHEKPP 237

 Score =  154 bits (388), Expect = 4e-36
 Identities = 86/145 (59%), Positives = 101/145 (69%), Gaps = 13/145 (8%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEK------PPVYKPPVEKPPVYKPPVEK-PPVYKPPV 172
           PP Y PP EKPP    P Y+PP EK      PP ++PP EKPP ++PP EK PP Y+PP 
Sbjct: 86  PPEYLPPHEKPP----PEYQPPHEKPPHENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPH 141

Query: 173 EK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPPVEK-PPV 337
           EK PP Y+PP EK PP Y+PP EK PP Y+PP EK PP ++PP EKPP ++PP EK PP 
Sbjct: 142 EKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEHQPPHEKPPEHQPPHEKPPPE 201

Query: 338 YKPPVEK-PPVYKPPVEKPPVYKPP 409
           Y+PP EK PP Y+PP EKPP  KPP
Sbjct: 202 YQPPHEKPPPEYQPPQEKPPHEKPP 226

 Score =  151 bits (382), Expect = 2e-35
 Identities = 87/157 (55%), Positives = 105/157 (66%), Gaps = 22/157 (14%)
 Frame = +2

Query: 5   VEKPPVYKPP-VEKPPEYTPPI------YKPPVEK-PPVYKPPVEK--PPVYKPPVEK-P 151
           +EKPP Y+PP   KPP Y PP+      Y+PP EK PP Y PP  +  PP Y PP EK P
Sbjct: 38  IEKPPTYEPPPFYKPPYYPPPVHHPPPEYQPPHEKTPPEYLPPPHEKPPPEYLPPHEKPP 97

Query: 152 PVYKPPVEK------PPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PP 304
           P Y+PP EK      PP ++PP EKPP ++PP EK PP Y+PP EK PP Y+PP EK PP
Sbjct: 98  PEYQPPHEKPPHENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPHEKPPPEYQPPHEKPPP 157

Query: 305 VYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPP 409
            Y+PP EK PP Y+PP EK PP ++PP EKPP ++PP
Sbjct: 158 EYQPPHEKPPPEYQPPHEKPPPEHQPPHEKPPEHQPP 194

 Score =  144 bits (362), Expect = 4e-33
 Identities = 81/138 (58%), Positives = 94/138 (68%), Gaps = 13/138 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPI------YKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PP ++PP EKPPE+ PP       Y+PP EK PP Y+PP EKPP  KP    PP Y+PP 
Sbjct: 178 PPEHQPPHEKPPEHQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPHEKP----PPEYQPPH 233

Query: 173 EK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPP--VYKPPVEKPPVYK-PPVEKPP 334
           EK PP ++PP EK PPVY PP EK PPVY+PP EKPP  VY PP EKPP+Y+ PP+EKPP
Sbjct: 234 EKPPPEHQPPHEKPPPVYPPPYEKPPPVYEPPYEKPPPVVYPPPHEKPPIYEPPPLEKPP 293

Query: 335 VYKPPVEKPPVYKPPVEK 388
           VY PP   P    PP +K
Sbjct: 294 VYNPP---PYGRYPPSKK 308

 Score =  134 bits (338), Expect = 2e-30
 Identities = 79/140 (56%), Positives = 91/140 (65%), Gaps = 16/140 (11%)
 Frame = +2

Query: 38  EKPPEYTPPIYK-PPVEKPPVYKPPV-EKPPVYKPPVEK-PPVYKPPVEK--PPVYKPPV 202
           E PP   PP Y+ PP  KPP Y PPV   PP Y+PP EK PP Y PP  +  PP Y PP 
Sbjct: 34  EPPPIEKPPTYEPPPFYKPPYYPPPVHHPPPEYQPPHEKTPPEYLPPPHEKPPPEYLPPH 93

Query: 203 EK-PPVYKPPVEK------PPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVE 355
           EK PP Y+PP EK      PP ++PP EKPP ++PP EK PP Y+PP EK PP Y+PP E
Sbjct: 94  EKPPPEYQPPHEKPPHENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPHEKPPPEYQPPHE 153

Query: 356 K-PPVYKPPVEK-PPVYKPP 409
           K PP Y+PP EK PP Y+PP
Sbjct: 154 KPPPEYQPPHEKPPPEYQPP 173

[28][TOP]
>UniRef100_Q94G51 Proline-rich protein-1 n=1 Tax=Gossypium hirsutum
           RepID=Q94G51_GOSHI
          Length = 299

 Score =  162 bits (410), Expect = 1e-38
 Identities = 78/148 (52%), Positives = 102/148 (68%), Gaps = 15/148 (10%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 175
           KPPVY+PP ++ PE  PP+Y PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +
Sbjct: 141 KPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKK 199

Query: 176 -----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVE 325
                KPP+Y+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP   PP+Y+P   
Sbjct: 200 EKPEPKPPMYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPP-NNPPIYEPKPP 257

Query: 326 KPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           KPPVY PP E+ P  KPPV +PP ++PP
Sbjct: 258 KPPVYAPPKEEKPKPKPPVYEPPAHEPP 285

 Score =  162 bits (409), Expect = 1e-38
 Identities = 82/158 (51%), Positives = 105/158 (66%), Gaps = 25/158 (15%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVY 160
           KPP+Y PP ++ PE  PP+Y+PP +     KPPVY PP +     KPPVY+PP +KPP+Y
Sbjct: 126 KPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPVYEPP-KKPPMY 184

Query: 161 KPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVY 310
           +P   KPPVY PP +     KPP+Y+PP +KPP+Y+P   KPPVY PP +     KPP+Y
Sbjct: 185 EPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMY 243

Query: 311 KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPP 409
           +PP   PP+Y+P   KPPVY PP E     KPPVY+PP
Sbjct: 244 QPP-NNPPIYEPKPPKPPVYAPPKEEKPKPKPPVYEPP 280

 Score =  161 bits (407), Expect = 2e-38
 Identities = 83/158 (52%), Positives = 105/158 (66%), Gaps = 25/158 (15%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE----- 145
           KPPVY+PP ++ PE  PPIY PP +     KPPVY+PP +     KPPVY PP +     
Sbjct: 111 KPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEP 170

Query: 146 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVY 310
           KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP +KPP+Y+P   KPPVY
Sbjct: 171 KPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPPMYEPKPPKPPVY 228

Query: 311 KPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PP +     KPP+Y+PP   PP+Y+P   KPPVY PP
Sbjct: 229 TPPKKEKPEPKPPMYQPP-NNPPIYEPKPPKPPVYAPP 265

 Score =  156 bits (394), Expect = 8e-37
 Identities = 72/138 (52%), Positives = 95/138 (68%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPPVY PP ++ P+  PP+Y+PP ++ P  KPP+  PP  + P  KPPVY+PP ++ P  
Sbjct: 96  KPPVYTPPKKEVPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEP 155

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE 355
           KPPV  PP  + P  KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP +
Sbjct: 156 KPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-K 213

Query: 356 KPPVYKPPVEKPPVYKPP 409
           KPP+Y+P   KPPVY PP
Sbjct: 214 KPPMYEPKPPKPPVYTPP 231

 Score =  153 bits (387), Expect = 5e-36
 Identities = 73/142 (51%), Positives = 96/142 (67%), Gaps = 10/142 (7%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE 175
           KPPVY PP ++ PE  PP+Y+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP +
Sbjct: 156 KPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-K 213

Query: 176 KPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
           KPP+Y+P   KPPVY PP +     KPP+Y+PP   PP+Y+P   KPPVY PP E+ P  
Sbjct: 214 KPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPP-NNPPIYEPKPPKPPVYAPPKEEKPKP 272

Query: 341 KPPVEKPPVYKPPVEKPPVYKP 406
           KPPV +PP ++PP    P + P
Sbjct: 273 KPPVYEPPAHEPPYGHYPGHPP 294

 Score =  147 bits (372), Expect = 3e-34
 Identities = 80/163 (49%), Positives = 101/163 (61%), Gaps = 32/163 (19%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTP--PIYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE----- 145
           PV+KPP  KPP Y P  P+Y+PP +     KPPVY PP +     KP +Y+PP +     
Sbjct: 36  PVFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPTMYEPPKKEKPEP 95

Query: 146 KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVY 280
           KPPVY PP +     KPPVY+PP +     KPP+Y PP +     KPPVY+PP ++ P  
Sbjct: 96  KPPVYTPPKKEVPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEP 155

Query: 281 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           KPPV  PP  + P  KPPVY+PP +KPP+Y+P   KPPVY PP
Sbjct: 156 KPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPP 197

 Score =  134 bits (337), Expect = 3e-30
 Identities = 63/128 (49%), Positives = 84/128 (65%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           +KPP+Y+P   KPP YTPP  + P  KPP+Y+PP +KPP+Y+P   KPPVY PP ++ P 
Sbjct: 179 KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPPMYEPKPPKPPVYTPPKKEKPE 237

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
            KPP+ +PP        PP+Y+P   KPPVY PP E+ P  KPPV +PP ++PP    P 
Sbjct: 238 PKPPMYQPP------NNPPIYEPKPPKPPVYAPPKEEKPKPKPPVYEPPAHEPPYGHYPG 291

Query: 368 YKPPVEKP 391
           + PP+ KP
Sbjct: 292 H-PPLGKP 298

[29][TOP]
>UniRef100_O49201 Proline-rich protein n=1 Tax=Gossypium hirsutum RepID=O49201_GOSHI
          Length = 299

 Score =  160 bits (404), Expect = 5e-38
 Identities = 82/158 (51%), Positives = 105/158 (66%), Gaps = 25/158 (15%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE----- 145
           KPPVY+PP ++ PE  PPIY PP +     KPPVY+PP +     +PPVY PP +     
Sbjct: 111 KPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPRPPVYTPPKKEKPEP 170

Query: 146 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVY 310
           KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP +KPP+Y+P   KPPVY
Sbjct: 171 KPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPPMYEPKPPKPPVY 228

Query: 311 KPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PP +     KPP+Y+PP   PP+Y+P   KPPVY PP
Sbjct: 229 TPPKKEKPEPKPPMYQPP-NNPPIYEPKPPKPPVYAPP 265

 Score =  158 bits (400), Expect = 2e-37
 Identities = 77/148 (52%), Positives = 100/148 (67%), Gaps = 15/148 (10%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 175
           KPPVY+PP ++ PE  PP+Y PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +
Sbjct: 141 KPPVYEPPKKEKPEPRPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKK 199

Query: 176 -----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVE 325
                KPP+Y+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP   PP+Y+P   
Sbjct: 200 EKPEPKPPMYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPP-NNPPIYEPKPP 257

Query: 326 KPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           KPPVY PP E+ P  KPPV   P ++PP
Sbjct: 258 KPPVYAPPKEEKPKPKPPVYDAPAHEPP 285

 Score =  157 bits (398), Expect = 3e-37
 Identities = 78/153 (50%), Positives = 102/153 (66%), Gaps = 20/153 (13%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVY 160
           KPP+Y PP ++ PE  PP+Y+PP +     +PPVY PP +     KPPVY+PP +KPP+Y
Sbjct: 126 KPPIYTPPKKEKPEPKPPVYEPPKKEKPEPRPPVYTPPKKEKPEPKPPVYEPP-KKPPMY 184

Query: 161 KPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVY 310
           +P   KPPVY PP +     KPP+Y+PP +KPP+Y+P   KPPVY PP +     KPP+Y
Sbjct: 185 EPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMY 243

Query: 311 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           +PP   PP+Y+P   KPPVY PP E+ P  KPP
Sbjct: 244 QPP-NNPPIYEPKPPKPPVYAPPKEEKPKPKPP 275

 Score =  156 bits (395), Expect = 6e-37
 Identities = 77/153 (50%), Positives = 102/153 (66%), Gaps = 20/153 (13%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE----- 175
           KPP+Y+PP ++ PE  PP+Y PP ++ P  KPPV +PP  + P  KPP+Y PP +     
Sbjct: 81  KPPMYEPPKKEKPEPKPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEP 140

Query: 176 KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 325
           KPPVY+PP +     +PPVY PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +
Sbjct: 141 KPPVYEPPKKEKPEPRPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKK 199

Query: 326 -----KPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
                KPP+Y+PP +KPP+Y+P   KPPVY PP
Sbjct: 200 EKPEPKPPMYEPP-KKPPMYEPKPPKPPVYTPP 231

 Score =  155 bits (391), Expect = 2e-36
 Identities = 76/153 (49%), Positives = 102/153 (66%), Gaps = 20/153 (13%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVY 160
           KPPVY PP ++ P+  PP+Y+PP +     KPP+Y PP +     KPPVY+PP ++ P  
Sbjct: 96  KPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEP 155

Query: 161 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE 325
           +PPV  PP  + P  KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP +
Sbjct: 156 RPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-K 213

Query: 326 KPPVYKPPVEKPPVYKPPVE-----KPPVYKPP 409
           KPP+Y+P   KPPVY PP +     KPP+Y+PP
Sbjct: 214 KPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPP 246

 Score =  153 bits (387), Expect = 5e-36
 Identities = 74/148 (50%), Positives = 97/148 (65%), Gaps = 15/148 (10%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 175
           KPPVY+PP ++ PE  PP+Y PP +     KPP+Y+PP ++ P  KPPV  PP  + P  
Sbjct: 51  KPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPPMYEPPKKEKPEPKPPVYTPPKKEEPKP 110

Query: 176 KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 325
           KPPVY+PP +     KPP+Y PP +     KPPVY+PP ++ P  +PPV  PP  + P  
Sbjct: 111 KPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPRPPVYTPPKKEKPEP 170

Query: 326 KPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           KPPVY+PP +KPP+Y+P   KPPVY PP
Sbjct: 171 KPPVYEPP-KKPPMYEPKPPKPPVYTPP 197

 Score =  148 bits (374), Expect = 2e-34
 Identities = 71/142 (50%), Positives = 94/142 (66%), Gaps = 10/142 (7%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE 175
           +PPVY PP ++ PE  PP+Y+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP +
Sbjct: 156 RPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-K 213

Query: 176 KPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
           KPP+Y+P   KPPVY PP +     KPP+Y+PP   PP+Y+P   KPPVY PP E+ P  
Sbjct: 214 KPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPP-NNPPIYEPKPPKPPVYAPPKEEKPKP 272

Query: 341 KPPVEKPPVYKPPVEKPPVYKP 406
           KPPV   P ++PP    P + P
Sbjct: 273 KPPVYDAPAHEPPYGHYPGHPP 294

 Score =  135 bits (340), Expect = 1e-30
 Identities = 68/132 (51%), Positives = 86/132 (65%), Gaps = 5/132 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPPVY+PP +KPP Y P   KPPV  PP  + P  KPP+Y+PP +KPP+Y+P   KPPVY
Sbjct: 171 KPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPPMYEPKPPKPPVY 228

Query: 191 KPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
            PP +     KPP+Y+PP   PP+Y+P   KPPVY PP E+ P  KPPV   P ++PP  
Sbjct: 229 TPPKKEKPEPKPPMYQPP-NNPPIYEPKPPKPPVYAPPKEEKPKPKPPVYDAPAHEPPYG 287

Query: 356 KPPVYKPPVEKP 391
             P + PP+ KP
Sbjct: 288 HYPGH-PPLGKP 298

[30][TOP]
>UniRef100_Q6PZE9 Putative uncharacterized protein (Fragment) n=1 Tax=Brassica napus
           var. napus RepID=Q6PZE9_BRANA
          Length = 225

 Score =  158 bits (400), Expect = 2e-37
 Identities = 79/146 (54%), Positives = 95/146 (65%), Gaps = 14/146 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPE--YTPPIYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKPPVE 175
           PPV  PPV+KPP   Y+PP+  PPV+KPP   Y PP++ PPV KPP     PP+  PPV+
Sbjct: 74  PPVKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVQ 133

Query: 176 KPPV--YKPPVEKPPVYKPPVE--KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVE--KPP 334
           KPP   Y PPV+ PPV KPP     PP+  PPV+ P P+Y PPV+ PPV KPP     PP
Sbjct: 134 KPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVQKPPTPTYSPP 193

Query: 335 VYKPPVEKP-PVYKPPVEKPPVYKPP 409
           +  PPV+ P P Y PPV+ PPV KPP
Sbjct: 194 IKPPPVKPPTPTYSPPVKPPPVQKPP 219

 Score =  157 bits (396), Expect = 5e-37
 Identities = 79/146 (54%), Positives = 95/146 (65%), Gaps = 14/146 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKP-PEYTPPIYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKPPVEK 178
           PPV  PPV+ P P Y+PP+  PPV++PP   Y PPV+ PPV KPP     PPV  PPV+K
Sbjct: 41  PPVKPPPVKPPTPIYSPPVMPPPVQQPPTPSYSPPVKPPPVQKPPTPTYSPPVKPPPVQK 100

Query: 179 PPV--YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPP 334
           PP   Y PP++ PPV KPP     PP+  PPV+KPP   Y PPV+ PPV KPP     PP
Sbjct: 101 PPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPP 160

Query: 335 VYKPPVEKP-PVYKPPVEKPPVYKPP 409
           +  PPV+ P P+Y PPV+ PPV KPP
Sbjct: 161 IKPPPVKPPTPIYSPPVKPPPVQKPP 186

 Score =  153 bits (386), Expect = 7e-36
 Identities = 79/144 (54%), Positives = 92/144 (63%), Gaps = 13/144 (9%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKP--PVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPV 187
           PV KPP    P Y+PPI  PPV+KP  P Y PPV+ PPV  P P+  PPV  PPV++PP 
Sbjct: 13  PVQKPPT---PTYSPPIKPPPVQKPPTPTYSPPVKPPPVKPPTPIYSPPVMPPPVQQPPT 69

Query: 188 --YKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYK 343
             Y PPV+ PPV KPP     PPV  PPV+KP  P Y PP++ PPV KPP     PP+  
Sbjct: 70  PSYSPPVKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKP 129

Query: 344 PPVEKP--PVYKPPVEKPPVYKPP 409
           PPV+KP  P Y PPV+ PPV KPP
Sbjct: 130 PPVQKPPTPTYSPPVKPPPVQKPP 153

 Score =  145 bits (365), Expect = 2e-33
 Identities = 77/145 (53%), Positives = 89/145 (61%), Gaps = 14/145 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPE--YTPPIYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKPPVE 175
           PPV  PPV+KPP   Y+PPI  PPV+KPP   Y PP++ PPV KPP     PPV  PPV+
Sbjct: 91  PPVKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQ 150

Query: 176 KPPV--YKPPVEKPPV------YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
           KPP   Y PP++ PPV      Y PPV+ PPV KPP    P Y PP++ PPV KPP    
Sbjct: 151 KPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVQKPPT---PTYSPPIKPPPV-KPPT--- 203

Query: 332 PVYKPPVEKPPVYKPPVEKPPVYKP 406
           P Y PPV+ PPV KPP    P Y P
Sbjct: 204 PTYSPPVKPPPVQKPPT---PTYSP 225

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 46/87 (52%), Positives = 53/87 (60%), Gaps = 3/87 (3%)
 Frame = +2

Query: 5   VEKPPV--YKPPVEKPPEYTP-PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 175
           V+KPP   Y PP++ PP   P PIY PPV+ PPV KPP    P Y PP++ PPV KPP  
Sbjct: 149 VQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVQKPPT---PTYSPPIKPPPV-KPPT- 203

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKP 256
             P Y PPV+ PPV KPP    P Y P
Sbjct: 204 --PTYSPPVKPPPVQKPPT---PTYSP 225

[31][TOP]
>UniRef100_A7PF96 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PF96_VITVI
          Length = 266

 Score =  158 bits (399), Expect = 2e-37
 Identities = 71/133 (53%), Positives = 88/133 (66%), Gaps = 1/133 (0%)
 Frame = +2

Query: 11  KPPVY-KPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           KPP + KPP  KPP   PPI KPP+  PPV  PP+ KPP+  PPV  PP+ KPP+  PP+
Sbjct: 43  KPPSHHKPPKGKPPITRPPIVKPPITVPPVV-PPIVKPPITLPPVV-PPIVKPPITVPPI 100

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
             PP+ KPP+  PP+  PP+ KPP+  PP+  PP+ KPPV  PP+  PP+ KPP+  PPV
Sbjct: 101 TVPPIVKPPITVPPITVPPIVKPPITVPPITVPPIVKPPVTVPPITVPPIIKPPITVPPV 160

Query: 368 YKPPVEKPPVYKP 406
             PPV KPPV  P
Sbjct: 161 VTPPVNKPPVGTP 173

 Score =  157 bits (398), Expect = 3e-37
 Identities = 70/139 (50%), Positives = 90/139 (64%), Gaps = 7/139 (5%)
 Frame = +2

Query: 14  PPVYKPPVE-------KPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PP +KPP         KPP+  PPI +PP+ KPP+  PPV  PP+ KPP+  PPV  PP+
Sbjct: 33  PPQHKPPFHHKPPSHHKPPKGKPPITRPPIVKPPITVPPVV-PPIVKPPITLPPVV-PPI 90

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
            KPP+  PP+  PP+ KPP+  PP+  PP+ KPP+  PP+  PP+ KPPV  PP+  PP+
Sbjct: 91  VKPPITVPPITVPPIVKPPITVPPITVPPIVKPPITVPPITVPPIVKPPVTVPPITVPPI 150

Query: 353 EKPPVYKPPVEKPPVYKPP 409
            KPP+  PPV  PPV KPP
Sbjct: 151 IKPPITVPPVVTPPVNKPP 169

 Score =  139 bits (351), Expect = 8e-32
 Identities = 61/131 (46%), Positives = 80/131 (61%), Gaps = 4/131 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPV 172
           + +PP+ KPP+  PP   PPI KPP+  PPV     KPP+  PP+  PP+ KPP+  PP+
Sbjct: 57  ITRPPIVKPPITVPP-VVPPIVKPPITLPPVVPPIVKPPITVPPITVPPIVKPPITVPPI 115

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
             PP+ KPP+  PP+  PP+ KPPV  PP+  PP+ KPP+  PPV  PPV KPPV  P  
Sbjct: 116 TVPPIVKPPITVPPITVPPIVKPPVTVPPITVPPIIKPPITVPPVVTPPVNKPPVGTPCP 175

Query: 353 EKPPVYKPPVE 385
             P     P++
Sbjct: 176 PPPASATCPID 186

[32][TOP]
>UniRef100_A1YL95 Proline-rich protein n=1 Tax=Gossypium hirsutum RepID=A1YL95_GOSHI
          Length = 258

 Score =  155 bits (393), Expect = 1e-36
 Identities = 76/148 (51%), Positives = 97/148 (65%), Gaps = 15/148 (10%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 175
           KPPVY+PP ++ PE  PP+Y PP +     KPPVY+PP ++ P  KPPV  PP  + P  
Sbjct: 50  KPPVYEPPKKEKPEPKPPVYAPPKKEKPGPKPPVYEPPKKEKPEPKPPVYTPPKKEEPKP 109

Query: 176 KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 325
           KPPVY+PP +     KPP+Y PP +     KPPVY+PP ++ P  KPPV  PP  + P  
Sbjct: 110 KPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEP 169

Query: 326 KPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           KPPVY+PP +KPP+Y+P   KPPVY PP
Sbjct: 170 KPPVYEPP-KKPPMYEPKPPKPPVYTPP 196

 Score =  154 bits (388), Expect = 4e-36
 Identities = 77/153 (50%), Positives = 101/153 (66%), Gaps = 20/153 (13%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE----- 145
           KPPVY+PP ++ PE  PP+Y PP +     KPPVY+PP +     KPP+Y PP +     
Sbjct: 80  KPPVYEPPKKEKPEPKPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEP 139

Query: 146 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 325
           KPPVY+PP ++ P  KPPV  PP  + P  KPPVY+PP +KPP+Y+P   KPPVY PP +
Sbjct: 140 KPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKK 198

Query: 326 K-----PPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           +     PP+Y+PP +KPP+ +P   KPPVY PP
Sbjct: 199 EKPEPIPPMYEPP-KKPPMCEPKPPKPPVYTPP 230

 Score =  117 bits (294), Expect = 3e-25
 Identities = 63/135 (46%), Positives = 87/135 (64%), Gaps = 13/135 (9%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVY 160
           KPP+Y PP ++ PE  PP+Y+PP +     KPPVY PP +     KPPVY+PP +KPP+Y
Sbjct: 125 KPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPVYEPP-KKPPMY 183

Query: 161 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPV 337
           +P   KPPVY PP ++ P    P+  PP+Y+PP +KPP+ +P   KPPVY PP  EK   
Sbjct: 184 EPKPPKPPVYTPPKKEKP---EPI--PPMYEPP-KKPPMCEPKPPKPPVYTPPKKEKSDP 237

Query: 338 YKPPVE--KPPVYKP 376
            +P +   +P +Y+P
Sbjct: 238 SQPCINLPQPTIYEP 252

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 3/76 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPP 184
           +KPP+Y+P   KPP YTPP  + P   PP+Y+PP +KPP+ +P   KPPVY PP  EK  
Sbjct: 178 KKPPMYEPKPPKPPVYTPPKKEKPEPIPPMYEPP-KKPPMCEPKPPKPPVYTPPKKEKSD 236

Query: 185 VYKPPVE--KPPVYKP 226
             +P +   +P +Y+P
Sbjct: 237 PSQPCINLPQPTIYEP 252

[33][TOP]
>UniRef100_Q89392 A57R protein n=1 Tax=Paramecium bursaria Chlorella virus 1
           RepID=Q89392_PBCV1
          Length = 544

 Score =  155 bits (391), Expect = 2e-36
 Identities = 73/133 (54%), Positives = 80/133 (60%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP  KPP  KPP   PP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 39  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 98

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  +PP  +PP  +PP  +PP  
Sbjct: 99  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAP 158

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 159 EPPAPEPPALEPP 171

 Score =  153 bits (387), Expect = 5e-36
 Identities = 71/133 (53%), Positives = 80/133 (60%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP  KPP  KPP   PP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 49  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 108

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           KPP  KPP  KPP  KPP  KPP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 109 KPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPPAPEPPAL 168

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 169 EPPAPEPPAPEPP 181

 Score =  152 bits (385), Expect = 9e-36
 Identities = 72/133 (54%), Positives = 80/133 (60%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP  KPP  KPP   PP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 44  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 103

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 104 KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPPAP 163

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 164 EPPALEPPAPEPP 176

 Score =  151 bits (381), Expect = 3e-35
 Identities = 70/133 (52%), Positives = 80/133 (60%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP  KPP  KPP   PP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 54  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 113

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           KPP  KPP  KPP  KPP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 114 KPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPPAPEPPALEPPAP 173

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 174 EPPAPEPPAPEPP 186

 Score =  140 bits (354), Expect = 3e-32
 Identities = 65/130 (50%), Positives = 76/130 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP  KPP  KPP   PP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 64  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 123

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           KPP  KPP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 124 KPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPPAPEPPALEPPAPEPPAPEPPAP 183

Query: 371 KPPVEKPPVY 400
           +PP  +   Y
Sbjct: 184 EPPAPEQNFY 193

[34][TOP]
>UniRef100_Q7M1Z7 Extensin (Fragment) n=1 Tax=Daucus carota RepID=Q7M1Z7_DAUCA
          Length = 154

 Score =  154 bits (390), Expect = 2e-36
 Identities = 75/125 (60%), Positives = 86/125 (68%), Gaps = 5/125 (4%)
 Frame = +2

Query: 29  PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKP--- 196
           PP+ KPP YTPP++KPP+ KPPVY PPV KPPVY PPV KPP  YKPPVE          
Sbjct: 20  PPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHY 79

Query: 197 PVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           P+ KPPVYKPPV+KP P +KPPV KPP++KPPV    VYK     PP++ PP   PPVY 
Sbjct: 80  PIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVH-TLVYKYKSPPPPMHSPP---PPVYS 135

Query: 374 PPVEK 388
           PP  K
Sbjct: 136 PPPPK 140

 Score =  146 bits (369), Expect = 6e-34
 Identities = 75/135 (55%), Positives = 86/135 (63%), Gaps = 5/135 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYKP---PV 172
           + KPPVY PPV KPP + PP+Y PPV KPPVY PPV KPP  YKPPVE          P+
Sbjct: 22  IHKPPVYTPPVHKPPIHKPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHYPI 81

Query: 173 EKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
            KPPVYKPPV+KP P +KPPV KPP++KPPV    VYK     PP++ PP   PPVY PP
Sbjct: 82  HKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVH-TLVYKYKSPPPPMHSPP---PPVYSPP 137

Query: 350 VEKPPVYKPPVEKPP 394
              PP +      PP
Sbjct: 138 ---PPKHHYSYTSPP 149

 Score =  146 bits (368), Expect = 8e-34
 Identities = 72/122 (59%), Positives = 84/122 (68%), Gaps = 10/122 (8%)
 Frame = +2

Query: 74  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKP-------- 226
           PP+ KPPVY PPV KPP++KPPV  PPV+KPPV  PPV+KPP E KPPV           
Sbjct: 20  PPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHY 79

Query: 227 PVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
           P+ KPPVYKPPV+KP P +KPPV KPP++KPPV    VYK     PP++ PP   PPVY 
Sbjct: 80  PIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVH-TLVYKYKSPPPPMHSPP---PPVYS 135

Query: 404 PP 409
           PP
Sbjct: 136 PP 137

[35][TOP]
>UniRef100_Q9FEW3 Putative repetitive proline-rich protein n=1 Tax=Medicago
           truncatula RepID=Q9FEW3_MEDTR
          Length = 174

 Score =  146 bits (368), Expect = 8e-34
 Identities = 68/134 (50%), Positives = 88/134 (65%), Gaps = 3/134 (2%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           P+Y  P+ K P  TP +Y PP+ KPP  YKPP++K P+ K P +KP + KPP+ KPP  +
Sbjct: 37  PIYTTPIHKNPTNTP-VYNPPIYKPPPTYKPPIKKQPINKSPNKKPLLLKPPLPKPPHKE 95

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP  K P+  PP +KPP+ KPP  KPP  KPP  K P+  PP +KPP+ KPPV KPP  K
Sbjct: 96  PPSRKRPINTPPDKKPPLLKPPFPKPPQKKPPSRKRPINTPPNKKPPLPKPPVNKPPHKK 155

Query: 374 PPVEKPPVY--KPP 409
           P  ++PP Y  +PP
Sbjct: 156 PSNKRPPPYGNQPP 169

 Score =  121 bits (303), Expect = 3e-26
 Identities = 58/114 (50%), Positives = 73/114 (64%), Gaps = 2/114 (1%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP YKPP++K      PI K P +KP + KPP+ KPP  +PP  K P+  PP +KPP+ K
Sbjct: 61  PPTYKPPIKK-----QPINKSPNKKPLLLKPPLPKPPHKEPPSRKRPINTPPDKKPPLLK 115

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPP 349
           PP  KPP  KPP  K P+  PP +KPP+ KPPV KPP  KP  ++PP Y  +PP
Sbjct: 116 PPFPKPPQKKPPSRKRPINTPPNKKPPLPKPPVNKPPHKKPSNKRPPPYGNQPP 169

 Score =  116 bits (291), Expect = 7e-25
 Identities = 53/105 (50%), Positives = 67/105 (63%), Gaps = 2/105 (1%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP+ K P+ K P   P + KPP+ KPP  +PP  K P+  PP +KPP+ KPP  KPP  
Sbjct: 65  KPPIKKQPINKSPNKKPLLLKPPLPKPPHKEPPSRKRPINTPPDKKPPLLKPPFPKPPQK 124

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPP 319
           KPP  K P+  PP +KPP+ KPPV KPP  KP  ++PP Y  +PP
Sbjct: 125 KPPSRKRPINTPPNKKPPLPKPPVNKPPHKKPSNKRPPPYGNQPP 169

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 44/84 (52%), Positives = 54/84 (64%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           +KP + KPP+ KPP   PP  K P+  PP  KPP+ KPP  KPP +KPP  K P+  PP 
Sbjct: 79  KKPLLLKPPLPKPPHKEPPSRKRPINTPPDKKPPLLKPPFPKPPQKKPPSRKRPINTPPN 138

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPP 259
            KPP+ KPPV KPP +KP   +PP
Sbjct: 139 KKPPLPKPPVNKPPHKKPSNKRPP 162

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 38/76 (50%), Positives = 49/76 (64%), Gaps = 2/76 (2%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           ++PP  K P+  PP+  PP+ KPP  KPP  KPP  K P+  PP +KPP+ KPPV KPP 
Sbjct: 94  KEPPSRKRPINTPPDKKPPLLKPPFPKPPQKKPPSRKRPINTPPNKKPPLPKPPVNKPPH 153

Query: 188 YKPPVEKPPVY--KPP 229
            KP  ++PP Y  +PP
Sbjct: 154 KKPSNKRPPPYGNQPP 169

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 34/67 (50%), Positives = 42/67 (62%), Gaps = 2/67 (2%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           +  PP  KPP+ KPP   PP  KPP  K P+  PP +KPP+ KPPV KPP  KP  ++PP
Sbjct: 103 INTPPDKKPPLLKPPFPKPPQKKPPSRKRPINTPPNKKPPLPKPPVNKPPHKKPSNKRPP 162

Query: 185 VY--KPP 199
            Y  +PP
Sbjct: 163 PYGNQPP 169

[36][TOP]
>UniRef100_O49870 Extensin (Fragment) n=1 Tax=Hordeum vulgare RepID=O49870_HORVU
          Length = 330

 Score =  145 bits (367), Expect = 1e-33
 Identities = 69/147 (46%), Positives = 76/147 (51%), Gaps = 15/147 (10%)
 Frame = +2

Query: 14  PPVYKP------PVEKP-PEYTPPIYKP--------PVEKPPVYKPPVEKPPVYKPPVEK 148
           PP YKP      P  KP P+ +PP YKP        P   PP YKPP   PP  KPP   
Sbjct: 174 PPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPT 233

Query: 149 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
           PP YKPP   PP +KPP   PP +KP    PP +KPP   PP +KP    P  YKPP   
Sbjct: 234 PPAYKPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPPTPTPPAHKPTTPTP-AYKPPTPT 292

Query: 329 PPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PP  KPP   P  +KPP   PP YK P
Sbjct: 293 PPADKPPTPTPLAHKPPTPTPPAYKAP 319

 Score =  145 bits (365), Expect = 2e-33
 Identities = 66/131 (50%), Positives = 72/131 (54%), Gaps = 4/131 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKP----PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           PP YKP V KP    P+ TPP YKPP   PP  KPP   PP YKPP   PP +KPP   P
Sbjct: 196 PPAYKP-VPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTP 254

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           P +KP    PP +KPP   PP +K P    P YKPP   PP  KPP   P  +KPP   P
Sbjct: 255 PAHKPATPTPPAHKPPTPTPPAHK-PTTPTPAYKPPTPTPPADKPPTPTPLAHKPPTPTP 313

Query: 362 PVYKPPVEKPP 394
           P YK P   PP
Sbjct: 314 PAYKAPTPSPP 324

 Score =  143 bits (360), Expect = 7e-33
 Identities = 75/159 (47%), Positives = 80/159 (50%), Gaps = 27/159 (16%)
 Frame = +2

Query: 14  PPVYKP------PVEKP-PEYTPPIYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYK 163
           PP YKP      P  KP P+ +PP YKP P   PP YKP P   PP YKP P   PP YK
Sbjct: 141 PPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYK 200

Query: 164 P--------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 319
           P        P   PP YKPP   PP  KPP   PP YKPP   PP +KPP   PP +KP 
Sbjct: 201 PVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKPA 260

Query: 320 VEKPPVYKPPVEKP---------PVYKPPVEKPPVYKPP 409
              PP +KPP   P         P YKPP   PP  KPP
Sbjct: 261 TPTPPAHKPPTPTPPAHKPTTPTPAYKPPTPTPPADKPP 299

 Score =  133 bits (335), Expect = 5e-30
 Identities = 80/165 (48%), Positives = 83/165 (50%), Gaps = 30/165 (18%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKP-PEYTPPIYKPPVE---KPPVYKP-PVEKPPVYKP-PVEKPPVYKP 166
           + KPP   PP   P P+  PP YKPP +    PP YKP P   PP YKP P   PP YKP
Sbjct: 76  IPKPPKPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKP 135

Query: 167 -PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP----- 316
            P   PP YKP P   PP YKP P   PP YKP P   PP YKP P   PP YKP     
Sbjct: 136 APKVSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVS 195

Query: 317 -----PVEK---------PPVYKPPVEKPPVYKPPVEKPPVYKPP 409
                PV K         PP YKPP   PP  KPP   PP YKPP
Sbjct: 196 PPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPP 240

 Score =  127 bits (319), Expect = 4e-28
 Identities = 75/145 (51%), Positives = 78/145 (53%), Gaps = 12/145 (8%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKP-PVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVE-- 175
           + PP Y PP  KP   TPP  KP P    P+ KPP   PP Y P P   PP YKPP +  
Sbjct: 49  QAPPTYSPPTAKP---TPPAPKPAPPTYAPIPKPPKPSPPAYHPTPKPAPPTYKPPTQPK 105

Query: 176 -KPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPV 337
             PP YKP P   PP YKP P   PP YKP P   PP YKP P   PP YKP P   PP 
Sbjct: 106 PSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPSPKVSPPA 165

Query: 338 YKP-PVEKPPVYKP-PVEKPPVYKP 406
           YKP P   PP YKP P   PP YKP
Sbjct: 166 YKPAPKVSPPAYKPAPKVSPPAYKP 190

 Score =  127 bits (319), Expect = 4e-28
 Identities = 54/108 (50%), Positives = 60/108 (55%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP   PP +KPP  TPP YKPP   PP +KPP   PP +KP    PP +KPP   PP +
Sbjct: 218 KPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPPTPTPPAH 277

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
           K P    P YKPP   PP  KPP   P  +KPP   PP YK P   PP
Sbjct: 278 K-PTTPTPAYKPPTPTPPADKPPTPTPLAHKPPTPTPPAYKAPTPSPP 324

 Score =  115 bits (287), Expect = 2e-24
 Identities = 72/148 (48%), Positives = 78/148 (52%), Gaps = 22/148 (14%)
 Frame = +2

Query: 29  PPVEKPPE-YTPPIY----KPPV--EKPPVYKPPVEKPPVYKPPVEKP------PVYKPP 169
           P  EKPP+ + PP +    KPPV  + PP Y PP  KP    PP  KP      P+ KPP
Sbjct: 24  PKHEKPPKGHKPPHHHHHAKPPVGSQAPPTYSPPTAKPT---PPAPKPAPPTYAPIPKPP 80

Query: 170 VEKPPVYKP-PVEKPPVYKPPVE---KPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEK 328
              PP Y P P   PP YKPP +    PP YKP P   PP YKP P   PP YKP P   
Sbjct: 81  KPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVS 140

Query: 329 PPVYKP-PVEKPPVYKP-PVEKPPVYKP 406
           PP YKP P   PP YKP P   PP YKP
Sbjct: 141 PPAYKPAPKVSPPAYKPSPKVSPPAYKP 168

 Score =  112 bits (279), Expect = 2e-23
 Identities = 48/99 (48%), Positives = 54/99 (54%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           +KPP   PP  KPP  TPP +KPP   PP +KP    PP +KPP   PP +K P    P 
Sbjct: 227 QKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPPTPTPPAHK-PTTPTPA 285

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 304
           YKPP   PP  KPP   P  +KPP   PP YK P   PP
Sbjct: 286 YKPPTPTPPADKPPTPTPLAHKPPTPTPPAYKAPTPSPP 324

 Score =  107 bits (268), Expect = 3e-22
 Identities = 69/147 (46%), Positives = 73/147 (49%), Gaps = 21/147 (14%)
 Frame = +2

Query: 29  PPVEKPPEYTPPIYKPPV-EKPPVY----KPPV--EKPPVYKPPVEKPPVYKPPVEKP-- 181
           PP   P    P   KPP   KPP +    KPPV  + PP Y PP  KP    PP  KP  
Sbjct: 14  PPSPTPISPAPKHEKPPKGHKPPHHHHHAKPPVGSQAPPTYSPPTAKPT---PPAPKPAP 70

Query: 182 ----PVYKPPVEKPPVYKP-PVEKPPVYKPPVE---KPPVYKP-PVEKPPVYKP-PVEKP 331
               P+ KPP   PP Y P P   PP YKPP +    PP YKP P   PP YKP P   P
Sbjct: 71  PTYAPIPKPPKPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSP 130

Query: 332 PVYKP-PVEKPPVYKP-PVEKPPVYKP 406
           P YKP P   PP YKP P   PP YKP
Sbjct: 131 PAYKPAPKVSPPAYKPAPKVSPPAYKP 157

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 40/104 (38%), Positives = 42/104 (40%), Gaps = 2/104 (1%)
 Frame = +2

Query: 104 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPPV 277
           PP   P    P  EKPP    P       KPPV  + PP Y PP  KP    PP  KP  
Sbjct: 14  PPSPTPISPAPKHEKPPKGHKPPHHHHHAKPPVGSQAPPTYSPPTAKPT---PPAPKPA- 69

Query: 278 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
              P    P+ KPP   PP Y P     P   PP  KPP    P
Sbjct: 70  ---PPTYAPIPKPPKPSPPAYHPT----PKPAPPTYKPPTQPKP 106

[37][TOP]
>UniRef100_Q94G50 Proline-rich protein-2 n=1 Tax=Gossypium hirsutum
           RepID=Q94G50_GOSHI
          Length = 310

 Score =  144 bits (363), Expect = 3e-33
 Identities = 80/163 (49%), Positives = 104/163 (63%), Gaps = 30/163 (18%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE----- 145
           KP VY PP ++ PE  P +Y+PP +     KPPVY PP +     KPP+Y+PP +     
Sbjct: 124 KPSVYTPPKKEKPEPKPLVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPMYEPPKKEKLEP 183

Query: 146 KPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVY-----KPPVEKPPVYKPPVE 295
           KP VY PP +     KPPVY+PP +KPPVY+P   KPPVY     + P  KPP+Y+PP  
Sbjct: 184 KPLVYAPPKKEKPEPKPPVYEPP-KKPPVYEPKPPKPPVYASPKKEKPEPKPPMYEPP-N 241

Query: 296 KPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPP 409
           KPP+Y+P  +K PVY PP +     KPP+Y+PP +KPPV+KPP
Sbjct: 242 KPPMYEPKPQKSPVYVPPKKEKPEPKPPMYEPP-KKPPVHKPP 283

 Score =  139 bits (350), Expect = 1e-31
 Identities = 72/148 (48%), Positives = 92/148 (62%), Gaps = 15/148 (10%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 175
           KPPVY+PP ++ PE   P+Y PP +     KPPVY+PP ++ P  KP V  PP  + P  
Sbjct: 79  KPPVYEPPKKEKPEPKSPVYTPPKKERPEPKPPVYEPPKKEKPKPKPSVYTPPKKEKPEP 138

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE----- 325
           KP VY+PP ++ P  KPPV  PP  + P  KPP+Y+PP +     KP VY PP +     
Sbjct: 139 KPLVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPMYEPPKKEKLEPKPLVYAPPKKEKPEP 198

Query: 326 KPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           KPPVY+PP +KPPVY+P   KPPVY  P
Sbjct: 199 KPPVYEPP-KKPPVYEPKPPKPPVYASP 225

 Score =  135 bits (341), Expect = 1e-30
 Identities = 68/143 (47%), Positives = 87/143 (60%), Gaps = 12/143 (8%)
 Frame = +2

Query: 17  PVYKPPVEKPP--EYTPPIYKPPVEKPPVYKPPV----------EKPPVYKPPVEKPPVY 160
           PVYKPP  KPP  E+ PP+Y+PP ++ P  KPPV           KPPVY+PP ++ P  
Sbjct: 34  PVYKPPKVKPPPYEHKPPVYEPPKKEKPEPKPPVYTSPKKDKPEPKPPVYEPPKKEKPEP 93

Query: 161 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
           K PV  PP  + P  KPPVY+PP ++ P  KP V  PP  + P  KP VY+PP ++ P  
Sbjct: 94  KSPVYTPPKKERPEPKPPVYEPPKKEKPKPKPSVYTPPKKEKPEPKPLVYEPPKKEKPEP 153

Query: 341 KPPVEKPPVYKPPVEKPPVYKPP 409
           KPPV  PP  + P  KPP+Y+PP
Sbjct: 154 KPPVYTPPKKEKPEPKPPMYEPP 176

 Score =  134 bits (337), Expect = 3e-30
 Identities = 80/168 (47%), Positives = 101/168 (60%), Gaps = 35/168 (20%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKP-----PVEKPPVYKPPVE-----KPPVYKPPVE----- 145
           K PVY PP ++ PE  PP+Y+P     P  KP VY PP +     KP VY+PP +     
Sbjct: 94  KSPVYTPPKKERPEPKPPVYEPPKKEKPKPKPSVYTPPKKEKPEPKPLVYEPPKKEKPEP 153

Query: 146 KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVY 280
           KPPVY PP +     KPP+Y+PP +     KP VY PP +     KPPVY+PP +KPPVY
Sbjct: 154 KPPVYTPPKKEKPEPKPPMYEPPKKEKLEPKPLVYAPPKKEKPEPKPPVYEPP-KKPPVY 212

Query: 281 KPPVEKPPVY-----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           +P   KPPVY     + P  KPP+Y+PP  KPP+Y+P  +K PVY PP
Sbjct: 213 EPKPPKPPVYASPKKEKPEPKPPMYEPP-NKPPMYEPKPQKSPVYVPP 259

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 47/99 (47%), Positives = 64/99 (64%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           ++ P  KPPV +PP+  PP+Y+P   KPPVY  P ++ P  KPP+ +PP       KPP+
Sbjct: 193 KEKPEPKPPVYEPPK-KPPVYEPKPPKPPVYASPKKEKPEPKPPMYEPP------NKPPM 245

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 304
           Y+P  +K PVY PP ++ P  KPP+ +PP  KPPV KPP
Sbjct: 246 YEPKPQKSPVYVPPKKEKPEPKPPMYEPP-KKPPVHKPP 283

[38][TOP]
>UniRef100_Q25434 Adhesive plaque matrix protein n=1 Tax=Mytilus coruscus
           RepID=FP1_MYTCO
          Length = 872

 Score =  144 bits (362), Expect = 4e-33
 Identities = 64/139 (46%), Positives = 71/139 (51%), Gaps = 5/139 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP    PP Y P     P YKP +  PP YKP    PP YKP    PP YKP
Sbjct: 355 KITYPPTYKPKPSYPPSYKPKKTYSPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKP 414

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
            +  PP YKP       YK     PP YKP +  PP YKP    PP YKP +  PP YKP
Sbjct: 415 KISYPPTYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKITYPPTYKP 474

Query: 347 PVEKPPVYKPPVEKPPVYK 403
               PP YKP +  PP YK
Sbjct: 475 KPSYPPTYKPKITYPPTYK 493

 Score =  141 bits (355), Expect = 3e-32
 Identities = 70/176 (39%), Positives = 77/176 (43%), Gaps = 45/176 (25%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP---------------PIYKPPVEKPPVYKPPVEKPPVYKPPVEK 148
           PP YKP +  PP Y P               P YKP +  PP YKP    PP YKP +  
Sbjct: 409 PPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKITY 468

Query: 149 PPVYKPPVEKPPVYKPPVEKPPVYK---------------PPVEK--------------- 238
           PP YKP    PP YKP +  PP YK               PP+ K               
Sbjct: 469 PPTYKPKPSYPPTYKPKITYPPTYKRKPSYPTPYKQKPSYPPIYKSKSSYPTSYKSKKTY 528

Query: 239 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           PP YKP +  PP YKP    PP YKP    PP YKP +  PP YKP    PP YKP
Sbjct: 529 PPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRYPPTYKPKASYPPTYKP 584

 Score =  141 bits (355), Expect = 3e-32
 Identities = 68/156 (43%), Positives = 75/156 (48%), Gaps = 25/156 (16%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P     P YKP +  PP YKP    PP YKP +  PP YK     
Sbjct: 439 PPTYKPKISYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKPKITYPPTYKRKPSY 498

Query: 179 PPVYK-----PPVEK---------------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 298
           P  YK     PP+ K               PP YKP +  PP YKP    PP YKP    
Sbjct: 499 PTPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKTTY 558

Query: 299 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           PP YKP +  PP YKP    PP YKP +  PP YKP
Sbjct: 559 PPTYKPKIRYPPTYKPKASYPPTYKPKITYPPTYKP 594

 Score =  140 bits (352), Expect = 6e-32
 Identities = 70/166 (42%), Positives = 76/166 (45%), Gaps = 35/166 (21%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---- 166
           PP YKP +  PP Y P     P YKP V  PP YKP    PP YKP +  PP YKP    
Sbjct: 259 PPTYKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKPKPSYPPTYKPKITYPPTYKPKPSY 318

Query: 167 -----------PVEK---------------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 268
                      P+ K               PP YKP +  PP YKP    PP YKP    
Sbjct: 319 PTPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKKTY 378

Query: 269 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
            P YKP +  PP YKP    PP YKP    PP YKP +  PP YKP
Sbjct: 379 SPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKP 424

 Score =  139 bits (350), Expect = 1e-31
 Identities = 65/146 (44%), Positives = 71/146 (48%), Gaps = 15/146 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP+YK     P  Y      PP YKP +  PP YKP    PP YKP     P YKP +  
Sbjct: 329 PPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKKTYSPTYKPKITY 388

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE----------KPPVYKPPVEK 328
           PP YKP    PP YKP    PP YKP +  PP YKP              PP YKP +  
Sbjct: 389 PPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISY 448

Query: 329 PPVYKPPVEKPPVYKPPVEKPPVYKP 406
           PP YKP    PP YKP +  PP YKP
Sbjct: 449 PPTYKPKPSYPPTYKPKITYPPTYKP 474

 Score =  139 bits (349), Expect = 1e-31
 Identities = 62/136 (45%), Positives = 69/136 (50%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P     P YKP    PP YKP +  PP YKP    PP YKP +  
Sbjct: 529 PPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRYPPTYKPKASYPPTYKPKITY 588

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP    P  YK     PP+YK     P  YK     PP YKP +  PP YKP    
Sbjct: 589 PPTYKPKPSYPTPYKQKPSYPPIYKSKSSYPTAYKSKKTYPPTYKPKITYPPTYKPKPSY 648

Query: 359 PPVYKPPVEKPPVYKP 406
           PP Y+P +  PP YKP
Sbjct: 649 PPSYRPKITYPPTYKP 664

 Score =  136 bits (343), Expect = 6e-31
 Identities = 70/176 (39%), Positives = 76/176 (43%), Gaps = 45/176 (25%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEK---------------PPVYKPPVEKPPVYKPPVEK 148
           PP YKP    PP Y P I  PP  K               PP YKP +  PP YKP    
Sbjct: 399 PPSYKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSY 458

Query: 149 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---------------PPVEK----- 268
           PP YKP +  PP YKP    PP YKP +  PP YK               PP+ K     
Sbjct: 459 PPTYKPKITYPPTYKPKPSYPPTYKPKITYPPTYKRKPSYPTPYKQKPSYPPIYKSKSSY 518

Query: 269 ----------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
                     PP YKP +  PP YKP    PP YKP    PP YKP +  PP YKP
Sbjct: 519 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRYPPTYKP 574

 Score =  136 bits (342), Expect = 8e-31
 Identities = 70/180 (38%), Positives = 78/180 (43%), Gaps = 45/180 (25%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVE----------KPPVYKP 136
           ++  PP YKP    PP Y P     P YKP +  PP YKP              PP YKP
Sbjct: 385 KITYPPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKP 444

Query: 137 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----------- 283
            +  PP YKP    PP YKP +  PP YKP    PP YKP +  PP YK           
Sbjct: 445 KISYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKPKITYPPTYKRKPSYPTPYKQ 504

Query: 284 ----PPVEK---------------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
               PP+ K               PP YKP +  PP YKP    PP YKP    PP YKP
Sbjct: 505 KPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKP 564

 Score =  135 bits (339), Expect = 2e-30
 Identities = 65/146 (44%), Positives = 69/146 (47%), Gaps = 15/146 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           P  YK     PP Y P     P YKP    PP YKP     P YKP +  PP YKP    
Sbjct: 339 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKKTYSPTYKPKITYPPTYKPKPSY 398

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVE----------KPPVYKPPVEKPPVYKPPVEK 328
           PP YKP    PP YKP +  PP YKP              PP YKP +  PP YKP    
Sbjct: 399 PPSYKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSY 458

Query: 329 PPVYKPPVEKPPVYKPPVEKPPVYKP 406
           PP YKP +  PP YKP    PP YKP
Sbjct: 459 PPTYKPKITYPPTYKPKPSYPPTYKP 484

 Score =  133 bits (335), Expect = 5e-30
 Identities = 69/175 (39%), Positives = 76/175 (43%), Gaps = 45/175 (25%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVE----------KP 151
           P YKP +  PP Y P     P YKP    PP YKP +  PP YKP              P
Sbjct: 380 PTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYP 439

Query: 152 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK------ 313
           P YKP +  PP YKP    PP YKP +  PP YKP    PP YKP +  PP YK      
Sbjct: 440 PTYKPKISYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKPKITYPPTYKRKPSYP 499

Query: 314 ---------PPVEK---------------PPVYKPPVEKPPVYKPPVEKPPVYKP 406
                    PP+ K               PP YKP +  PP YKP    PP YKP
Sbjct: 500 TPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKP 554

 Score =  132 bits (333), Expect = 9e-30
 Identities = 68/166 (40%), Positives = 74/166 (44%), Gaps = 35/166 (21%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP---------------PIYKPPVEKPPVYKPPVEKPPVYKPPVEK 148
           PP YKP +  P  Y P               P YKP +  PP YKP    PP YKP V  
Sbjct: 229 PPTYKPKISYPSIYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKVTY 288

Query: 149 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK--------------- 268
           PP YKP    PP YKP +  PP YKP    P  YK     PP+ K               
Sbjct: 289 PPTYKPKPSYPPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSYPTSYKSKKTY 348

Query: 269 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           PP YKP +  PP YKP    PP YKP     P YKP +  PP YKP
Sbjct: 349 PPTYKPKITYPPTYKPKPSYPPSYKPKKTYSPTYKPKITYPPTYKP 394

 Score =  132 bits (333), Expect = 9e-30
 Identities = 60/139 (43%), Positives = 68/139 (48%), Gaps = 5/139 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP    PP Y P     P YKP +  PP YKP    PP YKP +  PP YKP
Sbjct: 535 KITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRYPPTYKPKASYPPTYKPKITYPPTYKP 594

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
               P  YK     PP+YK     P  YK     PP YKP +  PP YKP    PP Y+P
Sbjct: 595 KPSYPTPYKQKPSYPPIYKSKSSYPTAYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYRP 654

Query: 347 PVEKPPVYKPPVEKPPVYK 403
            +  PP YKP    P  YK
Sbjct: 655 KITYPPTYKPKKSYPQAYK 673

 Score =  132 bits (332), Expect = 1e-29
 Identities = 70/176 (39%), Positives = 76/176 (43%), Gaps = 45/176 (25%)
 Frame = +2

Query: 14  PPVYKP-----PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE- 175
           PP YKP     P  KP    PP YKP    PP YKP    PP YKP +  PP YKP    
Sbjct: 369 PPSYKPKKTYSPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKPKASY 428

Query: 176 ---------KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
                     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YKP +  
Sbjct: 429 VSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKPKITY 488

Query: 329 PPVYK---------------PPVEK---------------PPVYKPPVEKPPVYKP 406
           PP YK               PP+ K               PP YKP +  PP YKP
Sbjct: 489 PPTYKRKPSYPTPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKP 544

 Score =  131 bits (329), Expect = 3e-29
 Identities = 69/175 (39%), Positives = 76/175 (43%), Gaps = 44/175 (25%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT--------------PPIYKPPVEKPPVYKPPVEK----------P 121
           PP YKP +  PP Y               PP YKP +  P +YKP              P
Sbjct: 200 PPTYKPKITYPPTYKRKPSYTPYKPKTTYPPTYKPKISYPSIYKPKASYVSSYKSKKTYP 259

Query: 122 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 301
           P YKP +  PP YKP    PP YKP V  PP YKP    PP YKP +  PP YKP    P
Sbjct: 260 PTYKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYP 319

Query: 302 PVYK-----PPVEK---------------PPVYKPPVEKPPVYKPPVEKPPVYKP 406
             YK     PP+ K               PP YKP +  PP YKP    PP YKP
Sbjct: 320 TPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKP 374

 Score =  131 bits (329), Expect = 3e-29
 Identities = 59/136 (43%), Positives = 67/136 (49%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
            PP YKP +  P  Y      PP YKP       YKP +  PP YKP       YKP +  
Sbjct: 729  PPTYKPKISYPSTYKAKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRY 788

Query: 179  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
            PP YKP       YKP +  PP YKP       YKP +  PP YKP +  PP YKP +  
Sbjct: 789  PPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITY 848

Query: 359  PPVYKPPVEKPPVYKP 406
            PP YKP +  PP YKP
Sbjct: 849  PPTYKPKISYPPAYKP 864

 Score =  128 bits (321), Expect = 2e-28
 Identities = 60/134 (44%), Positives = 68/134 (50%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           ++  PP YK    + P YTP  YKP    PP YKP +  P +YKP       YK     P
Sbjct: 206 KITYPPTYK----RKPSYTP--YKPKTTYPPTYKPKISYPSIYKPKASYVSSYKSKKTYP 259

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           P YKP +  PP YKP    PP YKP V  PP YKP    PP YKP +  PP YKP    P
Sbjct: 260 PTYKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYP 319

Query: 362 PVYKPPVEKPPVYK 403
             YK     PP+YK
Sbjct: 320 TPYKQKPSYPPIYK 333

 Score =  128 bits (321), Expect = 2e-28
 Identities = 68/166 (40%), Positives = 75/166 (45%), Gaps = 35/166 (21%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-PIYKPPVEK----PPVYK---------------PPVEKP---- 121
           PP YKP +  PP Y P P Y  P ++    PP+YK               PP  KP    
Sbjct: 299 PPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITY 358

Query: 122 -PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 298
            P YKP    PP YKP     P YKP +  PP YKP    PP YKP    PP YKP +  
Sbjct: 359 PPTYKPKPSYPPSYKPKKTYSPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKISY 418

Query: 299 PPVYKPPVE----------KPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           PP YKP              PP YKP +  PP YKP    PP YKP
Sbjct: 419 PPTYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKP 464

 Score =  127 bits (320), Expect = 3e-28
 Identities = 67/164 (40%), Positives = 73/164 (44%), Gaps = 33/164 (20%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPV------- 157
           PP YK  +  PP Y P I  PP  K     PP YKP    PP YKP +  PP        
Sbjct: 131 PPSYKHKITYPPTYKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKPKITYPPTYKRKPSY 190

Query: 158 --YKPPVEKPPVYKPPVEKPPV---------YKPPVEKPPVYKPPVEKPPVYKPPVE--- 295
             YKP    PP YKP +  PP          YKP    PP YKP +  P +YKP      
Sbjct: 191 TPYKPKATYPPTYKPKITYPPTYKRKPSYTPYKPKTTYPPTYKPKISYPSIYKPKASYVS 250

Query: 296 -------KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
                   PP YKP +  PP YKP    PP YKP V  PP YKP
Sbjct: 251 SYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKP 294

 Score =  127 bits (320), Expect = 3e-28
 Identities = 69/178 (38%), Positives = 78/178 (43%), Gaps = 43/178 (24%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYK---------PP 139
           ++  PP YKP +  PP Y      PP YKP    PP YKP +  PP YK         P 
Sbjct: 137 KITYPPTYKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKPKITYPPTYKRKPSYTPYKPK 196

Query: 140 VEKPPVYKPPVEKPPVYK---------PPVEKPPVYKPPVEKPPVYKPPVEK-------- 268
              PP YKP +  PP YK         P    PP YKP +  P +YKP            
Sbjct: 197 ATYPPTYKPKITYPPTYKRKPSYTPYKPKTTYPPTYKPKISYPSIYKPKASYVSSYKSKK 256

Query: 269 --PPVYKPPVEKPPVYKP-----PVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKP 406
             PP YKP +  PP YKP     P  KP     P YKP    PP YKP +  PP YKP
Sbjct: 257 TYPPTYKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKPKPSYPPTYKPKITYPPTYKP 314

 Score =  127 bits (320), Expect = 3e-28
 Identities = 64/155 (41%), Positives = 72/155 (46%), Gaps = 25/155 (16%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----- 148
            PP YKP +  PP Y P     P YKP +  PP YKP    P  YK     PP+ K     
Sbjct: 559  PPTYKPKIRYPPTYKPKASYPPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSY 618

Query: 149  ----------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 298
                      PP YKP +  PP YKP    PP Y+P +  PP YKP    P  YK     
Sbjct: 619  PTAYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSYPQAYKSKGSY 678

Query: 299  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
            PP Y+P    PP YKP    PP YKP +  PP YK
Sbjct: 679  PPSYQPKKTYPPSYKPKKTYPPTYKPKISYPPTYK 713

 Score =  127 bits (318), Expect = 5e-28
 Identities = 65/156 (41%), Positives = 71/156 (45%), Gaps = 25/156 (16%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 163
            PP YKP    PP Y P     P YKP    PP YKP +  PP YKP    P  YK     
Sbjct: 549  PPSYKPKTTYPPTYKPKIRYPPTYKPKASYPPTYKPKITYPPTYKPKPSYPTPYKQKPSY 608

Query: 164  PPVEK---------------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 298
            PP+ K               PP YKP +  PP YKP    PP Y+P +  PP YKP    
Sbjct: 609  PPIYKSKSSYPTAYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSY 668

Query: 299  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
            P  YK     PP Y+P    PP YKP    PP YKP
Sbjct: 669  PQAYKSKGSYPPSYQPKKTYPPSYKPKKTYPPTYKP 704

 Score =  124 bits (311), Expect = 3e-27
 Identities = 56/138 (40%), Positives = 66/138 (47%), Gaps = 5/138 (3%)
 Frame = +2

Query: 2    RVEKPPVYKPPVEKPPEYTPP-----IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
            ++  P  YK     PP Y P       YKP +  PP YKP       YKP +  PP YKP
Sbjct: 735  KISYPSTYKAKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKP 794

Query: 167  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
                   YKP +  PP YKP       YKP +  PP YKP +  PP YKP +  PP YKP
Sbjct: 795  KPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPTYKP 854

Query: 347  PVEKPPVYKPPVEKPPVY 400
             +  PP YKP +  P  Y
Sbjct: 855  KISYPPAYKPKISYPSQY 872

 Score =  122 bits (307), Expect = 1e-26
 Identities = 68/183 (37%), Positives = 72/183 (39%), Gaps = 53/183 (28%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           P YK     PP Y      PP YKP +  PP YK     PP YKP    PP YKP +  P
Sbjct: 122 PAYKAKTSYPPSYKHKITYPPTYKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKPKITYP 181

Query: 182 PVYK---------PPVEKPPVYKPPVEKPPVYK--------------PPVEKP------- 271
           P YK         P    PP YKP +  PP YK              PP  KP       
Sbjct: 182 PTYKRKPSYTPYKPKATYPPTYKPKITYPPTYKRKPSYTPYKPKTTYPPTYKPKISYPSI 241

Query: 272 ------------------PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 397
                             P YKP +  PP YKP    PP YKP V  PP YKP    PP 
Sbjct: 242 YKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKPKPSYPPT 301

Query: 398 YKP 406
           YKP
Sbjct: 302 YKP 304

 Score =  121 bits (304), Expect = 2e-26
 Identities = 61/145 (42%), Positives = 69/145 (47%), Gaps = 14/145 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-----TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP+YKP  +K   Y     T P YK     PP YK  +  PP YKP +  PP YK     
Sbjct: 101 PPIYKPIAKKLSSYKAIKTTYPAYKAKTSYPPSYKHKITYPPTYKPKITYPPTYKQKPSY 160

Query: 179 PPVYKPPVEKPPVYKPPVEKPPV---------YKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
           PP YKP    PP YKP +  PP          YKP    PP YKP +  PP YK      
Sbjct: 161 PPSYKPKTTYPPTYKPKITYPPTYKRKPSYTPYKPKATYPPTYKPKITYPPTYKRKPSYT 220

Query: 332 PVYKPPVEKPPVYKPPVEKPPVYKP 406
           P YKP    PP YKP +  P +YKP
Sbjct: 221 P-YKPKTTYPPTYKPKISYPSIYKP 244

 Score =  121 bits (303), Expect = 3e-26
 Identities = 59/140 (42%), Positives = 68/140 (48%), Gaps = 6/140 (4%)
 Frame = +2

Query: 2    RVEKPPVYKP------PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 163
            ++  PP YKP      P ++ P Y PPIYK     P  YK     PP YKP +  PP YK
Sbjct: 585  KITYPPTYKPKPSYPTPYKQKPSY-PPIYKSKSSYPTAYKSKKTYPPTYKPKITYPPTYK 643

Query: 164  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 343
            P    PP Y+P +  PP YKP    P  YK     PP Y+P    PP YKP    PP YK
Sbjct: 644  PKPSYPPSYRPKITYPPTYKPKKSYPQAYKSKGSYPPSYQPKKTYPPSYKPKKTYPPTYK 703

Query: 344  PPVEKPPVYKPPVEKPPVYK 403
            P +  PP YK     P  YK
Sbjct: 704  PKISYPPTYKTKPSYPASYK 723

 Score =  121 bits (303), Expect = 3e-26
 Identities = 61/146 (41%), Positives = 68/146 (46%), Gaps = 15/146 (10%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
            PP YKP +  PP Y P     P Y+P +  PP YKP    P  YK     PP Y+P    
Sbjct: 629  PPTYKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSYPQAYKSKGSYPPSYQPKKTY 688

Query: 179  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 343
            PP YKP    PP YKP +  PP YK     P  YK     PP YKP +  P  YK     
Sbjct: 689  PPSYKPKKTYPPTYKPKISYPPTYKTKPSYPASYKRKTSYPPTYKPKISYPSTYKAKPSY 748

Query: 344  PPVEKP-----PVYKPPVEKPPVYKP 406
            PP  KP       YKP +  PP YKP
Sbjct: 749  PPTYKPKPSYASSYKPKIRYPPTYKP 774

 Score =  120 bits (300), Expect = 6e-26
 Identities = 59/146 (40%), Positives = 65/146 (44%), Gaps = 15/146 (10%)
 Frame = +2

Query: 14   PPVYK---------------PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEK 148
            PP+YK               PP  KP    PP YKP    PP Y+P +  PP YKP    
Sbjct: 609  PPIYKSKSSYPTAYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSY 668

Query: 149  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
            P  YK     PP Y+P    PP YKP    PP YKP +  PP YK     P  YK     
Sbjct: 669  PQAYKSKGSYPPSYQPKKTYPPSYKPKKTYPPTYKPKISYPPTYKTKPSYPASYKRKTSY 728

Query: 329  PPVYKPPVEKPPVYKPPVEKPPVYKP 406
            PP YKP +  P  YK     PP YKP
Sbjct: 729  PPTYKPKISYPSTYKAKPSYPPTYKP 754

 Score =  119 bits (299), Expect = 8e-26
 Identities = 57/140 (40%), Positives = 64/140 (45%), Gaps = 5/140 (3%)
 Frame = +2

Query: 2    RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
            ++  PP YKP    P  Y      PP Y+P    PP YKP    PP YKP +  PP YK 
Sbjct: 655  KITYPPTYKPKKSYPQAYKSKGSYPPSYQPKKTYPPSYKPKKTYPPTYKPKISYPPTYKT 714

Query: 167  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
                P  YK     PP YKP +  P  YK     PP YKP       YKP +  PP YKP
Sbjct: 715  KPSYPASYKRKTSYPPTYKPKISYPSTYKAKPSYPPTYKPKPSYASSYKPKIRYPPTYKP 774

Query: 347  PVEKPPVYKPPVEKPPVYKP 406
                   YKP +  PP YKP
Sbjct: 775  KPSYASSYKPKIRYPPTYKP 794

 Score =  118 bits (295), Expect = 2e-25
 Identities = 56/136 (41%), Positives = 62/136 (45%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
            PP Y+P    PP Y P     P YKP +  PP YK     P  YK     PP YKP +  
Sbjct: 679  PPSYQPKKTYPPSYKPKKTYPPTYKPKISYPPTYKTKPSYPASYKRKTSYPPTYKPKISY 738

Query: 179  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
            P  YK     PP YKP       YKP +  PP YKP       YKP +  PP YKP    
Sbjct: 739  PSTYKAKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKPKPSY 798

Query: 359  PPVYKPPVEKPPVYKP 406
               YKP +  PP YKP
Sbjct: 799  ASSYKPKIRYPPTYKP 814

 Score =  109 bits (272), Expect = 1e-22
 Identities = 55/139 (39%), Positives = 62/139 (44%), Gaps = 9/139 (6%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           P  YKP    P +   P Y      PP+YKP  +K   YK      P YK     PP YK
Sbjct: 76  PAPYKPKGYYPTKRYQPTYGSKTNYPPIYKPIAKKLSSYKAIKTTYPAYKAKTSYPPSYK 135

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV---------YKP 346
             +  PP YKP +  PP YK     PP YKP    PP YKP +  PP          YKP
Sbjct: 136 HKITYPPTYKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKPKITYPPTYKRKPSYTPYKP 195

Query: 347 PVEKPPVYKPPVEKPPVYK 403
               PP YKP +  PP YK
Sbjct: 196 KATYPPTYKPKITYPPTYK 214

 Score =  103 bits (256), Expect = 8e-21
 Identities = 52/129 (40%), Positives = 58/129 (44%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           PVYKP  + P  Y      P   KP  Y P     P Y      PP+YKP  +K   YK 
Sbjct: 57  PVYKPMNKIPTPYISKKSYPAPYKPKGYYPTKRYQPTYGSKTNYPPIYKPIAKKLSSYKA 116

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
                P YK     PP YK  +  PP YKP +  PP YK     PP YKP    PP YKP
Sbjct: 117 IKTTYPAYKAKTSYPPSYKHKITYPPTYKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKP 176

Query: 377 PVEKPPVYK 403
            +  PP YK
Sbjct: 177 KITYPPTYK 185

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/120 (39%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = +2

Query: 62  PIYKPPVEKPPVY-----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 226
           P+YKP  + P  Y      P   KP  Y P     P Y      PP+YKP  +K   YK 
Sbjct: 57  PVYKPMNKIPTPYISKKSYPAPYKPKGYYPTKRYQPTYGSKTNYPPIYKPIAKKLSSYKA 116

Query: 227 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
                P YK     PP YK  +  PP YKP +  PP YK     PP YKP    PP YKP
Sbjct: 117 IKTTYPAYKAKTSYPPSYKHKITYPPTYKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKP 176

[39][TOP]
>UniRef100_B8CCT2 Predicted protein n=1 Tax=Thalassiosira pseudonana CCMP1335
           RepID=B8CCT2_THAPS
          Length = 937

 Score =  142 bits (358), Expect = 1e-32
 Identities = 65/117 (55%), Positives = 65/117 (55%)
 Frame = +2

Query: 59  PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 238
           PPI K    KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP  K
Sbjct: 578 PPIQKQTAGKPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAK 637

Query: 239 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            P  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP     P
Sbjct: 638 LPAAKPPAAKPPAAKPPAAKPPTAKPPTAKPPTAKPPAAKPPTVKPPTVKPTAAVKP 694

 Score =  139 bits (351), Expect = 8e-32
 Identities = 63/117 (53%), Positives = 65/117 (55%)
 Frame = +2

Query: 29  PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 208
           PP++K     PP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP  K
Sbjct: 578 PPIQKQTAGKPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAK 637

Query: 209 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 379
            P  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP     P
Sbjct: 638 LPAAKPPAAKPPAAKPPAAKPPTAKPPTAKPPTAKPPAAKPPTVKPPTVKPTAAVKP 694

 Score =  139 bits (349), Expect = 1e-31
 Identities = 63/117 (53%), Positives = 64/117 (54%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP+ K    KPP   PP  KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP  K
Sbjct: 578 PPIQKQTAGKPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAK 637

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            P  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP     P
Sbjct: 638 LPAAKPPAAKPPAAKPPAAKPPTAKPPTAKPPTAKPPAAKPPTVKPPTVKPTAAVKP 694

 Score =  137 bits (344), Expect = 5e-31
 Identities = 63/117 (53%), Positives = 63/117 (53%)
 Frame = +2

Query: 44  PPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 223
           PP       KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP  K
Sbjct: 578 PPIQKQTAGKPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAK 637

Query: 224 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 394
            P  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP     P
Sbjct: 638 LPAAKPPAAKPPAAKPPAAKPPTAKPPTAKPPTAKPPAAKPPTVKPPTVKPTAAVKP 694

 Score =  134 bits (337), Expect = 3e-30
 Identities = 61/115 (53%), Positives = 63/115 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           ++K    KPP  KPP   PP  KPP  KPP  KPP  KPP  KPP  KP   KPP  K P
Sbjct: 580 IQKQTAGKPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAKLP 639

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
             KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP     P
Sbjct: 640 AAKPPAAKPPAAKPPAAKPPTAKPPTAKPPTAKPPAAKPPTVKPPTVKPTAAVKP 694

[40][TOP]
>UniRef100_UPI0000E49E3C PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus
            RepID=UPI0000E49E3C
          Length = 1082

 Score =  142 bits (357), Expect = 2e-32
 Identities = 54/133 (40%), Positives = 80/133 (60%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP  +PP  + P   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 637  QPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 696

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  
Sbjct: 697  QPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTT 756

Query: 371  KPPVEKPPVYKPP 409
            +PP  +PP  +PP
Sbjct: 757  QPPTTQPPTTQPP 769

 Score =  142 bits (357), Expect = 2e-32
 Identities = 54/133 (40%), Positives = 80/133 (60%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP  + P  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 642  QPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 701

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  
Sbjct: 702  QPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTT 761

Query: 371  KPPVEKPPVYKPP 409
            +PP  +PP  +PP
Sbjct: 762  QPPTTQPPTAQPP 774

 Score =  140 bits (354), Expect = 3e-32
 Identities = 55/133 (41%), Positives = 80/133 (60%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 472 QPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTT 531

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  
Sbjct: 532 QPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTT 591

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 592 QPPTTQPPSTQPP 604

 Score =  140 bits (354), Expect = 3e-32
 Identities = 55/132 (41%), Positives = 78/132 (59%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP   PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 488 PPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQ 547

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 548 PPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQ 607

Query: 374 PPVEKPPVYKPP 409
           PP  +PP  +PP
Sbjct: 608 PPYTRPPTTQPP 619

 Score =  140 bits (354), Expect = 3e-32
 Identities = 55/132 (41%), Positives = 79/132 (59%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 493 PPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQ 552

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 553 PPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTR 612

Query: 374 PPVEKPPVYKPP 409
           PP  +PP  +PP
Sbjct: 613 PPTTQPPTTQPP 624

 Score =  140 bits (354), Expect = 3e-32
 Identities = 54/133 (40%), Positives = 80/133 (60%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP  +PP  +PP    P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 632  QPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 691

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 692  QPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPST 751

Query: 371  KPPVEKPPVYKPP 409
            KPP  +PP  +PP
Sbjct: 752  KPPTTQPPTTQPP 764

 Score =  140 bits (353), Expect = 4e-32
 Identities = 55/133 (41%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 467 QPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTT 526

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  
Sbjct: 527 QPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTT 586

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 587 QPPTTQPPTTQPP 599

 Score =  140 bits (353), Expect = 4e-32
 Identities = 55/133 (41%), Positives = 79/133 (59%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 477 QPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPST 536

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  
Sbjct: 537 QPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTT 596

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 597 QPPSTQPPTTQPP 609

 Score =  139 bits (351), Expect = 8e-32
 Identities = 55/133 (41%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 462 QPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTT 521

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  
Sbjct: 522 QPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTT 581

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 582 QPPTTQPPTTQPP 594

 Score =  139 bits (350), Expect = 1e-31
 Identities = 55/133 (41%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  
Sbjct: 452 QPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPST 511

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  
Sbjct: 512 EPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPST 571

Query: 371 KPPVEKPPVYKPP 409
           KPP  +PP  +PP
Sbjct: 572 KPPTTQPPTTQPP 584

 Score =  139 bits (350), Expect = 1e-31
 Identities = 55/133 (41%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  
Sbjct: 457 QPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTM 516

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  
Sbjct: 517 QPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTT 576

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 577 QPPTTQPPTTQPP 589

 Score =  139 bits (350), Expect = 1e-31
 Identities = 54/133 (40%), Positives = 79/133 (59%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ 
Sbjct: 497 QPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMT 556

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 557 HPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTT 616

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  + P
Sbjct: 617 QPPTTQPPTTQLP 629

 Score =  139 bits (349), Expect = 1e-31
 Identities = 55/133 (41%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP   PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 482 QPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTT 541

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 542 QPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPST 601

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 602 QPPTTQPPYTRPP 614

 Score =  138 bits (348), Expect = 2e-31
 Identities = 53/133 (39%), Positives = 79/133 (59%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP  + P  +PP   PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 622  QPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 681

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 682  QPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTT 741

Query: 371  KPPVEKPPVYKPP 409
            +PP  +PP  KPP
Sbjct: 742  QPPTTQPPSTKPP 754

 Score =  138 bits (347), Expect = 2e-31
 Identities = 54/133 (40%), Positives = 79/133 (59%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  
Sbjct: 502 QPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTA 561

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 562 QPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTT 621

Query: 371 KPPVEKPPVYKPP 409
           +PP  + P  +PP
Sbjct: 622 QPPTTQLPTTQPP 634

 Score =  138 bits (347), Expect = 2e-31
 Identities = 54/133 (40%), Positives = 79/133 (59%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  
Sbjct: 512 EPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPST 571

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  
Sbjct: 572 KPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTT 631

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 632 QPPSTQPPTTQPP 644

 Score =  138 bits (347), Expect = 2e-31
 Identities = 53/131 (40%), Positives = 78/131 (59%)
 Frame = +2

Query: 17   PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
            P  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P
Sbjct: 629  PTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQP 688

Query: 197  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
            P  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P
Sbjct: 689  PTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQP 748

Query: 377  PVEKPPVYKPP 409
            P  KPP  +PP
Sbjct: 749  PSTKPPTTQPP 759

 Score =  137 bits (346), Expect = 3e-31
 Identities = 53/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            + P  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 647  RQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 706

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  
Sbjct: 707  QPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTT 766

Query: 371  KPPVEKPPVYKPP 409
            +PP  +PP    P
Sbjct: 767  QPPTAQPPTTPVP 779

 Score =  137 bits (344), Expect = 5e-31
 Identities = 53/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  
Sbjct: 572 KPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTT 631

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 632 QPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 691

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 692 QPPTTQPPTTQPP 704

 Score =  137 bits (344), Expect = 5e-31
 Identities = 52/133 (39%), Positives = 79/133 (59%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  
Sbjct: 582 QPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTT 641

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 642 QPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 701

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP+ +PP
Sbjct: 702 QPPTTQPPITQPP 714

 Score =  137 bits (344), Expect = 5e-31
 Identities = 52/133 (39%), Positives = 79/133 (59%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  
Sbjct: 587 QPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTT 646

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 647 RQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 706

Query: 371 KPPVEKPPVYKPP 409
           +PP+ +PP  +PP
Sbjct: 707 QPPITQPPSTQPP 719

 Score =  137 bits (344), Expect = 5e-31
 Identities = 52/133 (39%), Positives = 79/133 (59%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP  +PP  +PP    P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  
Sbjct: 612  RPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTT 671

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  
Sbjct: 672  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTT 731

Query: 371  KPPVEKPPVYKPP 409
            +PP  +PP  +PP
Sbjct: 732  QPPTTQPPTTQPP 744

 Score =  137 bits (344), Expect = 5e-31
 Identities = 52/133 (39%), Positives = 79/133 (59%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP  +PP  + P   PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  
Sbjct: 617  QPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTT 676

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  
Sbjct: 677  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTT 736

Query: 371  KPPVEKPPVYKPP 409
            +PP  +PP  +PP
Sbjct: 737  QPPTTQPPTTQPP 749

 Score =  137 bits (344), Expect = 5e-31
 Identities = 53/132 (40%), Positives = 77/132 (58%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ 
Sbjct: 652  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPIT 711

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  
Sbjct: 712  QPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPPTA 771

Query: 371  KPPVEKPPVYKP 406
            +PP    P   P
Sbjct: 772  QPPTTPVPCLHP 783

 Score =  136 bits (343), Expect = 6e-31
 Identities = 54/133 (40%), Positives = 79/133 (59%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  
Sbjct: 507 QPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTT 566

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 567 QPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTT 626

Query: 371 KPPVEKPPVYKPP 409
           + P  +PP  +PP
Sbjct: 627 QLPTTQPPSTQPP 639

 Score =  136 bits (343), Expect = 6e-31
 Identities = 52/133 (39%), Positives = 79/133 (59%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP  +PP  +PP   PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  
Sbjct: 602  QPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTT 661

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  
Sbjct: 662  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTT 721

Query: 371  KPPVEKPPVYKPP 409
            +PP  +PP  +PP
Sbjct: 722  QPPTTQPPTTQPP 734

 Score =  136 bits (343), Expect = 6e-31
 Identities = 52/133 (39%), Positives = 79/133 (59%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  
Sbjct: 607  QPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTT 666

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  
Sbjct: 667  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTT 726

Query: 371  KPPVEKPPVYKPP 409
            +PP  +PP  +PP
Sbjct: 727  QPPTTQPPTTQPP 739

 Score =  136 bits (342), Expect = 8e-31
 Identities = 54/131 (41%), Positives = 76/131 (58%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P  +PP  +PP   PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +P
Sbjct: 449 PTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQP 508

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
           P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +P
Sbjct: 509 PSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQP 568

Query: 377 PVEKPPVYKPP 409
           P  KPP  +PP
Sbjct: 569 PSTKPPTTQPP 579

 Score =  136 bits (342), Expect = 8e-31
 Identities = 53/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  
Sbjct: 522 QPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTT 581

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  
Sbjct: 582 QPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTT 641

Query: 371 KPPVEKPPVYKPP 409
           +PP  + P  +PP
Sbjct: 642 QPPTTRQPTTQPP 654

 Score =  136 bits (342), Expect = 8e-31
 Identities = 53/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  
Sbjct: 537 QPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTT 596

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  
Sbjct: 597 QPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTT 656

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 657 QPPTTQPPTTQPP 669

 Score =  136 bits (342), Expect = 8e-31
 Identities = 53/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP+  PP  +PP   PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 552 QPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYT 611

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  
Sbjct: 612 RPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTT 671

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 672 QPPTTQPPTTQPP 684

 Score =  136 bits (342), Expect = 8e-31
 Identities = 53/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  KPP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 562 QPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTT 621

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 622 QPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 681

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 682 QPPTTQPPTTQPP 694

 Score =  136 bits (342), Expect = 8e-31
 Identities = 53/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 567 QPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTT 626

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 627 QLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 686

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 687 QPPTTQPPTTQPP 699

 Score =  136 bits (342), Expect = 8e-31
 Identities = 52/133 (39%), Positives = 79/133 (59%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  
Sbjct: 592 QPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTT 651

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ 
Sbjct: 652 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPIT 711

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 712 QPPSTQPPTTQPP 724

 Score =  135 bits (341), Expect = 1e-30
 Identities = 54/132 (40%), Positives = 76/132 (57%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP  + P  +PP   PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +
Sbjct: 443 PPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQ 502

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +
Sbjct: 503 PPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQ 562

Query: 374 PPVEKPPVYKPP 409
           PP  +PP  KPP
Sbjct: 563 PPTTQPPSTKPP 574

 Score =  135 bits (341), Expect = 1e-30
 Identities = 53/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP+  PP   PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 547 QPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTT 606

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  
Sbjct: 607 QPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTT 666

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 667 QPPTTQPPTTQPP 679

 Score =  135 bits (340), Expect = 1e-30
 Identities = 53/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  
Sbjct: 517 QPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTT 576

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  
Sbjct: 577 QPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPST 636

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  + P
Sbjct: 637 QPPTTQPPTTRQP 649

 Score =  135 bits (340), Expect = 1e-30
 Identities = 53/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 542 QPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPST 601

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  
Sbjct: 602 QPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTT 661

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 662 QPPTTQPPTTQPP 674

 Score =  135 bits (340), Expect = 1e-30
 Identities = 52/132 (39%), Positives = 77/132 (58%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 558 PPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQ 617

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 618 PPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQ 677

Query: 374 PPVEKPPVYKPP 409
           PP  +PP  +PP
Sbjct: 678 PPTTQPPTTQPP 689

 Score =  135 bits (340), Expect = 1e-30
 Identities = 52/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  
Sbjct: 577 QPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPST 636

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 637 QPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 696

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 697 QPPTTQPPTTQPP 709

 Score =  135 bits (340), Expect = 1e-30
 Identities = 52/133 (39%), Positives = 79/133 (59%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  
Sbjct: 597 QPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTT 656

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  
Sbjct: 657 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPST 716

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 717 QPPTTQPPTTQPP 729

 Score =  135 bits (339), Expect = 2e-30
 Identities = 53/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  
Sbjct: 527 QPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTT 586

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  
Sbjct: 587 QPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTT 646

Query: 371 KPPVEKPPVYKPP 409
           + P  +PP  +PP
Sbjct: 647 RQPTTQPPTTQPP 659

 Score =  135 bits (339), Expect = 2e-30
 Identities = 53/133 (39%), Positives = 78/133 (58%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  
Sbjct: 532 QPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTT 591

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  
Sbjct: 592 QPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTT 651

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 652 QPPTTQPPTTQPP 664

 Score =  134 bits (336), Expect = 4e-30
 Identities = 53/133 (39%), Positives = 76/133 (57%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 422 QPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTI 481

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 482 QPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTT 541

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 542 QPPTTQPPTTQPP 554

 Score =  134 bits (336), Expect = 4e-30
 Identities = 53/133 (39%), Positives = 77/133 (57%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 427 QPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPST 486

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 487 SPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTT 546

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP+  PP
Sbjct: 547 QPPTTQPPMTHPP 559

 Score =  133 bits (335), Expect = 5e-30
 Identities = 53/133 (39%), Positives = 76/133 (57%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP   PP    P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  
Sbjct: 432 QPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTT 491

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 492 HPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTT 551

Query: 371 KPPVEKPPVYKPP 409
           +PP+  PP  +PP
Sbjct: 552 QPPMTHPPTAQPP 564

 Score =  133 bits (334), Expect = 7e-30
 Identities = 53/132 (40%), Positives = 77/132 (58%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +P   +PP  + P  +
Sbjct: 138 PPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQ 197

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +
Sbjct: 198 PPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQ 257

Query: 374 PPVEKPPVYKPP 409
           PP  +PP+ KPP
Sbjct: 258 PPTTRPPITKPP 269

 Score =  133 bits (334), Expect = 7e-30
 Identities = 54/138 (39%), Positives = 78/138 (56%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 332 QPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTT 391

Query: 191 KPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
           +PP  +PP  +PP  +P     P  +PP  +PP  +PP  +PP  +PP   PP  + P  
Sbjct: 392 QPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTT 451

Query: 356 KPPVYKPPVEKPPVYKPP 409
           +PP  +PP  +PP  +PP
Sbjct: 452 QPPTTQPPSTQPPTTQPP 469

 Score =  133 bits (334), Expect = 7e-30
 Identities = 53/133 (39%), Positives = 76/133 (57%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  
Sbjct: 417 QPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTT 476

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 477 QPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPST 536

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 537 QPPTTQPPTTQPP 549

 Score =  132 bits (333), Expect = 9e-30
 Identities = 52/133 (39%), Positives = 76/133 (57%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  KPP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P   
Sbjct: 352 QPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTT 411

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           + P  +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  
Sbjct: 412 QTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPST 471

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 472 QPPTTQPPTIQPP 484

 Score =  132 bits (333), Expect = 9e-30
 Identities = 53/133 (39%), Positives = 76/133 (57%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP   PP  + P   PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  
Sbjct: 437 QPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTP 496

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ 
Sbjct: 497 QPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMT 556

Query: 371 KPPVEKPPVYKPP 409
            PP  +PP  +PP
Sbjct: 557 HPPTAQPPTTQPP 569

 Score =  132 bits (332), Expect = 1e-29
 Identities = 53/136 (38%), Positives = 76/136 (55%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           R  + P  +PP  +PP   PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +P
Sbjct: 409 RTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQP 468

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           P  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +P
Sbjct: 469 PSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQP 528

Query: 362 PVYKPPVEKPPVYKPP 409
           P  +PP  +PP  +PP
Sbjct: 529 PTTQPPSTQPPTTQPP 544

 Score =  132 bits (331), Expect = 2e-29
 Identities = 53/135 (39%), Positives = 76/135 (56%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           + KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P 
Sbjct: 265 ITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPL 324

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
             +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP
Sbjct: 325 TTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPP 384

Query: 365 VYKPPVEKPPVYKPP 409
             +PP  +PP  +PP
Sbjct: 385 STQPPTTQPPTTQPP 399

 Score =  131 bits (330), Expect = 2e-29
 Identities = 53/133 (39%), Positives = 77/133 (57%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  KPP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 117 QPPTTQPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTT 176

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 177 QPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTT 236

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 237 QPPTTQPPTTQPP 249

 Score =  131 bits (330), Expect = 2e-29
 Identities = 52/129 (40%), Positives = 75/129 (58%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  
Sbjct: 657  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPST 716

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  
Sbjct: 717  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPPTT 776

Query: 371  KPPVEKPPV 397
              P   P V
Sbjct: 777  PVPCLHPGV 785

 Score =  130 bits (328), Expect = 3e-29
 Identities = 53/133 (39%), Positives = 76/133 (57%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  
Sbjct: 257 QPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPST 316

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           KP   +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  
Sbjct: 317 KPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTT 376

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 377 RPPTTQPPSTQPP 389

 Score =  130 bits (328), Expect = 3e-29
 Identities = 53/133 (39%), Positives = 75/133 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP+ KPP    P   PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   
Sbjct: 262 RPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTT 321

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  
Sbjct: 322 QPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTT 381

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 382 QPPSTQPPTTQPP 394

 Score =  130 bits (328), Expect = 3e-29
 Identities = 54/138 (39%), Positives = 78/138 (56%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 342 QPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTT 401

Query: 191 KPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
           +PP  +P     P  +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  
Sbjct: 402 QPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPST 461

Query: 356 KPPVYKPPVEKPPVYKPP 409
           +PP  +PP  +PP  +PP
Sbjct: 462 QPPTTQPPSTQPPTTQPP 479

 Score =  130 bits (327), Expect = 5e-29
 Identities = 53/133 (39%), Positives = 74/133 (55%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  
Sbjct: 232 QPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTT 291

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP  +PP  
Sbjct: 292 QPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTT 351

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  KPP
Sbjct: 352 QPPTTQPPTTKPP 364

 Score =  130 bits (327), Expect = 5e-29
 Identities = 54/133 (40%), Positives = 74/133 (55%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP   PP  +PP   PPI KPP    P  +PP   PP  +PP  +PP  +PP+  PP  
Sbjct: 247 QPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTT 306

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  KP   +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  
Sbjct: 307 QPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPST 366

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 367 QPPTTQPPTTRPP 379

 Score =  130 bits (326), Expect = 6e-29
 Identities = 52/133 (39%), Positives = 77/133 (57%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 112 QPPTTQPPTTQPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTT 171

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 172 QPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPST 231

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 232 QPPTTQPPTTQPP 244

 Score =  130 bits (326), Expect = 6e-29
 Identities = 53/133 (39%), Positives = 75/133 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  
Sbjct: 237 QPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTT 296

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP  +PP  +PP  
Sbjct: 297 QPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTT 356

Query: 371 KPPVEKPPVYKPP 409
           +PP  KPP  +PP
Sbjct: 357 QPPTTKPPSTQPP 369

 Score =  130 bits (326), Expect = 6e-29
 Identities = 54/138 (39%), Positives = 76/138 (55%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVE 175
           +PP  KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +P     P  
Sbjct: 357 QPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTT 416

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
           +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  
Sbjct: 417 QPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTT 476

Query: 356 KPPVYKPPVEKPPVYKPP 409
           +PP  +PP   PP   PP
Sbjct: 477 QPPTIQPPSTSPPTTHPP 494

 Score =  130 bits (326), Expect = 6e-29
 Identities = 51/133 (38%), Positives = 74/133 (55%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +P   + P  +PP  +PP  +PP  
Sbjct: 372 QPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTT 431

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  
Sbjct: 432 QPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTT 491

Query: 371 KPPVEKPPVYKPP 409
            PP  +PP  +PP
Sbjct: 492 HPPTPQPPTTQPP 504

 Score =  129 bits (325), Expect = 8e-29
 Identities = 52/133 (39%), Positives = 76/133 (57%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +P   +PP  + P  +PP  
Sbjct: 142 QPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTT 201

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  
Sbjct: 202 QPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTT 261

Query: 371 KPPVEKPPVYKPP 409
           +PP+ KPP    P
Sbjct: 262 RPPITKPPTSHLP 274

 Score =  129 bits (324), Expect = 1e-28
 Identities = 53/132 (40%), Positives = 75/132 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  + P  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 187 QPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTT 246

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  
Sbjct: 247 QPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTT 306

Query: 371 KPPVEKPPVYKP 406
           +PP  +PP  KP
Sbjct: 307 QPPTTQPPSTKP 318

 Score =  129 bits (324), Expect = 1e-28
 Identities = 52/132 (39%), Positives = 75/132 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP   PP  +PP   PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  
Sbjct: 277 QPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTT 336

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 337 QPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTT 396

Query: 371 KPPVEKPPVYKP 406
           +PP  +PP  +P
Sbjct: 397 QPPTTQPPTTQP 408

 Score =  129 bits (324), Expect = 1e-28
 Identities = 51/133 (38%), Positives = 75/133 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +P   +PP  +PP   PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  
Sbjct: 327 QPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPST 386

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +P   + P  +PP  +PP  +PP  +PP  +PP   PP  
Sbjct: 387 QPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTT 446

Query: 371 KPPVEKPPVYKPP 409
           + P  +PP  +PP
Sbjct: 447 QTPTTQPPTTQPP 459

 Score =  129 bits (324), Expect = 1e-28
 Identities = 51/125 (40%), Positives = 73/125 (58%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  
Sbjct: 662  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTT 721

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP    P  
Sbjct: 722  QPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPPTTPVPCL 781

Query: 371  KPPVE 385
             P VE
Sbjct: 782  HPGVE 786

 Score =  129 bits (323), Expect = 1e-28
 Identities = 52/134 (38%), Positives = 76/134 (56%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           +  P  +PP  +PP   PP  KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP 
Sbjct: 106 DSEPTTQPPTTQPPTTQPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPT 165

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
            +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP 
Sbjct: 166 TQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPT 225

Query: 368 YKPPVEKPPVYKPP 409
            +PP  +PP  +PP
Sbjct: 226 TQPPSTQPPTTQPP 239

 Score =  129 bits (323), Expect = 1e-28
 Identities = 52/133 (39%), Positives = 76/133 (57%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  
Sbjct: 147 QPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPST 206

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ 
Sbjct: 207 QPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPIT 266

Query: 371 KPPVEKPPVYKPP 409
           KPP    P  +PP
Sbjct: 267 KPPTSHLPTTQPP 279

 Score =  129 bits (323), Expect = 1e-28
 Identities = 53/133 (39%), Positives = 74/133 (55%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP   PP   PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+ 
Sbjct: 242 QPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMT 301

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 302 HPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTT 361

Query: 371 KPPVEKPPVYKPP 409
           KPP  +PP  +PP
Sbjct: 362 KPPSTQPPTTQPP 374

 Score =  128 bits (322), Expect = 2e-28
 Identities = 53/138 (38%), Positives = 76/138 (55%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVE 175
           +PP  +PP  +PP   PP  +PP  +PP  +P     P  +PP  +PP  +PP  +PP  
Sbjct: 377 RPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTT 436

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
           +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  
Sbjct: 437 QPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTP 496

Query: 356 KPPVYKPPVEKPPVYKPP 409
           +PP  +PP  +PP  +PP
Sbjct: 497 QPPTTQPPATQPPSTEPP 514

 Score =  128 bits (322), Expect = 2e-28
 Identities = 53/138 (38%), Positives = 76/138 (55%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 175
           +PP  +PP  +PP   PP  +P     P  +PP  +PP  +PP  +PP  +PP   PP  
Sbjct: 387 QPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTT 446

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
           + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  
Sbjct: 447 QTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPAT 506

Query: 356 KPPVYKPPVEKPPVYKPP 409
           +PP  +PP  +PP  +PP
Sbjct: 507 QPPSTEPPTMQPPTTQPP 524

 Score =  128 bits (322), Expect = 2e-28
 Identities = 53/138 (38%), Positives = 76/138 (55%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKP-----PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 175
           +PP  +PP  +P     P   PP  +PP  +PP  +PP  +PP   PP  + P  +PP  
Sbjct: 397 QPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTT 456

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
           +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  
Sbjct: 457 QPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTM 516

Query: 356 KPPVYKPPVEKPPVYKPP 409
           +PP  +PP  +PP  +PP
Sbjct: 517 QPPTTQPPTTQPPTTQPP 534

 Score =  128 bits (321), Expect = 2e-28
 Identities = 52/133 (39%), Positives = 75/133 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +P   +PP  + P   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 182 QPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTT 241

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+ 
Sbjct: 242 QPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMT 301

Query: 371 KPPVEKPPVYKPP 409
            PP  +PP  +PP
Sbjct: 302 HPPTTQPPTTQPP 314

 Score =  128 bits (321), Expect = 2e-28
 Identities = 52/133 (39%), Positives = 74/133 (55%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ 
Sbjct: 207 QPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPIT 266

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   
Sbjct: 267 KPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTT 326

Query: 371 KPPVEKPPVYKPP 409
           +P   +PP  +PP
Sbjct: 327 QPATTQPPTTQPP 339

 Score =  128 bits (321), Expect = 2e-28
 Identities = 53/138 (38%), Positives = 77/138 (55%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP+  PP  +PP   PP  KP   +P   +P   +PP  +PP  +PP  +PP  +PP  
Sbjct: 297 QPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTT 356

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVE 355
           +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P     P  
Sbjct: 357 QPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTT 416

Query: 356 KPPVYKPPVEKPPVYKPP 409
           +PP  +PP  +PP  +PP
Sbjct: 417 QPPTTQPPTTQPPTTQPP 434

 Score =  127 bits (320), Expect = 3e-28
 Identities = 52/133 (39%), Positives = 75/133 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  
Sbjct: 157 QPPTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTT 216

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  
Sbjct: 217 QPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTT 276

Query: 371 KPPVEKPPVYKPP 409
           +PP   PP  +PP
Sbjct: 277 QPPSTLPPTTQPP 289

 Score =  127 bits (320), Expect = 3e-28
 Identities = 52/133 (39%), Positives = 75/133 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 167 QPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTT 226

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  
Sbjct: 227 QPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTT 286

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 287 QPPTTQPPTTQPP 299

 Score =  127 bits (320), Expect = 3e-28
 Identities = 52/133 (39%), Positives = 75/133 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +P   +PP    P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 177 QPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTT 236

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  
Sbjct: 237 QPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTT 296

Query: 371 KPPVEKPPVYKPP 409
           +PP+  PP  +PP
Sbjct: 297 QPPMTHPPTTQPP 309

 Score =  127 bits (320), Expect = 3e-28
 Identities = 52/130 (40%), Positives = 73/130 (56%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   P
Sbjct: 194 PSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYP 253

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
           P  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +P
Sbjct: 254 PTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQP 313

Query: 377 PVEKPPVYKP 406
           P  KP   +P
Sbjct: 314 PSTKPSTTQP 323

 Score =  127 bits (320), Expect = 3e-28
 Identities = 52/132 (39%), Positives = 74/132 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  
Sbjct: 197 QPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTT 256

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  
Sbjct: 257 QPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPST 316

Query: 371 KPPVEKPPVYKP 406
           KP   +P   +P
Sbjct: 317 KPSTTQPLTTQP 328

 Score =  127 bits (320), Expect = 3e-28
 Identities = 52/133 (39%), Positives = 74/133 (55%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP  
Sbjct: 212 QPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTS 271

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
             P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P   
Sbjct: 272 HLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATT 331

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 332 QPPTTQPPTSQPP 344

 Score =  127 bits (320), Expect = 3e-28
 Identities = 51/133 (38%), Positives = 75/133 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  KP    P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  
Sbjct: 307 QPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPST 366

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P   + P  +PP  +PP  
Sbjct: 367 QPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTT 426

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP  +PP
Sbjct: 427 QPPTTQPPTTQPP 439

 Score =  127 bits (319), Expect = 4e-28
 Identities = 52/133 (39%), Positives = 75/133 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  
Sbjct: 162 QPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPST 221

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP  
Sbjct: 222 QPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPST 281

Query: 371 KPPVEKPPVYKPP 409
            PP  +PP  +PP
Sbjct: 282 LPPTTQPPTTQPP 294

 Score =  127 bits (319), Expect = 4e-28
 Identities = 53/137 (38%), Positives = 76/137 (55%), Gaps = 5/137 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP  +PP  +PP   PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP  +
Sbjct: 283 PPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQ 342

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 343 PPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQ 402

Query: 374 PPVEKP-----PVYKPP 409
           PP  +P     P  +PP
Sbjct: 403 PPTTQPRTTQTPTTQPP 419

 Score =  127 bits (319), Expect = 4e-28
 Identities = 53/138 (38%), Positives = 77/138 (55%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP  
Sbjct: 287 QPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPST 346

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 347 QPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTT 406

Query: 371 KP-----PVEKPPVYKPP 409
           +P     P  +PP  +PP
Sbjct: 407 QPRTTQTPTTQPPTTQPP 424

 Score =  127 bits (318), Expect = 5e-28
 Identities = 52/133 (39%), Positives = 75/133 (56%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +P    PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 172 QPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPST 231

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  
Sbjct: 232 QPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTT 291

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP+  PP
Sbjct: 292 QPPTTQPPMTHPP 304

 Score =  127 bits (318), Expect = 5e-28
 Identities = 53/138 (38%), Positives = 76/138 (55%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKP-----PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 175
           +PP  +P     P  +PP   PP  +PP  +PP  +PP   PP  + P  +PP  +PP  
Sbjct: 402 QPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPST 461

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
           +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 462 QPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTT 521

Query: 356 KPPVYKPPVEKPPVYKPP 409
           +PP  +PP  +PP  +PP
Sbjct: 522 QPPTTQPPTTQPPSTQPP 539

 Score =  126 bits (316), Expect = 9e-28
 Identities = 52/133 (39%), Positives = 74/133 (55%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  
Sbjct: 202 QPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTT 261

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   
Sbjct: 262 RPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTT 321

Query: 371 KPPVEKPPVYKPP 409
           +P   +P   +PP
Sbjct: 322 QPLTTQPATTQPP 334

 Score =  125 bits (315), Expect = 1e-27
 Identities = 51/133 (38%), Positives = 74/133 (55%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  KP   +P    P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  
Sbjct: 312 QPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTT 371

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P   + P  +PP  +PP  +PP  
Sbjct: 372 QPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTT 431

Query: 371 KPPVEKPPVYKPP 409
           +PP  +PP   PP
Sbjct: 432 QPPTTQPPTAWPP 444

 Score =  124 bits (311), Expect = 3e-27
 Identities = 52/138 (37%), Positives = 75/138 (54%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KP   +P   +P    PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  
Sbjct: 317 KPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTT 376

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVE 355
           +PP  +PP  +PP  +PP  +PP  +PP  +P     P  +PP  +PP  +PP  +PP  
Sbjct: 377 RPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTT 436

Query: 356 KPPVYKPPVEKPPVYKPP 409
           +PP   PP  + P  +PP
Sbjct: 437 QPPTAWPPTTQTPTTQPP 454

 Score =  122 bits (305), Expect = 2e-26
 Identities = 50/130 (38%), Positives = 72/130 (55%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  
Sbjct: 667  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTT 726

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP    P   P V 
Sbjct: 727  QPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPPTTPVPCLHPGVE 786

Query: 371  KPPVEKPPVY 400
                  P +Y
Sbjct: 787  VCGTSLPGLY 796

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 31/77 (40%), Positives = 43/77 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           + +PP  +PP  +PP   PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP
Sbjct: 710 ITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPP 769

Query: 185 VYKPPVEKPPVYKPPVE 235
             +PP    P   P VE
Sbjct: 770 TAQPPTTPVPCLHPGVE 786

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 28/114 (24%), Positives = 52/114 (45%)
 Frame = +1

Query: 70  QAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPSL 249
           Q P+ +    QTP  +    Q P+ +  + Q P+ +  +      +TP+ Q P+ + PS 
Sbjct: 402 QPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPST 461

Query: 250 QTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           Q    +  S Q P  + P++Q       +   P+ + P+ Q P  + PS + P+
Sbjct: 462 QPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPT 515

[41][TOP]
>UniRef100_C6TN18 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TN18_SOYBN
          Length = 143

 Score =  141 bits (355), Expect = 3e-32
 Identities = 74/122 (60%), Positives = 90/122 (73%), Gaps = 10/122 (8%)
 Frame = +2

Query: 53  YTPPIYKPP-VEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVEKPP-VY 220
           + PPIY+PP +EKPP+Y+PP    P Y+PP  +  PP+YKPP   PPVY+PP EKPP VY
Sbjct: 25  FFPPIYEPPPIEKPPIYEPP----PSYEPPPTENPPPLYKPPFYPPPVYQPPYEKPPPVY 80

Query: 221 KPPVEKPP-VYKPPVEKPP-VYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVY--KPPV 382
           +PP EKPP VY+PP EKPP VY+PP EK PPVY+PP EK PP Y+PP+  PP Y   PP 
Sbjct: 81  QPPYEKPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPNEKPPPEYQPPIYNPPPYGHYPPS 140

Query: 383 EK 388
           +K
Sbjct: 141 KK 142

 Score =  131 bits (330), Expect = 2e-29
 Identities = 67/105 (63%), Positives = 81/105 (77%), Gaps = 8/105 (7%)
 Frame = +2

Query: 119 PPVYKPP-VEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVEKPP-VYKP 286
           PP+Y+PP +EKPP+Y+PP    P Y+PP  +  PP+YKPP   PPVY+PP EKPP VY+P
Sbjct: 27  PPIYEPPPIEKPPIYEPP----PSYEPPPTENPPPLYKPPFYPPPVYQPPYEKPPPVYQP 82

Query: 287 PVEKPP-VYKPPVEKPP-VYKPPVEK-PPVYKPPVEK-PPVYKPP 409
           P EKPP VY+PP EKPP VY+PP EK PPVY+PP EK PP Y+PP
Sbjct: 83  PYEKPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPNEKPPPEYQPP 127

 Score =  129 bits (325), Expect = 8e-29
 Identities = 69/115 (60%), Positives = 82/115 (71%), Gaps = 7/115 (6%)
 Frame = +2

Query: 5   VEKPPVYKPP--VEKPP-EYTPPIYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPP 169
           +EKPP+Y+PP   E PP E  PP+YKPP   PPVY+PP EK PPVY+PP EK PPVY+PP
Sbjct: 35  IEKPPIYEPPPSYEPPPTENPPPLYKPPFYPPPVYQPPYEKPPPVYQPPYEKPPPVYQPP 94

Query: 170 VEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
            EK PPVY+PP EK PPVY+PP EKP    PP  +PP+Y PP   P  + PP +K
Sbjct: 95  YEKPPPVYQPPYEKPPPVYQPPNEKP----PPEYQPPIYNPP---PYGHYPPSKK 142

[42][TOP]
>UniRef100_C9SV57 Repetitive proline-rich cell wall protein n=1 Tax=Verticillium
           albo-atrum VaMs.102 RepID=C9SV57_9PEZI
          Length = 345

 Score =  141 bits (355), Expect = 3e-32
 Identities = 67/121 (55%), Positives = 78/121 (64%)
 Frame = +2

Query: 47  PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 226
           P   PP+Y+PP E  PVY+PP E  P  +PP E  PVY+PPVE  PVY+PPVE  PVY+P
Sbjct: 20  PAPDPPVYEPPAESHPVYEPPKESYPPVEPPKESHPVYEPPVESHPVYEPPVESHPVYEP 79

Query: 227 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           P E  PVY+PP E  PVY+PP E  PVY+PP E  PVY+P  E    Y PP   P  Y P
Sbjct: 80  PKESHPVYEPPKESHPVYEPPKESHPVYEPPKESHPVYEPLKES---YSPP--PPHEYPP 134

Query: 407 P 409
           P
Sbjct: 135 P 135

 Score =  135 bits (341), Expect = 1e-30
 Identities = 66/123 (53%), Positives = 78/123 (63%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P   PPV +PP  + P+Y+PP E  P  +PP E  PVY+PPVE  PVY+PPVE  PVY+P
Sbjct: 20  PAPDPPVYEPPAESHPVYEPPKESYPPVEPPKESHPVYEPPVESHPVYEPPVESHPVYEP 79

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
           P E  PVY+PP E  PVY+PP E  PVY+PP E  PVY+P  E    Y PP   PP   P
Sbjct: 80  PKESHPVYEPPKESHPVYEPPKESHPVYEPPKESHPVYEPLKES---YSPP---PPHEYP 133

Query: 377 PVE 385
           P E
Sbjct: 134 PPE 136

 Score =  129 bits (324), Expect = 1e-28
 Identities = 67/119 (56%), Positives = 75/119 (63%), Gaps = 5/119 (4%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYK-PPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PPVY+PP E  P Y PP    PPVE P    PVY+PPVE  PVY+PPVE  PVY+PP E 
Sbjct: 24  PPVYEPPAESHPVYEPPKESYPPVEPPKESHPVYEPPVESHPVYEPPVESHPVYEPPKES 83

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
            PVY+PP E  PVY+PP E  PVY+PP E  PVY+P  E    Y PP   PP   PP E
Sbjct: 84  HPVYEPPKESHPVYEPPKESHPVYEPPKESHPVYEPLKES---YSPP---PPHEYPPPE 136

 Score =  117 bits (294), Expect = 3e-25
 Identities = 59/111 (53%), Positives = 71/111 (63%), Gaps = 5/111 (4%)
 Frame = +2

Query: 8   EKPPVYKPPVE-----KPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E  PVY+PP E     +PP+ + P+Y+PPVE  PVY+PPVE  PVY+PP E  PVY+PP 
Sbjct: 32  ESHPVYEPPKESYPPVEPPKESHPVYEPPVESHPVYEPPVESHPVYEPPKESHPVYEPPK 91

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 325
           E  PVY+PP E  PVY+PP E  PVY+P  E    Y PP   PP   PP E
Sbjct: 92  ESHPVYEPPKESHPVYEPPKESHPVYEPLKES---YSPP---PPHEYPPPE 136

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 42/82 (51%), Positives = 48/82 (58%), Gaps = 5/82 (6%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPP-----IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VE  PVY+PPVE  P Y PP     +Y+PP E  PVY+PP E  PVY+PP E  PVY+P 
Sbjct: 61  VESHPVYEPPVESHPVYEPPKESHPVYEPPKESHPVYEPPKESHPVYEPPKESHPVYEPL 120

Query: 170 VEKPPVYKPPVEKPPVYKPPVE 235
            E    Y PP   PP   PP E
Sbjct: 121 KES---YSPP---PPHEYPPPE 136

[43][TOP]
>UniRef100_Q9LZJ7 Proline-rich protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9LZJ7_ARATH
          Length = 313

 Score =  140 bits (352), Expect = 6e-32
 Identities = 78/144 (54%), Positives = 81/144 (56%), Gaps = 13/144 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKP----PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPP 169
           PPVYK P  KP    P YTPP+YKP +  PPVY  P   PPVY PPV K    PPVY  P
Sbjct: 30  PPVYKSPEHKPTLPSPVYTPPVYKPTLS-PPVYTKPTIPPPVYTPPVYKHTPSPPVYTKP 88

Query: 170 VEKPPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPP 334
              PPVY PPV KP    PVY  P   PPVY PPV KP PVY  P   PPVY PPV KP 
Sbjct: 89  TIPPPVYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKPTPVYTKPTIPPPVYTPPVYKPT 148

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKP 406
              P  +K P Y  P   PP Y P
Sbjct: 149 PSPPVYKKSPSYSSP---PPPYVP 169

 Score =  127 bits (320), Expect = 3e-28
 Identities = 72/139 (51%), Positives = 75/139 (53%), Gaps = 5/139 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYKPPV 172
           V  PPVYKP +  PP YT P   PPV  PPVYK    PPV   P   PPV  PPVYKP +
Sbjct: 46  VYTPPVYKPTL-SPPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTL 104

Query: 173 EKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
             PPVY  P   PPVY PPV KP PVY  P   PPVY PPV KP    P  +K P Y  P
Sbjct: 105 -SPPVYTKPTIPPPVYTPPVYKPTPVYTKPTIPPPVYTPPVYKPTPSPPVYKKSPSYSSP 163

Query: 350 VEKPPVYKPPVEKPPVYKP 406
              PP Y P     P  KP
Sbjct: 164 ---PPPYVPKPTYTPTTKP 179

 Score =  120 bits (302), Expect = 4e-26
 Identities = 66/128 (51%), Positives = 69/128 (53%), Gaps = 5/128 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYK----PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           PPVY  P   PP YTPP+YK    PPV   P   PPV  PPVYKP +  PPVY  P   P
Sbjct: 58  PPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTL-SPPVYTKPTIPP 116

Query: 182 PVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PVY PPV KP PVY  P   PPVY PPV KP    P  +K P Y  P   PP Y P    
Sbjct: 117 PVYTPPVYKPTPVYTKPTIPPPVYTPPVYKPTPSPPVYKKSPSYSSP---PPPYVPKPTY 173

Query: 359 PPVYKPPV 382
            P  KP V
Sbjct: 174 TPTTKPYV 181

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 56/108 (51%), Positives = 59/108 (54%), Gaps = 4/108 (3%)
 Frame = +2

Query: 98  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK--- 268
           Y P    PPVYK P  KP +   PV  PPVYKP +  PPVY  P   PPVY PPV K   
Sbjct: 25  YSP--SSPPVYKSPEHKPTL-PSPVYTPPVYKPTLS-PPVYTKPTIPPPVYTPPVYKHTP 80

Query: 269 -PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PPVY  P   PPVY PPV KP +       PPVY  P   PPVY PP
Sbjct: 81  SPPVYTKPTIPPPVYTPPVYKPTL------SPPVYTKPTIPPPVYTPP 122

[44][TOP]
>UniRef100_Q2TCK9 Foot protein 1 variant 2 n=1 Tax=Mytilus californianus
           RepID=Q2TCK9_MYTCA
          Length = 672

 Score =  138 bits (347), Expect = 2e-31
 Identities = 63/140 (45%), Positives = 69/140 (49%), Gaps = 5/140 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP +  PP Y P     P YKP    PP YK     P  YKP    PP YKP
Sbjct: 135 KITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKP 194

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
            +  PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK 
Sbjct: 195 KITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKA 254

Query: 347 PVEKPPVYKPPVEKPPVYKP 406
               PP YKP +  PP YKP
Sbjct: 255 KKTYPPTYKPKITYPPTYKP 274

 Score =  137 bits (345), Expect = 4e-31
 Identities = 63/139 (45%), Positives = 69/139 (49%), Gaps = 5/139 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP    PP Y      P  YKP    PP YKP +  PP YKP    PP YK 
Sbjct: 195 KITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKA 254

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
               PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP YKP
Sbjct: 255 KKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKP 314

Query: 347 PVEKPPVYKPPVEKPPVYK 403
            +  PP YKP    PP YK
Sbjct: 315 KITYPPTYKPKKSYPPAYK 333

 Score =  137 bits (344), Expect = 5e-31
 Identities = 63/136 (46%), Positives = 68/136 (50%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P     P YK     P  YKP    PP YKP +  PP YKP    
Sbjct: 189 PPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSY 248

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    
Sbjct: 249 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSY 308

Query: 359 PPVYKPPVEKPPVYKP 406
           PP YKP +  PP YKP
Sbjct: 309 PPSYKPKITYPPTYKP 324

 Score =  133 bits (334), Expect = 7e-30
 Identities = 62/146 (42%), Positives = 69/146 (47%), Gaps = 15/146 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT---------------PPIYKPPVEKPPVYKPPVEKPPVYKPPVEK 148
           PP+YKP  +K   Y                PP+YK  +  PP YKP +  PP YKP    
Sbjct: 99  PPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSY 158

Query: 149 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
           PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 159 PPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSY 218

Query: 329 PPVYKPPVEKPPVYKPPVEKPPVYKP 406
           P  YKP    PP YKP +  PP YKP
Sbjct: 219 PSTYKPKPSYPPTYKPKITYPPTYKP 244

 Score =  132 bits (331), Expect = 2e-29
 Identities = 63/146 (43%), Positives = 67/146 (45%), Gaps = 15/146 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT---------------PPIYKPPVEKPPVYKPPVEKPPVYKPPVEK 148
           PP YKP    PP Y                PP YKP +  PP YKP    PP YK     
Sbjct: 159 PPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSY 218

Query: 149 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
           P  YKP    PP YKP +  PP YKP    PP YK     PP YKP +  PP YKP    
Sbjct: 219 PSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSY 278

Query: 329 PPVYKPPVEKPPVYKPPVEKPPVYKP 406
           P  YK     PP YKP +  PP YKP
Sbjct: 279 PTSYKSKKTYPPTYKPKITYPPTYKP 304

 Score =  130 bits (327), Expect = 5e-29
 Identities = 61/139 (43%), Positives = 68/139 (48%), Gaps = 5/139 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP    PP Y      PP YKP +  PP YKP    P  YK     PP YKP
Sbjct: 235 KITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKP 294

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
            +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P     P YKP
Sbjct: 295 KITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKP 354

Query: 347 PVEKPPVYKPPVEKPPVYK 403
               PP YK  +  PP YK
Sbjct: 355 KKTYPPTYKRKISYPPTYK 373

 Score =  129 bits (325), Expect = 8e-29
 Identities = 61/133 (45%), Positives = 64/133 (48%), Gaps = 5/133 (3%)
 Frame = +2

Query: 20  VYKPPVEKPPEY-----TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VYK     PP Y      PP YKP +  PP YKP    PP YKP    PP YK     P 
Sbjct: 121 VYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPS 180

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            YKP    PP YKP +  PP YKP    PP YK     P  YKP    PP YKP +  PP
Sbjct: 181 TYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPP 240

Query: 365 VYKPPVEKPPVYK 403
            YKP    PP YK
Sbjct: 241 TYKPKPSYPPTYK 253

 Score =  129 bits (324), Expect = 1e-28
 Identities = 61/135 (45%), Positives = 66/135 (48%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P     P YK     PP YKP +  PP YKP    P  YK     
Sbjct: 229 PPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTY 288

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P    
Sbjct: 289 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTY 348

Query: 359 PPVYKPPVEKPPVYK 403
            P YKP    PP YK
Sbjct: 349 LPSYKPKKTYPPTYK 363

 Score =  127 bits (320), Expect = 3e-28
 Identities = 61/136 (44%), Positives = 65/136 (47%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           P  YKP    PP Y P     P YKP    PP YK     PP YKP +  PP YKP    
Sbjct: 219 PSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSY 278

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 279 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASY 338

Query: 359 PPVYKPPVEKPPVYKP 406
           PP Y+P     P YKP
Sbjct: 339 PPSYQPKKTYLPSYKP 354

 Score =  126 bits (317), Expect = 7e-28
 Identities = 60/135 (44%), Positives = 65/135 (48%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  P  Y      PP YK     PP YKP +  PP YKP    P  YK     
Sbjct: 399 PPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTY 458

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P    
Sbjct: 459 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTY 518

Query: 359 PPVYKPPVEKPPVYK 403
            P YKP    PP YK
Sbjct: 519 LPSYKPKKTYPPTYK 533

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/150 (39%), Positives = 66/150 (44%), Gaps = 15/150 (10%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT---------------PPIYKPPVEKPPVYKPPVEKPPVYKP 136
           ++  PP YK     P  Y                PP YKP +  P  YK     PP YK 
Sbjct: 365 KISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKA 424

Query: 137 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 316
               PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP YKP
Sbjct: 425 KKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKP 484

Query: 317 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
            +  PP YKP    PP YK     PP Y+P
Sbjct: 485 KITYPPTYKPKKSYPPAYKSKASYPPSYQP 514

 Score =  122 bits (307), Expect = 1e-26
 Identities = 58/136 (42%), Positives = 63/136 (46%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK  +  PP Y      P  YK     P  YK     PP YKP +  P  YK     
Sbjct: 359 PPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSY 418

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    
Sbjct: 419 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSY 478

Query: 359 PPVYKPPVEKPPVYKP 406
           PP YKP +  PP YKP
Sbjct: 479 PPSYKPKITYPPTYKP 494

 Score =  120 bits (302), Expect = 4e-26
 Identities = 58/140 (41%), Positives = 64/140 (45%), Gaps = 5/140 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP    P  Y      PP YKP +  PP YKP    PP YKP +  PP YKP
Sbjct: 265 KITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKP 324

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
               PP YK     PP Y+P     P YKP    PP YK  +  PP YK     P  YK 
Sbjct: 325 KKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKR 384

Query: 347 PVEKPPVYKPPVEKPPVYKP 406
               P  YK     PP YKP
Sbjct: 385 KTSYPSTYKRKTSYPPTYKP 404

 Score =  120 bits (302), Expect = 4e-26
 Identities = 58/140 (41%), Positives = 64/140 (45%), Gaps = 5/140 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP    P  Y      PP YKP +  PP YKP    PP YKP +  PP YKP
Sbjct: 435 KITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKP 494

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
               PP YK     PP Y+P     P YKP    PP YK  +  PP YK     P  YK 
Sbjct: 495 KKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKR 554

Query: 347 PVEKPPVYKPPVEKPPVYKP 406
               P  YK     PP YKP
Sbjct: 555 KTSYPSTYKRKTSYPPTYKP 574

 Score =  120 bits (300), Expect = 6e-26
 Identities = 56/136 (41%), Positives = 63/136 (46%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK  +  PP Y      P  YK     P  YK     PP YKP +  P  YK     
Sbjct: 529 PPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSY 588

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP       YKP +  PP YKP       YKP +  PP YKP +  PP YKP +  
Sbjct: 589 PPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITY 648

Query: 359 PPVYKPPVEKPPVYKP 406
           PP YKP +   P YKP
Sbjct: 649 PPSYKPKISYLPAYKP 664

 Score =  119 bits (298), Expect = 1e-25
 Identities = 59/135 (43%), Positives = 63/135 (46%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYK-----PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     PP  KP    PP YKP    P  YK     PP YKP +  PP YKP    
Sbjct: 419 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSY 478

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP +  PP YKP    PP YK     PP Y+P     P YKP    PP YK  +  
Sbjct: 479 PPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISY 538

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     P  YK
Sbjct: 539 PPTYKTKPSYPASYK 553

 Score =  119 bits (297), Expect = 1e-25
 Identities = 62/156 (39%), Positives = 68/156 (43%), Gaps = 25/156 (16%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P     P YKP +  PP YKP    PP YK     PP Y+P    
Sbjct: 289 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTY 348

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYK---------------PPVEK-----PPVYKPPVEK 298
            P YKP    PP YK  +  PP YK               P   K     PP YKP +  
Sbjct: 349 LPSYKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISY 408

Query: 299 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           P  YK     PP YK     PP YKP +  PP YKP
Sbjct: 409 PSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKP 444

 Score =  119 bits (297), Expect = 1e-25
 Identities = 57/136 (41%), Positives = 62/136 (45%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P     P YKP +  PP YKP    PP YK     PP Y+P    
Sbjct: 459 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTY 518

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
            P YKP    PP YK  +  PP YK     P  YK     P  YK     PP YKP +  
Sbjct: 519 LPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISY 578

Query: 359 PPVYKPPVEKPPVYKP 406
           P  YK     PP YKP
Sbjct: 579 PSTYKTKPSYPPTYKP 594

 Score =  117 bits (294), Expect = 3e-25
 Identities = 61/156 (39%), Positives = 67/156 (42%), Gaps = 25/156 (16%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYK--------------- 133
           PP YK     PP Y P     P YKP    PP YK  +  PP YK               
Sbjct: 499 PPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSY 558

Query: 134 PPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 298
           P   K     PP YKP +  P  YK     PP YKP       YKP +  PP YKP    
Sbjct: 559 PSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSY 618

Query: 299 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
              YKP +  PP YKP +  PP YKP +  PP YKP
Sbjct: 619 ASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKP 654

 Score =  117 bits (293), Expect = 4e-25
 Identities = 57/135 (42%), Positives = 62/135 (45%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP-----IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P       YK     PP YKP +  PP YKP    PP YKP +  
Sbjct: 259 PPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITY 318

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP    PP YK     PP Y+P     P YKP    PP YK  +  PP YK     
Sbjct: 319 PPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSY 378

Query: 359 PPVYKPPVEKPPVYK 403
           P  YK     P  YK
Sbjct: 379 PSSYKRKTSYPSTYK 393

 Score =  117 bits (293), Expect = 4e-25
 Identities = 57/135 (42%), Positives = 62/135 (45%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP-----IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P       YK     PP YKP +  PP YKP    PP YKP +  
Sbjct: 429 PPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITY 488

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP    PP YK     PP Y+P     P YKP    PP YK  +  PP YK     
Sbjct: 489 PPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSY 548

Query: 359 PPVYKPPVEKPPVYK 403
           P  YK     P  YK
Sbjct: 549 PASYKRKTSYPSTYK 563

 Score =  116 bits (291), Expect = 7e-25
 Identities = 54/138 (39%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YK     P  Y      P  YK     PP YKP +  P  YK     PP YKP
Sbjct: 535 KISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKP 594

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
                  YKP +  PP YKP       YKP +  PP YKP +  PP YKP +  PP YKP
Sbjct: 595 KPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKP 654

Query: 347 PVEKPPVYKPPVEKPPVY 400
            +   P YKP +  P  Y
Sbjct: 655 KISYLPAYKPKISYPSQY 672

 Score =  115 bits (289), Expect = 1e-24
 Identities = 56/131 (42%), Positives = 61/131 (46%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           P  YKP    P     P Y      PP+YKP  +K   YK       VYK     PPVYK
Sbjct: 74  PAPYKPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYK 133

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
             +  PP YKP +  PP YKP    PP YKP    PP YK     P  YKP    PP YK
Sbjct: 134 HKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYK 193

Query: 374 PPVEKPPVYKP 406
           P +  PP YKP
Sbjct: 194 PKITYPPTYKP 204

 Score =  115 bits (287), Expect = 2e-24
 Identities = 56/136 (41%), Positives = 62/136 (45%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKP-----PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP Y+P     P  KP +  PP YK  +  PP YK     P  YK     P  YK     
Sbjct: 339 PPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSY 398

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP +  P  YK     PP YK     PP YKP +  PP YKP    P  YK     
Sbjct: 399 PPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTY 458

Query: 359 PPVYKPPVEKPPVYKP 406
           PP YKP +  PP YKP
Sbjct: 459 PPTYKPKITYPPTYKP 474

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/135 (40%), Positives = 59/135 (43%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           P  YK     PP Y P     P YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 449 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASY 508

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP Y+P     P YKP    PP YK  +  PP YK     P  YK     P  YK     
Sbjct: 509 PPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSY 568

Query: 359 PPVYKPPVEKPPVYK 403
           PP YKP +  P  YK
Sbjct: 569 PPTYKPKISYPSTYK 583

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/140 (40%), Positives = 61/140 (43%), Gaps = 10/140 (7%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP---- 184
           PVYKP  + P  Y      P   KP  Y P     P Y      PP+YKP  +K      
Sbjct: 55  PVYKPMNKIPTSYISKKSYPAPYKPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKA 114

Query: 185 ------VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
                 VYK     PPVYK  +  PP YKP +  PP YKP    PP YKP    PP YK 
Sbjct: 115 IKTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKA 174

Query: 347 PVEKPPVYKPPVEKPPVYKP 406
               P  YKP    PP YKP
Sbjct: 175 KKTYPSTYKPKPSYPPTYKP 194

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 50/137 (36%), Positives = 55/137 (40%), Gaps = 10/137 (7%)
 Frame = +2

Query: 23  YKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPV 187
           YKP          P+YKP  + P  Y      P  YKP    P     P Y      PP+
Sbjct: 42  YKPLPGSYGSKHVPVYKPMNKIPTSYISKKSYPAPYKPKGYHPTNSYQPTYGSKTNYPPI 101

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPV 352
           YKP  +K   YK       VYK     PPVYK  +  PP YKP          P YKP  
Sbjct: 102 YKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKP-----KITYPPTYKPKP 156

Query: 353 EKPPVYKPPVEKPPVYK 403
             PP YKP    PP YK
Sbjct: 157 SYPPTYKPKPSYPPTYK 173

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 38/106 (35%), Positives = 43/106 (40%)
 Frame = +2

Query: 92  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 271
           PVYKP  + P  Y      P  YKP       Y P     P Y      PP+YKP  +K 
Sbjct: 55  PVYKPMNKIPTSYISKKSYPAPYKPKG-----YHPTNSYQPTYGSKTNYPPIYKPVAKKL 109

Query: 272 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
             YK       VYK     PPVYK  +  PP YKP      +  PP
Sbjct: 110 SSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKP-----KITYPP 150

[45][TOP]
>UniRef100_Q2TCL0 Foot protein 1 variant 1 n=1 Tax=Mytilus californianus
           RepID=Q2TCL0_MYTCA
          Length = 732

 Score =  137 bits (345), Expect = 4e-31
 Identities = 63/139 (45%), Positives = 69/139 (49%), Gaps = 5/139 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP    PP Y      P  YKP    PP YKP +  PP YKP    PP YK 
Sbjct: 255 KITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKA 314

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
               PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP YKP
Sbjct: 315 KKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKP 374

Query: 347 PVEKPPVYKPPVEKPPVYK 403
            +  PP YKP    PP YK
Sbjct: 375 KITYPPTYKPKKSYPPAYK 393

 Score =  137 bits (344), Expect = 5e-31
 Identities = 63/136 (46%), Positives = 68/136 (50%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P     P YK     P  YKP    PP YKP +  PP YKP    
Sbjct: 249 PPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSY 308

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    
Sbjct: 309 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSY 368

Query: 359 PPVYKPPVEKPPVYKP 406
           PP YKP +  PP YKP
Sbjct: 369 PPSYKPKITYPPTYKP 384

 Score =  133 bits (334), Expect = 7e-30
 Identities = 62/140 (44%), Positives = 67/140 (47%), Gaps = 5/140 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP    PP Y      P  YKP    PP YK     P  YKP    PP YKP
Sbjct: 195 KITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKP 254

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
            +  PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK 
Sbjct: 255 KITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKA 314

Query: 347 PVEKPPVYKPPVEKPPVYKP 406
               PP YKP +  PP YKP
Sbjct: 315 KKTYPPTYKPKITYPPTYKP 334

 Score =  131 bits (330), Expect = 2e-29
 Identities = 62/136 (45%), Positives = 66/136 (48%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYK-----PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     P   KP    PP YKP +  PP YKP    PP YK     P  YKP    
Sbjct: 229 PPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSY 288

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP +  PP YKP    PP YK     PP YKP +  PP YKP    P  YK     
Sbjct: 289 PPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTY 348

Query: 359 PPVYKPPVEKPPVYKP 406
           PP YKP +  PP YKP
Sbjct: 349 PPTYKPKITYPPTYKP 364

 Score =  130 bits (328), Expect = 3e-29
 Identities = 62/136 (45%), Positives = 65/136 (47%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PPVYK  +  PP Y P     P YKP    PP YKP    PP YK     P  YKP    
Sbjct: 129 PPVYKHKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSY 188

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP +  PP YKP    PP YK     P  YKP    PP YK     P  YKP    
Sbjct: 189 PPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKAKKTYPSTYKPKPSY 248

Query: 359 PPVYKPPVEKPPVYKP 406
           PP YKP +  PP YKP
Sbjct: 249 PPTYKPKITYPPTYKP 264

 Score =  130 bits (327), Expect = 5e-29
 Identities = 61/139 (43%), Positives = 68/139 (48%), Gaps = 5/139 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP    PP Y      PP YKP +  PP YKP    P  YK     PP YKP
Sbjct: 295 KITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKP 354

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
            +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P     P YKP
Sbjct: 355 KITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKP 414

Query: 347 PVEKPPVYKPPVEKPPVYK 403
               PP YK  +  PP YK
Sbjct: 415 KKTYPPTYKRKISYPPTYK 433

 Score =  130 bits (326), Expect = 6e-29
 Identities = 61/139 (43%), Positives = 66/139 (47%), Gaps = 5/139 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP +  PP Y P     P YKP    PP YK     P  YKP    PP YKP
Sbjct: 135 KITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKP 194

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
            +  PP YKP    PP YK     P  YKP    PP YK     P  YKP    PP YKP
Sbjct: 195 KITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKP 254

Query: 347 PVEKPPVYKPPVEKPPVYK 403
            +  PP YKP    PP YK
Sbjct: 255 KITYPPTYKPKPSYPPSYK 273

 Score =  129 bits (324), Expect = 1e-28
 Identities = 61/135 (45%), Positives = 66/135 (48%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P     P YK     PP YKP +  PP YKP    P  YK     
Sbjct: 289 PPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTY 348

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P    
Sbjct: 349 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTY 408

Query: 359 PPVYKPPVEKPPVYK 403
            P YKP    PP YK
Sbjct: 409 LPSYKPKKTYPPTYK 423

 Score =  127 bits (320), Expect = 3e-28
 Identities = 62/146 (42%), Positives = 65/146 (44%), Gaps = 15/146 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT---------------PPIYKPPVEKPPVYKPPVEKPPVYKPPVEK 148
           PP YKP    PP Y                PP YKP +  PP YKP    PP YK     
Sbjct: 159 PPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSY 218

Query: 149 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
           P  YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 219 PSTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSY 278

Query: 329 PPVYKPPVEKPPVYKPPVEKPPVYKP 406
           P  YKP    PP YKP +  PP YKP
Sbjct: 279 PSTYKPKPSYPPTYKPKITYPPTYKP 304

 Score =  127 bits (320), Expect = 3e-28
 Identities = 61/136 (44%), Positives = 65/136 (47%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           P  YKP    PP Y P     P YKP    PP YK     PP YKP +  PP YKP    
Sbjct: 279 PSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSY 338

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 339 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASY 398

Query: 359 PPVYKPPVEKPPVYKP 406
           PP Y+P     P YKP
Sbjct: 399 PPSYQPKKTYLPSYKP 414

 Score =  126 bits (317), Expect = 7e-28
 Identities = 60/135 (44%), Positives = 66/135 (48%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-----TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP+YKP  +K   Y     T  +YK     PPVYK  +  PP YKP +  PP YKP    
Sbjct: 99  PPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSY 158

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 159 PPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSY 218

Query: 359 PPVYKPPVEKPPVYK 403
           P  YKP    PP YK
Sbjct: 219 PSTYKPKPSYPPTYK 233

 Score =  126 bits (317), Expect = 7e-28
 Identities = 60/135 (44%), Positives = 65/135 (48%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  P  Y      PP YK     PP YKP +  PP YKP    P  YK     
Sbjct: 459 PPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTY 518

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P    
Sbjct: 519 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTY 578

Query: 359 PPVYKPPVEKPPVYK 403
            P YKP    PP YK
Sbjct: 579 LPSYKPKKTYPPTYK 593

 Score =  124 bits (311), Expect = 3e-27
 Identities = 60/135 (44%), Positives = 62/135 (45%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           P  YKP    PP Y      PP YKP    PP YK     P  YKP    PP YK     
Sbjct: 179 PSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKAKKTY 238

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           P  YKP    PP YKP +  PP YKP    PP YK     P  YKP    PP YKP +  
Sbjct: 239 PSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITY 298

Query: 359 PPVYKPPVEKPPVYK 403
           PP YKP    PP YK
Sbjct: 299 PPTYKPKPSYPPTYK 313

 Score =  123 bits (308), Expect = 7e-27
 Identities = 59/150 (39%), Positives = 66/150 (44%), Gaps = 15/150 (10%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT---------------PPIYKPPVEKPPVYKPPVEKPPVYKP 136
           ++  PP YK     P  Y                PP YKP +  P  YK     PP YK 
Sbjct: 425 KISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKA 484

Query: 137 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 316
               PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP YKP
Sbjct: 485 KKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKP 544

Query: 317 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
            +  PP YKP    PP YK     PP Y+P
Sbjct: 545 KITYPPTYKPKKSYPPAYKSKASYPPSYQP 574

 Score =  122 bits (307), Expect = 1e-26
 Identities = 58/136 (42%), Positives = 63/136 (46%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK  +  PP Y      P  YK     P  YK     PP YKP +  P  YK     
Sbjct: 419 PPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSY 478

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    
Sbjct: 479 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSY 538

Query: 359 PPVYKPPVEKPPVYKP 406
           PP YKP +  PP YKP
Sbjct: 539 PPSYKPKITYPPTYKP 554

 Score =  120 bits (302), Expect = 4e-26
 Identities = 58/140 (41%), Positives = 64/140 (45%), Gaps = 5/140 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP    P  Y      PP YKP +  PP YKP    PP YKP +  PP YKP
Sbjct: 325 KITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKP 384

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
               PP YK     PP Y+P     P YKP    PP YK  +  PP YK     P  YK 
Sbjct: 385 KKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKR 444

Query: 347 PVEKPPVYKPPVEKPPVYKP 406
               P  YK     PP YKP
Sbjct: 445 KTSYPSTYKRKTSYPPTYKP 464

 Score =  120 bits (302), Expect = 4e-26
 Identities = 58/140 (41%), Positives = 64/140 (45%), Gaps = 5/140 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YKP    P  Y      PP YKP +  PP YKP    PP YKP +  PP YKP
Sbjct: 495 KITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKP 554

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
               PP YK     PP Y+P     P YKP    PP YK  +  PP YK     P  YK 
Sbjct: 555 KKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKR 614

Query: 347 PVEKPPVYKPPVEKPPVYKP 406
               P  YK     PP YKP
Sbjct: 615 KTSYPSTYKRKTSYPPTYKP 634

 Score =  120 bits (300), Expect = 6e-26
 Identities = 56/136 (41%), Positives = 63/136 (46%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK  +  PP Y      P  YK     P  YK     PP YKP +  P  YK     
Sbjct: 589 PPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSY 648

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP       YKP +  PP YKP       YKP +  PP YKP +  PP YKP +  
Sbjct: 649 PPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITY 708

Query: 359 PPVYKPPVEKPPVYKP 406
           PP YKP +   P YKP
Sbjct: 709 PPSYKPKISYLPAYKP 724

 Score =  119 bits (298), Expect = 1e-25
 Identities = 59/135 (43%), Positives = 63/135 (46%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYK-----PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     PP  KP    PP YKP    P  YK     PP YKP +  PP YKP    
Sbjct: 479 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSY 538

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP +  PP YKP    PP YK     PP Y+P     P YKP    PP YK  +  
Sbjct: 539 PPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISY 598

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     P  YK
Sbjct: 599 PPTYKTKPSYPASYK 613

 Score =  119 bits (297), Expect = 1e-25
 Identities = 62/156 (39%), Positives = 68/156 (43%), Gaps = 25/156 (16%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P     P YKP +  PP YKP    PP YK     PP Y+P    
Sbjct: 349 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTY 408

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYK---------------PPVEK-----PPVYKPPVEK 298
            P YKP    PP YK  +  PP YK               P   K     PP YKP +  
Sbjct: 409 LPSYKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISY 468

Query: 299 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           P  YK     PP YK     PP YKP +  PP YKP
Sbjct: 469 PSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKP 504

 Score =  119 bits (297), Expect = 1e-25
 Identities = 57/136 (41%), Positives = 62/136 (45%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P     P YKP +  PP YKP    PP YK     PP Y+P    
Sbjct: 519 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTY 578

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
            P YKP    PP YK  +  PP YK     P  YK     P  YK     PP YKP +  
Sbjct: 579 LPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISY 638

Query: 359 PPVYKPPVEKPPVYKP 406
           P  YK     PP YKP
Sbjct: 639 PSTYKTKPSYPPTYKP 654

 Score =  118 bits (296), Expect = 2e-25
 Identities = 62/147 (42%), Positives = 66/147 (44%), Gaps = 15/147 (10%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYT-----PPIYKPPVEKPP----------VYKPPVEKPPVYKPPVE 145
           KP  Y P     P Y      PPIYKP  +K            VYK     PPVYK  + 
Sbjct: 78  KPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKIT 137

Query: 146 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 325
            PP YKP +  PP YKP    PP YKP    PP YK     P  YKP    PP YKP + 
Sbjct: 138 NPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKIT 197

Query: 326 KPPVYKPPVEKPPVYKPPVEKPPVYKP 406
            PP YKP    PP YK     P  YKP
Sbjct: 198 YPPTYKPKPSYPPSYKAKKSYPSTYKP 224

 Score =  117 bits (294), Expect = 3e-25
 Identities = 61/156 (39%), Positives = 67/156 (42%), Gaps = 25/156 (16%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYK--------------- 133
            PP YK     PP Y P     P YKP    PP YK  +  PP YK               
Sbjct: 559  PPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSY 618

Query: 134  PPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 298
            P   K     PP YKP +  P  YK     PP YKP       YKP +  PP YKP    
Sbjct: 619  PSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSY 678

Query: 299  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
               YKP +  PP YKP +  PP YKP +  PP YKP
Sbjct: 679  ASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKP 714

 Score =  117 bits (293), Expect = 4e-25
 Identities = 57/135 (42%), Positives = 62/135 (45%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP-----IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P       YK     PP YKP +  PP YKP    PP YKP +  
Sbjct: 319 PPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITY 378

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP    PP YK     PP Y+P     P YKP    PP YK  +  PP YK     
Sbjct: 379 PPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSY 438

Query: 359 PPVYKPPVEKPPVYK 403
           P  YK     P  YK
Sbjct: 439 PSSYKRKTSYPSTYK 453

 Score =  117 bits (293), Expect = 4e-25
 Identities = 57/135 (42%), Positives = 62/135 (45%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP-----IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P       YK     PP YKP +  PP YKP    PP YKP +  
Sbjct: 489 PPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITY 548

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP    PP YK     PP Y+P     P YKP    PP YK  +  PP YK     
Sbjct: 549 PPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSY 608

Query: 359 PPVYKPPVEKPPVYK 403
           P  YK     P  YK
Sbjct: 609 PASYKRKTSYPSTYK 623

 Score =  116 bits (291), Expect = 7e-25
 Identities = 54/138 (39%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = +2

Query: 2    RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
            ++  PP YK     P  Y      P  YK     PP YKP +  P  YK     PP YKP
Sbjct: 595  KISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKP 654

Query: 167  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
                   YKP +  PP YKP       YKP +  PP YKP +  PP YKP +  PP YKP
Sbjct: 655  KPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKP 714

Query: 347  PVEKPPVYKPPVEKPPVY 400
             +   P YKP +  P  Y
Sbjct: 715  KISYLPAYKPKISYPSQY 732

 Score =  115 bits (289), Expect = 1e-24
 Identities = 56/131 (42%), Positives = 61/131 (46%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           P  YKP    P     P Y      PP+YKP  +K   YK       VYK     PPVYK
Sbjct: 74  PAPYKPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYK 133

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
             +  PP YKP +  PP YKP    PP YKP    PP YK     P  YKP    PP YK
Sbjct: 134 HKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYK 193

Query: 374 PPVEKPPVYKP 406
           P +  PP YKP
Sbjct: 194 PKITYPPTYKP 204

 Score =  115 bits (287), Expect = 2e-24
 Identities = 56/136 (41%), Positives = 62/136 (45%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKP-----PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP Y+P     P  KP +  PP YK  +  PP YK     P  YK     P  YK     
Sbjct: 399 PPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSY 458

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP +  P  YK     PP YK     PP YKP +  PP YKP    P  YK     
Sbjct: 459 PPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTY 518

Query: 359 PPVYKPPVEKPPVYKP 406
           PP YKP +  PP YKP
Sbjct: 519 PPTYKPKITYPPTYKP 534

 Score =  110 bits (274), Expect = 6e-23
 Identities = 55/135 (40%), Positives = 59/135 (43%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           P  YK     PP Y P     P YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 509 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASY 568

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP Y+P     P YKP    PP YK  +  PP YK     P  YK     P  YK     
Sbjct: 569 PPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSY 628

Query: 359 PPVYKPPVEKPPVYK 403
           PP YKP +  P  YK
Sbjct: 629 PPTYKPKISYPSTYK 643

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/140 (40%), Positives = 61/140 (43%), Gaps = 10/140 (7%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP---- 184
           PVYKP  + P  Y      P   KP  Y P     P Y      PP+YKP  +K      
Sbjct: 55  PVYKPMNKIPTSYISKKSYPAPYKPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKA 114

Query: 185 ------VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
                 VYK     PPVYK  +  PP YKP +  PP YKP    PP YKP    PP YK 
Sbjct: 115 IKTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKA 174

Query: 347 PVEKPPVYKPPVEKPPVYKP 406
               P  YKP    PP YKP
Sbjct: 175 KKTYPSTYKPKPSYPPTYKP 194

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 50/137 (36%), Positives = 55/137 (40%), Gaps = 10/137 (7%)
 Frame = +2

Query: 23  YKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPV 187
           YKP          P+YKP  + P  Y      P  YKP    P     P Y      PP+
Sbjct: 42  YKPLPGSYGSKHVPVYKPMNKIPTSYISKKSYPAPYKPKGYHPTNSYQPTYGSKTNYPPI 101

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPV 352
           YKP  +K   YK       VYK     PPVYK  +  PP YKP          P YKP  
Sbjct: 102 YKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKP-----KITYPPTYKPKP 156

Query: 353 EKPPVYKPPVEKPPVYK 403
             PP YKP    PP YK
Sbjct: 157 SYPPTYKPKPSYPPTYK 173

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 38/106 (35%), Positives = 43/106 (40%)
 Frame = +2

Query: 92  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 271
           PVYKP  + P  Y      P  YKP       Y P     P Y      PP+YKP  +K 
Sbjct: 55  PVYKPMNKIPTSYISKKSYPAPYKPKG-----YHPTNSYQPTYGSKTNYPPIYKPVAKKL 109

Query: 272 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
             YK       VYK     PPVYK  +  PP YKP      +  PP
Sbjct: 110 SSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKP-----KITYPP 150

[46][TOP]
>UniRef100_Q9FUR7 ENOD2 (Fragment) n=1 Tax=Styphnolobium japonicum RepID=Q9FUR7_SOPJA
          Length = 269

 Score =  136 bits (343), Expect = 6e-31
 Identities = 82/165 (49%), Positives = 106/165 (64%), Gaps = 30/165 (18%)
 Frame = +2

Query: 5   VEKPPVYKPP-VEKPP--------EYTPPIYKPPVEK-PPVYKPPVEK--PPVYKPP--V 142
           V+ PPVY+PP  EKPP        E  PP+Y  P EK PP Y+PP  +  PP Y+PP  V
Sbjct: 4   VKPPPVYQPPHHEKPPPAYPPPHHEIPPPVYPSPHEKPPPEYQPPPHEKPPPEYQPPPHV 63

Query: 143 EKPPVYKPP--VEKPPVYKPP--VEKPPVYKPPVEK--PPVYKPP--VEKPPVYKPP--V 292
           + PP Y+PP  V+ PPVY+PP   + PP Y+PP  +  PP Y+PP  V+ PPVY PP   
Sbjct: 64  KPPPAYQPPPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHE 123

Query: 293 EKPPVYKPPVEK--PPVYKPP--VEKPPVYKPP--VEKPPVYKPP 409
           + PPV++PP  +  PP Y+PP  V+ PPVY+PP  V+ PPVY+PP
Sbjct: 124 KPPPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPP 168

 Score =  134 bits (338), Expect = 2e-30
 Identities = 78/158 (49%), Positives = 100/158 (63%), Gaps = 23/158 (14%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEK--PPVYKPP--VEKPPVYKPP--VEKPPVYKP 166
           V+ PPVY PP  + P   PP+++PP  +  PP Y+PP  V+ PPVY+PP  V+ PPVY+P
Sbjct: 111 VKPPPVYPPPHHEKP---PPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQP 167

Query: 167 PVEK---PPVYKPP--VEKPPVYKPPVEK--PPVYKPPVEK--PPVYKPPVEK--PPVYK 313
           P      PP Y+PP  V+ PPVY+PP  +  PPVY+PP  +  PPVY PP E   PP Y+
Sbjct: 168 PPHHEIPPPEYQPPHHVKPPPVYQPPPHEKPPPVYQPPHHEIPPPVYPPPRENKPPPEYQ 227

Query: 314 PP--VEKPPVYKPPVEK--PPVYKPP--VEKPPVYKPP 409
           PP  V+ PP Y+PP  +  PPVY PP   + PP Y PP
Sbjct: 228 PPPHVKPPPAYQPPPHEKPPPVYPPPHHEKPPPAYPPP 265

 Score =  111 bits (278), Expect = 2e-23
 Identities = 64/132 (48%), Positives = 80/132 (60%), Gaps = 13/132 (9%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEK---PPVYKPP--VEKPPVYKPPVEK--PPVYK 163
           V+ PPVY+PP    P   PP+Y+PP      PP Y+PP  V+ PPVY+PP  +  PPVY+
Sbjct: 147 VKPPPVYQPPPHVKP---PPVYQPPPHHEIPPPEYQPPHHVKPPPVYQPPPHEKPPPVYQ 203

Query: 164 PPVEK--PPVYKPPVEK--PPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 325
           PP  +  PPVY PP E   PP Y+PP  V+ PP Y+PP  + P   PPV  PP ++ P  
Sbjct: 204 PPHHEIPPPVYPPPRENKPPPEYQPPPHVKPPPAYQPPPHEKP---PPVYPPPHHEKP-- 258

Query: 326 KPPVYKPPVEKP 361
            PP Y PP EKP
Sbjct: 259 -PPAYPPPHEKP 269

[47][TOP]
>UniRef100_Q6PCS2 Zgc:64189 n=1 Tax=Danio rerio RepID=Q6PCS2_DANRE
          Length = 690

 Score =  135 bits (341), Expect = 1e-30
 Identities = 67/138 (48%), Positives = 81/138 (58%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 156 ERPPVSAPATERPPVSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAP 215

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 216 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 275

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 276 ERPPVSAPAPERPPVSAP 293

 Score =  135 bits (341), Expect = 1e-30
 Identities = 67/138 (48%), Positives = 81/138 (58%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 166 ERPPVSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 225

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 226 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 285

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 286 ERPPVSAPAPERPPVSAP 303

 Score =  135 bits (339), Expect = 2e-30
 Identities = 67/138 (48%), Positives = 81/138 (58%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 176 ERPPVSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 235

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 236 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 295

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 296 ERPPVSAPAPERPPVSAP 313

 Score =  134 bits (337), Expect = 3e-30
 Identities = 67/138 (48%), Positives = 81/138 (58%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 186 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 245

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 246 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 305

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 306 ERPPVSAPAPERPPVSAP 323

 Score =  134 bits (337), Expect = 3e-30
 Identities = 67/138 (48%), Positives = 81/138 (58%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 196 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 255

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 256 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 315

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 316 ERPPVSAPAPERPPVSAP 333

 Score =  134 bits (337), Expect = 3e-30
 Identities = 67/138 (48%), Positives = 81/138 (58%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 206 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 265

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 266 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 325

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 326 ERPPVSAPAPERPPVSAP 343

 Score =  134 bits (336), Expect = 4e-30
 Identities = 64/135 (47%), Positives = 78/135 (57%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           R + P   +PPV  P    PP+  P  E+PPV  P  E+PPV  P  E+PPV  P  E+P
Sbjct: 149 RRKAPAPERPPVSAPATERPPVSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERP 208

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+P
Sbjct: 209 PVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERP 268

Query: 362 PVYKPPVEKPPVYKP 406
           PV  P  E+PPV  P
Sbjct: 269 PVSAPAPERPPVSAP 283

 Score =  124 bits (311), Expect = 3e-27
 Identities = 62/133 (46%), Positives = 77/133 (57%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           E+PPV  P  E+     PP+  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 226 ERPPVSAPAPER-----PPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 280

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
             P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 281 SAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 340

Query: 368 YKPPVEKPPVYKP 406
             P  E+ P+  P
Sbjct: 341 SAPAPERSPMPVP 353

 Score =  109 bits (273), Expect = 8e-23
 Identities = 60/134 (44%), Positives = 75/134 (55%), Gaps = 5/134 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 236 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 295

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+ P+   PV
Sbjct: 296 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPM---PV 352

Query: 353 EKPPVYKPPVEKPP 394
              PV+   +  PP
Sbjct: 353 ---PVWLLALPAPP 363

 Score =  109 bits (272), Expect = 1e-22
 Identities = 59/145 (40%), Positives = 73/145 (50%), Gaps = 14/145 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEK---------PPVYKPPVEKPPVYKPPV-----EKP 151
           PPV  P  E+ P     +      +         P   +PPV  P   +PPV     E+P
Sbjct: 119 PPVSAPVPEQAPSPDDTVLTSQTTRRGRRRRRKAPAPERPPVSAPATERPPVSAPATERP 178

Query: 152 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
           PV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+P
Sbjct: 179 PVSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERP 238

Query: 332 PVYKPPVEKPPVYKPPVEKPPVYKP 406
           PV  P  E+PPV  P  E+PPV  P
Sbjct: 239 PVSAPAPERPPVSAPAPERPPVSAP 263

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/126 (40%), Positives = 64/126 (50%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           PV  PPV   P   PP+   PV+ PPV   PV+ PPV   PV+ PPV   P +  PV   
Sbjct: 489 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPA 548

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
           P +  PV   P +  PV   P + PPV   P + PPV   P + PPV   PV+ P   +P
Sbjct: 549 PAQLLPVPPAPAQLLPVPPAPAQLPPVPPVPAQLPPVPPAPAQLPPVPPAPVQLP--LQP 606

Query: 377 PVEKPP 394
            + KPP
Sbjct: 607 ALLKPP 612

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 50/124 (40%), Positives = 64/124 (51%), Gaps = 3/124 (2%)
 Frame = +2

Query: 47  PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 226
           P   PP+   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   P +  PV   
Sbjct: 489 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPA 548

Query: 227 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE---KPPV 397
           P +  PV   P +  PV   P + PPV   P + PPV   P + PPV   PV+   +P +
Sbjct: 549 PAQLLPVPPAPAQLLPVPPAPAQLPPVPPVPAQLPPVPPAPAQLPPVPPAPVQLPLQPAL 608

Query: 398 YKPP 409
            KPP
Sbjct: 609 LKPP 612

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/120 (39%), Positives = 59/120 (49%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V   PV  PPV   P   PP+   PV+ PPV   PV+ PPV   P +  PV   P +  P
Sbjct: 495 VPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPAPAQLLP 554

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   P +  PV   P + PPV   P + PPV   P + PPV   PV+ P   +P + KPP
Sbjct: 555 VPPAPAQLLPVPPAPAQLPPVPPVPAQLPPVPPAPAQLPPVPPAPVQLP--LQPALLKPP 612

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/114 (31%), Positives = 49/114 (42%)
 Frame = +1

Query: 70  QAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPSL 249
           +AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P +
Sbjct: 151 KAPAPERPPVSAPATERPPVSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERPPV 210

Query: 250 QTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
                E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 211 SAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 264

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 160 VSAPATERPPVSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 219

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 220 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 274

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 170 VSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 229

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 230 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 284

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 180 VSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 239

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 240 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 294

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 190 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 249

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 250 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 304

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 200 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 259

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 260 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 314

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 210 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 269

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 270 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 324

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 220 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 279

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 280 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 334

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 230 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 289

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 290 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 344

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 34/106 (32%), Positives = 45/106 (42%)
 Frame = +1

Query: 94  RLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPSLQTSGREAT 273
           R + P  +   V AP+ E   V  P+ E   V     E P V AP+ E P +     E  
Sbjct: 149 RRKAPAPERPPVSAPATERPPVSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERP 208

Query: 274 SVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
            V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 209 PVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 254

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 34/114 (29%), Positives = 46/114 (40%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 240 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 299

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAP 408
           +     E   V  P  E P +     E   V AP+ E P + AP  E   +  P
Sbjct: 300 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVP 353

[48][TOP]
>UniRef100_UPI0001AF2AEF putative secreted protein n=1 Tax=Streptomyces roseosporus NRRL
           11379 RepID=UPI0001AF2AEF
          Length = 227

 Score =  135 bits (340), Expect = 1e-30
 Identities = 58/118 (49%), Positives = 87/118 (73%)
 Frame = +2

Query: 47  PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 226
           P++  P  KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +P
Sbjct: 75  PKHEHPPVKPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEP 134

Query: 227 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 400
           PV++PPV +PPV++PPV +PPV++PPV +PP + P    P  + P    P    P  +
Sbjct: 135 PVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTPDAH 192

 Score =  134 bits (337), Expect = 3e-30
 Identities = 58/101 (57%), Positives = 83/101 (82%)
 Frame = +2

Query: 104 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 283
           P  E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 75  PKHEHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 133

Query: 284 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           PPV++PPV +PPV++PPV +PPV++PPV +PP + P    P
Sbjct: 134 PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTP 174

 Score =  130 bits (328), Expect = 3e-29
 Identities = 56/92 (60%), Positives = 80/92 (86%)
 Frame = +2

Query: 134 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 313
           P  E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 75  PKHEHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 133

Query: 314 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PPV++PPV +PPV++PPV +PPV++PPV +PP
Sbjct: 134 PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 165

 Score =  130 bits (326), Expect = 6e-29
 Identities = 53/100 (53%), Positives = 80/100 (80%)
 Frame = +2

Query: 32  PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 211
           P  + P   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++P
Sbjct: 75  PKHEHPPVKPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEP 134

Query: 212 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
           PV +PPV++PPV +PPV++PPV +PPV++PP   P  + P
Sbjct: 135 PVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTP 174

 Score =  129 bits (325), Expect = 8e-29
 Identities = 56/118 (47%), Positives = 84/118 (71%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P ++ P  KPP   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +P
Sbjct: 75  PKHEHPPVKPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEP 134

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           PV++PPV +PPV++PPV +PPV++PPV +PP + P    P  + P    P    P  +
Sbjct: 135 PVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTPDAH 192

 Score =  126 bits (316), Expect = 9e-28
 Identities = 54/110 (49%), Positives = 80/110 (72%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPPV +PPV++PP   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV 
Sbjct: 83  KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVD 142

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
           +PPV++PPV +PPV++PPV +PP + P    P  + P    P    P  +
Sbjct: 143 EPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTPDAH 192

 Score =  118 bits (296), Expect = 2e-25
 Identities = 48/89 (53%), Positives = 73/89 (82%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V++PPV +PPV++PP   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 86  VDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 145

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKP 271
           V +PPV++PPV +PPV++PP   P  + P
Sbjct: 146 VDEPPVDEPPVDEPPVDEPPTDTPGTDTP 174

 Score =  112 bits (281), Expect = 1e-23
 Identities = 48/102 (47%), Positives = 73/102 (71%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V++PPV +PPV++PP   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 91  VDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 150

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 310
           V +PPV++PPV +PP + P    P  + P    P    P  +
Sbjct: 151 VDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTPDAH 192

[49][TOP]
>UniRef100_UPI0001AECDFF putative secreted protein n=1 Tax=Streptomyces roseosporus NRRL
           15998 RepID=UPI0001AECDFF
          Length = 207

 Score =  135 bits (340), Expect = 1e-30
 Identities = 58/118 (49%), Positives = 87/118 (73%)
 Frame = +2

Query: 47  PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 226
           P++  P  KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +P
Sbjct: 75  PKHEHPPVKPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEP 134

Query: 227 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 400
           PV++PPV +PPV++PPV +PPV++PPV +PP + P    P  + P    P    P  +
Sbjct: 135 PVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTPDAH 192

 Score =  134 bits (337), Expect = 3e-30
 Identities = 58/101 (57%), Positives = 83/101 (82%)
 Frame = +2

Query: 104 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 283
           P  E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 75  PKHEHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 133

Query: 284 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           PPV++PPV +PPV++PPV +PPV++PPV +PP + P    P
Sbjct: 134 PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTP 174

 Score =  130 bits (328), Expect = 3e-29
 Identities = 56/92 (60%), Positives = 80/92 (86%)
 Frame = +2

Query: 134 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 313
           P  E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 75  PKHEHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 133

Query: 314 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PPV++PPV +PPV++PPV +PPV++PPV +PP
Sbjct: 134 PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 165

 Score =  130 bits (326), Expect = 6e-29
 Identities = 53/100 (53%), Positives = 80/100 (80%)
 Frame = +2

Query: 32  PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 211
           P  + P   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++P
Sbjct: 75  PKHEHPPVKPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEP 134

Query: 212 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
           PV +PPV++PPV +PPV++PPV +PPV++PP   P  + P
Sbjct: 135 PVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTP 174

 Score =  129 bits (325), Expect = 8e-29
 Identities = 56/118 (47%), Positives = 84/118 (71%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P ++ P  KPP   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +P
Sbjct: 75  PKHEHPPVKPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEP 134

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           PV++PPV +PPV++PPV +PPV++PPV +PP + P    P  + P    P    P  +
Sbjct: 135 PVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTPDAH 192

 Score =  126 bits (316), Expect = 9e-28
 Identities = 54/110 (49%), Positives = 80/110 (72%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPPV +PPV++PP   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV 
Sbjct: 83  KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVD 142

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
           +PPV++PPV +PPV++PPV +PP + P    P  + P    P    P  +
Sbjct: 143 EPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTPDAH 192

 Score =  118 bits (296), Expect = 2e-25
 Identities = 48/89 (53%), Positives = 73/89 (82%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V++PPV +PPV++PP   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 86  VDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 145

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKP 271
           V +PPV++PPV +PPV++PP   P  + P
Sbjct: 146 VDEPPVDEPPVDEPPVDEPPTDTPGTDTP 174

 Score =  112 bits (281), Expect = 1e-23
 Identities = 48/102 (47%), Positives = 73/102 (71%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V++PPV +PPV++PP   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 91  VDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 150

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 310
           V +PPV++PPV +PP + P    P  + P    P    P  +
Sbjct: 151 VDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTPDAH 192

[50][TOP]
>UniRef100_Q9M7P1 Proline-rich protein 1 n=1 Tax=Arabidopsis thaliana
           RepID=Q9M7P1_ARATH
          Length = 335

 Score =  135 bits (340), Expect = 1e-30
 Identities = 73/139 (52%), Positives = 80/139 (57%), Gaps = 8/139 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKP----PEYTPPIYKPPVEKPPVYKPPVEK----PPVYKPPVEKPPVYKPP 169
           PPVY  PV KP    P YTPP++KP +  PPVY PPV K    PPVY  P   PP Y PP
Sbjct: 30  PPVYTSPVNKPTLPPPVYTPPVHKPTLP-PPVYTPPVHKPTLSPPVYTKPTLPPPAYTPP 88

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           V   P    PV  PPVYKP +  PPVY  P   PPV+KP +  PPVY  P   P VYKP 
Sbjct: 89  VYNKPTLPAPVYTPPVYKPTL-SPPVYTKPTLLPPVFKPTL-SPPVYTKPTLSPTVYKPT 146

Query: 350 VEKPPVYKPPVEKPPVYKP 406
           +  PPV   P   PPVYKP
Sbjct: 147 L-SPPVNNKPSLSPPVYKP 164

 Score =  131 bits (330), Expect = 2e-29
 Identities = 72/143 (50%), Positives = 79/143 (55%), Gaps = 13/143 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKP----PEYTPPIYKP---------PVEKPPVYKPPVEKPPVYKPPVEKPP 154
           PPVY PPV KP    P YTPP++KP         P   PP Y PPV   P    PV  PP
Sbjct: 44  PPVYTPPVHKPTLPPPVYTPPVHKPTLSPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPP 103

Query: 155 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
           VYKP +  PPVY  P   PPV+KP +  PPVY  P   P VYKP +  PPV   P   PP
Sbjct: 104 VYKPTL-SPPVYTKPTLLPPVFKPTL-SPPVYTKPTLSPTVYKPTL-SPPVNNKPSLSPP 160

Query: 335 VYKPPVEKPPVYKPPVEKPPVYK 403
           VYKP +  PPVY  P   PPVYK
Sbjct: 161 VYKPTL-SPPVYTKPTLPPPVYK 182

 Score =  126 bits (316), Expect = 9e-28
 Identities = 70/139 (50%), Positives = 77/139 (55%), Gaps = 4/139 (2%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPPV 172
           V  PPV+KP +  PP YT P   PP   PPVY  P    PVY PPV K    PPVY  P 
Sbjct: 60  VYTPPVHKPTL-SPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVYKPTLSPPVYTKPT 118

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
             PPV+KP +  PPVY  P   P VYKP +  PPV   P   PPVYKP +  PPVY  P 
Sbjct: 119 LLPPVFKPTL-SPPVYTKPTLSPTVYKPTL-SPPVNNKPSLSPPVYKPTL-SPPVYTKPT 175

Query: 353 EKPPVYKPPVEKPPVYKPP 409
             PPVYK    K P+Y PP
Sbjct: 176 LPPPVYK----KSPIYSPP 190

 Score =  120 bits (302), Expect = 4e-26
 Identities = 68/145 (46%), Positives = 73/145 (50%), Gaps = 13/145 (8%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKP 181
           PPVY  P   PP YTPP+Y  P    PVY PPV KP    PVY  P   PPV+KP +  P
Sbjct: 72  PPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVYKPTLSPPVYTKPTLLPPVFKPTLS-P 130

Query: 182 PVYKPPVEKPPVYKP---------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
           PVY  P   P VYKP         P   PPVYKP +  PPVY  P   PPVYK    K P
Sbjct: 131 PVYTKPTLSPTVYKPTLSPPVNNKPSLSPPVYKPTLS-PPVYTKPTLPPPVYK----KSP 185

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKPP 409
           +Y PP        PP    P Y PP
Sbjct: 186 IYSPP--------PPFAPKPTYTPP 202

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 41/77 (53%), Positives = 45/77 (58%)
 Frame = +2

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PPVY  PV KP +  PPV  PPV+KP +  PPVY PPV KP +  PPV   P   PP   
Sbjct: 30  PPVYTSPVNKPTL-PPPVYTPPVHKPTLP-PPVYTPPVHKPTL-SPPVYTKPTLPPPAYT 86

Query: 359 PPVYKPPVEKPPVYKPP 409
           PPVY  P    PVY PP
Sbjct: 87  PPVYNKPTLPAPVYTPP 103

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 55/126 (43%), Positives = 59/126 (46%), Gaps = 18/126 (14%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKP----PVYKPPVEKPPVYKP---------PVE 145
           V  PPVYKP +  PP YT P   PPV KP    PVY  P   P VYKP         P  
Sbjct: 99  VYTPPVYKPTLS-PPVYTKPTLLPPVFKPTLSPPVYTKPTLSPTVYKPTLSPPVNNKPSL 157

Query: 146 KPPVYKP----PVEKPPVYKPPV-EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 310
            PPVYKP    PV   P   PPV +K P+Y PP        PP    P Y PP  KP  Y
Sbjct: 158 SPPVYKPTLSPPVYTKPTLPPPVYKKSPIYSPP--------PPFAPKPTYTPPT-KP--Y 206

Query: 311 KPPVEK 328
            P + K
Sbjct: 207 VPEIIK 212

[51][TOP]
>UniRef100_Q9FZ35 Proline-rich protein 1 n=1 Tax=Arabidopsis thaliana
           RepID=Q9FZ35_ARATH
          Length = 335

 Score =  135 bits (340), Expect = 1e-30
 Identities = 73/139 (52%), Positives = 80/139 (57%), Gaps = 8/139 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKP----PEYTPPIYKPPVEKPPVYKPPVEK----PPVYKPPVEKPPVYKPP 169
           PPVY  PV KP    P YTPP++KP +  PPVY PPV K    PPVY  P   PP Y PP
Sbjct: 30  PPVYTSPVNKPTLPPPVYTPPVHKPTLP-PPVYTPPVHKPTLSPPVYTKPTLPPPAYTPP 88

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           V   P    PV  PPVYKP +  PPVY  P   PPV+KP +  PPVY  P   P VYKP 
Sbjct: 89  VYNKPTLPAPVYTPPVYKPTL-SPPVYTKPTLLPPVFKPTL-SPPVYTKPTLSPTVYKPT 146

Query: 350 VEKPPVYKPPVEKPPVYKP 406
           +  PPV   P   PPVYKP
Sbjct: 147 L-SPPVNNKPSLSPPVYKP 164

 Score =  131 bits (330), Expect = 2e-29
 Identities = 72/143 (50%), Positives = 79/143 (55%), Gaps = 13/143 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKP----PEYTPPIYKP---------PVEKPPVYKPPVEKPPVYKPPVEKPP 154
           PPVY PPV KP    P YTPP++KP         P   PP Y PPV   P    PV  PP
Sbjct: 44  PPVYTPPVHKPTLPPPVYTPPVHKPTLSPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPP 103

Query: 155 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
           VYKP +  PPVY  P   PPV+KP +  PPVY  P   P VYKP +  PPV   P   PP
Sbjct: 104 VYKPTL-SPPVYTKPTLLPPVFKPTL-SPPVYTKPTLSPTVYKPTL-SPPVNNKPSLSPP 160

Query: 335 VYKPPVEKPPVYKPPVEKPPVYK 403
           VYKP +  PPVY  P   PPVYK
Sbjct: 161 VYKPTL-SPPVYTKPTLPPPVYK 182

 Score =  125 bits (314), Expect = 1e-27
 Identities = 71/147 (48%), Positives = 77/147 (52%), Gaps = 12/147 (8%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPPV 172
           V  PPV+KP +  PP YT P   PP   PPVY  P    PVY PPV K    PPVY  P 
Sbjct: 60  VYTPPVHKPTL-SPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVYKPTLSPPVYTKPT 118

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
             PPV+KP +  PPVY  P   P VYKP +  PPV   P   PPVYKP +  PPVY  P 
Sbjct: 119 LLPPVFKPTL-SPPVYTKPTLSPTVYKPTL-SPPVNNKPSLSPPVYKPTL-SPPVYTKPT 175

Query: 353 EKPPVYK--------PPVEKPPVYKPP 409
             PPVYK        PP    P Y PP
Sbjct: 176 LPPPVYKKSPSYSPPPPFAPKPTYTPP 202

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 41/77 (53%), Positives = 45/77 (58%)
 Frame = +2

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PPVY  PV KP +  PPV  PPV+KP +  PPVY PPV KP +  PPV   P   PP   
Sbjct: 30  PPVYTSPVNKPTL-PPPVYTPPVHKPTLP-PPVYTPPVHKPTL-SPPVYTKPTLPPPAYT 86

Query: 359 PPVYKPPVEKPPVYKPP 409
           PPVY  P    PVY PP
Sbjct: 87  PPVYNKPTLPAPVYTPP 103

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 56/136 (41%), Positives = 59/136 (43%), Gaps = 18/136 (13%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKP----PVYKPPVEKPPVYKP------------ 136
           V  PPVYKP +  PP YT P   PPV KP    PVY  P   P VYKP            
Sbjct: 99  VYTPPVYKPTLS-PPVYTKPTLLPPVFKPTLSPPVYTKPTLSPTVYKPTLSPPVNNKPSL 157

Query: 137 --PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 310
             PV KP +       PPVY  P   PPVYK    K P Y PP        PP    P Y
Sbjct: 158 SPPVYKPTL------SPPVYTKPTLPPPVYK----KSPSYSPP--------PPFAPKPTY 199

Query: 311 KPPVEKPPVYKPPVEK 358
            PP  KP  Y P + K
Sbjct: 200 TPPT-KP--YVPEIIK 212

[52][TOP]
>UniRef100_Q5XGC9 Serum response factor-binding protein 1 n=1 Tax=Xenopus (Silurana)
           tropicalis RepID=SRFB1_XENTR
          Length = 535

 Score =  135 bits (339), Expect = 2e-30
 Identities = 63/128 (49%), Positives = 87/128 (67%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+P V +P VE+P    P + +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 216 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 275

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V  P VE+PP
Sbjct: 276 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPP 335

Query: 365 VYKPPVEK 388
           V  PP +K
Sbjct: 336 VESPPKKK 343

 Score =  134 bits (336), Expect = 4e-30
 Identities = 63/128 (49%), Positives = 86/128 (67%)
 Frame = +2

Query: 20  VYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 199
           V +P VE+P    P + +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P 
Sbjct: 216 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 275

Query: 200 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 379
           VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE P V +PP
Sbjct: 276 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPP 335

Query: 380 VEKPPVYK 403
           VE PP  K
Sbjct: 336 VESPPKKK 343

 Score =  133 bits (335), Expect = 5e-30
 Identities = 62/125 (49%), Positives = 85/125 (68%)
 Frame = +2

Query: 35  VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 214
           VE+P    P + +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 216 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 275

Query: 215 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 394
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V  P VE+PP
Sbjct: 276 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPP 335

Query: 395 VYKPP 409
           V  PP
Sbjct: 336 VESPP 340

 Score =  131 bits (329), Expect = 3e-29
 Identities = 62/128 (48%), Positives = 86/128 (67%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+P V +P VE+P    P + +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 221 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 280

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE P V +PPVE PP
Sbjct: 281 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPP 340

Query: 365 VYKPPVEK 388
             K  +E+
Sbjct: 341 KKKACLEQ 348

 Score =  120 bits (301), Expect = 5e-26
 Identities = 60/127 (47%), Positives = 83/127 (65%), Gaps = 4/127 (3%)
 Frame = +2

Query: 38  EKPPEYTPPIYKPP----VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 205
           E  PE T    + P    VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE
Sbjct: 198 ENLPEQTAENKEQPKAQDVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVE 257

Query: 206 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 385
           +P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE
Sbjct: 258 RPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVE 317

Query: 386 KPPVYKP 406
           +P V +P
Sbjct: 318 RPAVERP 324

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 47/109 (43%), Positives = 68/109 (62%)
 Frame = +2

Query: 80  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 259
           +E P V +   E+    K   +   V +P VE+P V +P VE+P V +P VE+P V +P 
Sbjct: 191 LELPYVQENLPEQTAENKEQPKAQDVERPAVERPAVERPAVERPAVERPAVERPAVERPA 250

Query: 260 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P
Sbjct: 251 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERP 299

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 34/128 (26%), Positives = 67/128 (52%)
 Frame = +1

Query: 10  EASSVQTSC*ETP*VYSSYLQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSV 189
           +A  V+    E P V    ++ P+ E   ++ P  +   V+ P+ E  +V+ P+ E  +V
Sbjct: 212 KAQDVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAV 271

Query: 190 QTSC*ETPSVQAPS*EAPSLQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSL 369
           +    E P+V+ P+ E P+++    E  +V+ P  E P+++    E  +V+ P  E+P++
Sbjct: 272 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAV 331

Query: 370 QAPGREAP 393
           + P  E+P
Sbjct: 332 ERPPVESP 339

[53][TOP]
>UniRef100_Q9M7N9 Proline-rich protein 3 n=1 Tax=Arabidopsis thaliana
           RepID=Q9M7N9_ARATH
          Length = 313

 Score =  134 bits (338), Expect = 2e-30
 Identities = 75/141 (53%), Positives = 79/141 (56%), Gaps = 9/141 (6%)
 Frame = +2

Query: 14  PPVYKPPVEKP----PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPP 169
           PPVYK P  KP    P YTPP+YKP +  PPVY  P   PPVY PPV K    PPVY  P
Sbjct: 30  PPVYKSPEHKPTLPSPVYTPPVYKPTLS-PPVYTKPTIPPPVYTPPVYKHTPSPPVYTKP 88

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKP 346
              PPVY P     PVYKP +  PPVY  P   PPVY PPV KP P Y  P   PPVY P
Sbjct: 89  TIPPPVYTP-----PVYKPTL-SPPVYTKPTIPPPVYTPPVYKPTPDYTKPTIPPPVYTP 142

Query: 347 PVEKPPVYKPPVEKPPVYKPP 409
           PV KP    P  +K P Y  P
Sbjct: 143 PVYKPTPSPPVYKKSPSYSSP 163

 Score =  125 bits (313), Expect = 2e-27
 Identities = 71/139 (51%), Positives = 74/139 (53%), Gaps = 5/139 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYKPPV 172
           V  PPVYKP +  PP YT P   PPV  PPVYK    PPV   P   PPV  PPVYKP +
Sbjct: 46  VYTPPVYKPTL-SPPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTL 104

Query: 173 EKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
             PPVY  P   PPVY PPV KP P Y  P   PPVY PPV KP    P  +K P Y  P
Sbjct: 105 -SPPVYTKPTIPPPVYTPPVYKPTPDYTKPTIPPPVYTPPVYKPTPSPPVYKKSPSYSSP 163

Query: 350 VEKPPVYKPPVEKPPVYKP 406
              PP Y P     P  KP
Sbjct: 164 ---PPPYVPKPTYTPTTKP 179

 Score =  118 bits (295), Expect = 2e-25
 Identities = 65/128 (50%), Positives = 68/128 (53%), Gaps = 5/128 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYK----PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           PPVY  P   PP YTPP+YK    PPV   P   PPV  PPVYKP +  PPVY  P   P
Sbjct: 58  PPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTL-SPPVYTKPTIPP 116

Query: 182 PVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PVY PPV KP P Y  P   PPVY PPV KP    P  +K P Y  P   PP Y P    
Sbjct: 117 PVYTPPVYKPTPDYTKPTIPPPVYTPPVYKPTPSPPVYKKSPSYSSP---PPPYVPKPTY 173

Query: 359 PPVYKPPV 382
            P  KP V
Sbjct: 174 TPTTKPYV 181

[54][TOP]
>UniRef100_UPI00017611C2 PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI00017611C2
          Length = 653

 Score =  134 bits (337), Expect = 3e-30
 Identities = 67/138 (48%), Positives = 81/138 (58%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 159 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 218

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 219 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 278

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 279 ERPPVSAPAPERPPVSAP 296

 Score =  134 bits (337), Expect = 3e-30
 Identities = 67/138 (48%), Positives = 81/138 (58%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 169 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 228

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 229 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 288

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 289 ERPPVSAPAPERPPVSAP 306

 Score =  134 bits (337), Expect = 3e-30
 Identities = 67/138 (48%), Positives = 81/138 (58%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 179 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 238

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 239 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 298

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 299 ERPPVSAPAPERPPVSAP 316

 Score =  134 bits (337), Expect = 3e-30
 Identities = 67/138 (48%), Positives = 81/138 (58%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 189 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 248

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 249 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 308

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 309 ERPPVSAPAPERPPVSAP 326

 Score =  133 bits (334), Expect = 7e-30
 Identities = 67/138 (48%), Positives = 80/138 (57%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 139 ERPPVSAPAPEHPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 198

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 199 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 258

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 259 ERPPVSAPAPERPPVSAP 276

 Score =  133 bits (334), Expect = 7e-30
 Identities = 67/138 (48%), Positives = 80/138 (57%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 149 EHPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 208

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 209 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 268

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 269 ERPPVSAPAPERPPVSAP 286

 Score =  124 bits (311), Expect = 3e-27
 Identities = 62/133 (46%), Positives = 77/133 (57%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           E+PPV  P  E+     PP+  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 209 ERPPVSAPAPER-----PPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 263

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
             P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 264 SAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 323

Query: 368 YKPPVEKPPVYKP 406
             P  E+ P+  P
Sbjct: 324 SAPAPERSPMPVP 336

 Score =  109 bits (273), Expect = 8e-23
 Identities = 60/134 (44%), Positives = 75/134 (55%), Gaps = 5/134 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 219 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 278

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+ P+   PV
Sbjct: 279 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPM---PV 335

Query: 353 EKPPVYKPPVEKPP 394
              PV+   +  PP
Sbjct: 336 ---PVWLLALPAPP 346

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 60/163 (36%), Positives = 73/163 (44%), Gaps = 34/163 (20%)
 Frame = +2

Query: 20  VYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPV------------------- 127
           V +PP  +P E        P+  P  E PPV  P  E+ P                    
Sbjct: 74  VRRPPFSEPLESLLELCGTPVSAPAPECPPVSAPAPEQDPSPDHNTLPSQTTRRRRHRKR 133

Query: 128 -----YKPPVEKPPVYKPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPV 277
                 +PPV  P    PPV  P   +PPV     E+PPV  P  E+PPV  P  E+PPV
Sbjct: 134 TAHVPERPPVSAPAPEHPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 193

Query: 278 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
             P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 194 SAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 236

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 49/114 (42%), Positives = 62/114 (54%), Gaps = 3/114 (2%)
 Frame = +2

Query: 77  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 256
           PV+ PPV   PV+ P V   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   
Sbjct: 463 PVQLPPVPPAPVQLP-VPPDPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPA 521

Query: 257 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE---KPPVYKPP 409
           P +  PV   P +  PV   P + PPV   P + PPV   PV+   +P + KPP
Sbjct: 522 PAQLLPVPPAPAQLLPVPPAPAQLPPVPPAPAQLPPVPPAPVQLPLQPALLKPP 575

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 50/120 (41%), Positives = 63/120 (52%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V+ PPV   PV+ P    PP    PV+ PPV   PV+ PPV   PV+ PPV   PV+ PP
Sbjct: 464 VQLPPVPPAPVQLP---VPP---DPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPP 517

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   P +  PV   P +  PV   P + PPV   P + PPV   PV+ P   +P + KPP
Sbjct: 518 VPPAPAQLLPVPPAPAQLLPVPPAPAQLPPVPPAPAQLPPVPPAPVQLP--LQPALLKPP 575

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 153 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 212

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 213 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 267

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 163 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 222

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 223 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 277

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 173 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 232

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 233 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 287

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 183 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 242

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 243 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 297

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 193 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 252

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 253 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 307

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 203 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 262

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 263 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 317

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 213 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 272

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 273 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 327

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 143 VSAPAPEHPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 202

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 203 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 257

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 34/109 (31%), Positives = 45/109 (41%)
 Frame = +1

Query: 85  ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPSLQTSGR 264
           E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P +     
Sbjct: 139 ERPPVSAPAPEHPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 198

Query: 265 EATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 199 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 247

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 34/114 (29%), Positives = 46/114 (40%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 223 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 282

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAP 408
           +     E   V  P  E P +     E   V AP+ E P + AP  E   +  P
Sbjct: 283 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVP 336

[55][TOP]
>UniRef100_UPI000175F23A PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI000175F23A
          Length = 661

 Score =  134 bits (337), Expect = 3e-30
 Identities = 67/138 (48%), Positives = 81/138 (58%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 193 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 252

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 253 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 312

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 313 ERPPVSAPAPERPPVSAP 330

 Score =  124 bits (311), Expect = 3e-27
 Identities = 62/133 (46%), Positives = 77/133 (57%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           E+PPV  P  E+     PP+  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 213 ERPPVSAPAPER-----PPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 267

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
             P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 268 SAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 327

Query: 368 YKPPVEKPPVYKP 406
             P  E+ P+  P
Sbjct: 328 SAPAPERSPMPVP 340

 Score =  109 bits (273), Expect = 8e-23
 Identities = 60/134 (44%), Positives = 75/134 (55%), Gaps = 5/134 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 223 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 282

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+ P+   PV
Sbjct: 283 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPM---PV 339

Query: 353 EKPPVYKPPVEKPP 394
              PV+   +  PP
Sbjct: 340 ---PVWLLALPAPP 350

 Score =  101 bits (252), Expect = 2e-20
 Identities = 55/129 (42%), Positives = 69/129 (53%), Gaps = 3/129 (2%)
 Frame = +2

Query: 32  PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 211
           PV+ PP   PP+   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ P
Sbjct: 457 PVQLPP--LPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLP 514

Query: 212 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-- 385
           PV   P +  PV   P + PP    P + PPV   P + PPV   P + PPV   PV+  
Sbjct: 515 PVPPAPAQLLPVPPAPAQLPPASPVPAQLPPVPPAPAQLPPVPPAPAQLPPVPPAPVQLP 574

Query: 386 -KPPVYKPP 409
            +P   KPP
Sbjct: 575 LQPAFLKPP 583

 Score =  100 bits (248), Expect = 7e-20
 Identities = 61/163 (37%), Positives = 75/163 (46%), Gaps = 34/163 (20%)
 Frame = +2

Query: 20  VYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPV------------------- 127
           V +PP  +P E        P+  P  E PPV  P  E+ P                    
Sbjct: 128 VRRPPFSEPLESLLELCGTPVSAPAPECPPVSAPAPEQDPSPDDNTLPSQTTRRRRHRKR 187

Query: 128 -----YKPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 277
                 +PPV  P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 188 TAHVPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 247

Query: 278 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
             P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 248 SAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 290

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/130 (41%), Positives = 68/130 (52%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V+ PP+  PPV   P   PP+   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PP
Sbjct: 458 VQLPPL--PPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPP 515

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   P +  PV   P + PP    P + PPV   P + PPV   P + PPV   PV+ P 
Sbjct: 516 VPPAPAQLLPVPPAPAQLPPASPVPAQLPPVPPAPAQLPPVPPAPAQLPPVPPAPVQLP- 574

Query: 365 VYKPPVEKPP 394
             +P   KPP
Sbjct: 575 -LQPAFLKPP 583

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 197 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 256

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 257 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 311

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 207 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 266

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 267 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 321

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 217 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 276

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 277 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 331

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 34/109 (31%), Positives = 45/109 (41%)
 Frame = +1

Query: 85  ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPSLQTSGR 264
           E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P +     
Sbjct: 193 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 252

Query: 265 EATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 253 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 301

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 34/114 (29%), Positives = 46/114 (40%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 227 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 286

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAP 408
           +     E   V  P  E P +     E   V AP+ E P + AP  E   +  P
Sbjct: 287 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVP 340

[56][TOP]
>UniRef100_UPI0000F1E1DC PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI0000F1E1DC
          Length = 665

 Score =  134 bits (337), Expect = 3e-30
 Identities = 67/138 (48%), Positives = 81/138 (58%), Gaps = 5/138 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 193 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 252

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 253 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 312

Query: 353 EKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P
Sbjct: 313 ERPPVSAPAPERPPVSAP 330

 Score =  125 bits (313), Expect = 2e-27
 Identities = 63/131 (48%), Positives = 76/131 (58%), Gaps = 5/131 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 203 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 262

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 263 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 322

Query: 353 EKPPVYKPPVE 385
           E+PPV  P  E
Sbjct: 323 ERPPVSAPAPE 333

 Score =  124 bits (310), Expect = 4e-27
 Identities = 64/131 (48%), Positives = 76/131 (58%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           PV  PPV   P   PP+   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   
Sbjct: 439 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPA 498

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
           PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   
Sbjct: 499 PVQLPPVPPAPVQLPPVTPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPA 558

Query: 377 PVEKPPVYKPP 409
           PV+ PPV   P
Sbjct: 559 PVQLPPVPPAP 569

 Score =  122 bits (305), Expect = 2e-26
 Identities = 65/138 (47%), Positives = 79/138 (57%), Gaps = 3/138 (2%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V   PV  PPV   P   PP+   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PP
Sbjct: 445 VPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPAPVQLPP 504

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PP
Sbjct: 505 VPPAPVQLPPVTPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPP 564

Query: 365 VYKPPVE---KPPVYKPP 409
           V   PV+   +P + KPP
Sbjct: 565 VPPAPVQLHLQPALLKPP 582

 Score =  108 bits (269), Expect = 2e-22
 Identities = 64/173 (36%), Positives = 79/173 (45%), Gaps = 39/173 (22%)
 Frame = +2

Query: 5   VEKPPVYKP----------PVEKPPEYTPPIYKPPVEKPPV------------------- 97
           V +PP  +P          PV  P    PP+  P  E+ P                    
Sbjct: 128 VRRPPFSEPLESLLELCGTPVSAPVPQCPPVSAPAPEQAPSPDDNTLPSQTPRRRRHRRR 187

Query: 98  -----YKPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 247
                 +PPV  P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 188 TAHVPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 247

Query: 248 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
             P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 248 SAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 300

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 51/149 (34%), Positives = 63/149 (42%), Gaps = 34/149 (22%)
 Frame = +2

Query: 62  PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV----------------------- 172
           P  +  V +PP  +P      +   PV  P    PPV                       
Sbjct: 122 PYPRRAVRRPPFSEPLESLLELCGTPVSAPVPQCPPVSAPAPEQAPSPDDNTLPSQTPRR 181

Query: 173 -----------EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 319
                      E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P 
Sbjct: 182 RRHRRRTAHVPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 241

Query: 320 VEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
            E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 242 PERPPVSAPAPERPPVSAPAPERPPVSAP 270

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 47/143 (32%), Positives = 59/143 (41%), Gaps = 34/143 (23%)
 Frame = +2

Query: 80  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV------------------- 202
           +E  P  +  V +PP  +P      +   PV  P    PPV                   
Sbjct: 118 LELRPYPRRAVRRPPFSEPLESLLELCGTPVSAPVPQCPPVSAPAPEQAPSPDDNTLPSQ 177

Query: 203 ---------------EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 337
                          E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 178 TPRRRRHRRRTAHVPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 237

Query: 338 YKPPVEKPPVYKPPVEKPPVYKP 406
             P  E+PPV  P  E+PPV  P
Sbjct: 238 SAPAPERPPVSAPAPERPPVSAP 260

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 197 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 256

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 257 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 311

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 207 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 266

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 267 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 321

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/115 (31%), Positives = 49/115 (42%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 217 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 276

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           +     E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 277 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 331

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 35/114 (30%), Positives = 47/114 (41%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 227 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 286

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAP 408
           +     E   V  P  E P +     E   V AP+ E P + AP  E  S+  P
Sbjct: 287 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPECSSMPVP 340

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 34/109 (31%), Positives = 45/109 (41%)
 Frame = +1

Query: 85  ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPSLQTSGR 264
           E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P +     
Sbjct: 193 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 252

Query: 265 EATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
           E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 253 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 301

[57][TOP]
>UniRef100_B1VVM2 Putative secreted protein n=1 Tax=Streptomyces griseus subsp.
           griseus NBRC 13350 RepID=B1VVM2_STRGG
          Length = 231

 Score =  134 bits (336), Expect = 4e-30
 Identities = 55/109 (50%), Positives = 83/109 (76%)
 Frame = +2

Query: 74  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 253
           PP++ PP+  PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 88  PPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 147

Query: 254 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 400
           PPV++PPV +PPV++PPV +PPV++PP   P  + P    P    P  +
Sbjct: 148 PPVDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTPGSGTPGSNTPDAH 196

 Score =  132 bits (333), Expect = 9e-30
 Identities = 54/101 (53%), Positives = 81/101 (80%)
 Frame = +2

Query: 74  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 253
           P  + PP+  PP++ PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 83  PKHDHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 142

Query: 254 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
           PPV++PPV +PPV++PPV +PPV++PPV +PP + P    P
Sbjct: 143 PPVDEPPVDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTP 183

 Score =  132 bits (333), Expect = 9e-30
 Identities = 54/101 (53%), Positives = 81/101 (80%)
 Frame = +2

Query: 104 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 283
           P  + PP+  PP++ PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 83  PKHDHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 142

Query: 284 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           PPV++PPV +PPV++PPV +PPV++PPV +PP + P    P
Sbjct: 143 PPVDEPPVDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTP 183

 Score =  132 bits (331), Expect = 2e-29
 Identities = 55/101 (54%), Positives = 80/101 (79%)
 Frame = +2

Query: 44  PPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 223
           P    PPI  PP++ PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 83  PKHDHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 142

Query: 224 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
           PPV++PPV +PPV++PPV +PPV++PPV +PP + P    P
Sbjct: 143 PPVDEPPVDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTP 183

 Score =  131 bits (329), Expect = 3e-29
 Identities = 57/114 (50%), Positives = 83/114 (72%)
 Frame = +2

Query: 29  PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 208
           P  + PP   PPI  PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++
Sbjct: 83  PKHDHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 142

Query: 209 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           PPV +PPV++PPV +PPV++PPV +PPV++PP   P  + P    P    P  +
Sbjct: 143 PPVDEPPVDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTPGSGTPGSNTPDAH 196

 Score =  129 bits (324), Expect = 1e-28
 Identities = 52/92 (56%), Positives = 78/92 (84%)
 Frame = +2

Query: 134 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 313
           P  + PP+  PP++ PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 83  PKHDHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 142

Query: 314 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PPV++PPV +PPV++PPV +PPV++PPV +PP
Sbjct: 143 PPVDEPPVDQPPVDEPPVDQPPVDEPPVDQPP 174

 Score =  129 bits (323), Expect = 1e-28
 Identities = 53/111 (47%), Positives = 81/111 (72%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           + PP+  PP++ PP   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV
Sbjct: 86  DHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPV 145

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
            +PPV++PPV +PPV++PPV +PPV++PP   P  + P    P    P  +
Sbjct: 146 DEPPVDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTPGSGTPGSNTPDAH 196

 Score =  122 bits (306), Expect = 1e-26
 Identities = 49/94 (52%), Positives = 75/94 (79%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           ++ PP+  PPV++PP   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 90  IDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 149

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 286
           V +PPV++PPV +PPV++PPV +PP + P    P
Sbjct: 150 VDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTP 183

 Score =  118 bits (295), Expect = 2e-25
 Identities = 49/102 (48%), Positives = 75/102 (73%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           ++ PPV +PPV++PP   PP+ +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 95  IDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDQPP 154

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 310
           V +PPV++PPV +PPV++PP   P  + P    P    P  +
Sbjct: 155 VDEPPVDQPPVDEPPVDQPPTDTPGTDTPGSGTPGSNTPDAH 196

[58][TOP]
>UniRef100_Q9LIE9 Similarity to cell wall-plasma membrane linker protein n=1
           Tax=Arabidopsis thaliana RepID=Q9LIE9_ARATH
          Length = 334

 Score =  134 bits (336), Expect = 4e-30
 Identities = 70/146 (47%), Positives = 72/146 (49%), Gaps = 13/146 (8%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPP-VEKPPVYKPP-VEKPPVYKPP--VEK 178
           KPP  KPP  KPP    P  KPP+ KPP   PP   KPP   PP   KPP  KPP    K
Sbjct: 93  KPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPK 152

Query: 179 PPVYKPP---------VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
           PP +KPP            PPV  PP   PPV  PP   PPV  PP   PPV  PP   P
Sbjct: 153 PPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTP 212

Query: 332 PVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PV  PP   PPV  PP   PPV  PP
Sbjct: 213 PVITPPTPTPPVVTPPTPTPPVVTPP 238

 Score =  126 bits (316), Expect = 9e-28
 Identities = 72/163 (44%), Positives = 76/163 (46%), Gaps = 30/163 (18%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTP----PIYKP--------PVEKPPVYKPPVEKPPVYKPPVEKPP 154
           KPP  KPP  KPP   P    P  KP        P  KPP  KPP  KPP    P  KPP
Sbjct: 56  KPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPP 115

Query: 155 VYKPPVEKPP-VYKPPVE------KPPVYKPP--VEKPPVYKP---------PVEKPPVY 280
           + KPP + PP   KPP +      KPP  KPP    KPP +KP         P   PPV 
Sbjct: 116 IVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVV 175

Query: 281 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP
Sbjct: 176 TPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPP 218

 Score =  123 bits (308), Expect = 7e-27
 Identities = 73/168 (43%), Positives = 78/168 (46%), Gaps = 35/168 (20%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKP-----------------PVEKPPVYKPP 139
           KPP  KPP  KPP+  PP  KPP  KPP  KP                 P  KPP  KPP
Sbjct: 45  KPP--KPPAVKPPK--PPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPP 100

Query: 140 VEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVE------KPPVYKPP--VEKPPVYKP-- 286
             KPP    P  KPP+ KPP + PP   KPP +      KPP  KPP    KPP +KP  
Sbjct: 101 HPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPP 160

Query: 287 -------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
                  P   PPV  PP   PPV  PP   PPV  PP   PPV  PP
Sbjct: 161 TPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPP 208

 Score =  118 bits (296), Expect = 2e-25
 Identities = 63/136 (46%), Positives = 65/136 (47%), Gaps = 2/136 (1%)
 Frame = +2

Query: 5   VEKPPVYKPP-VEKPPEYTPP-IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           + KPP   PP   KPP   PP   KPP  KPP   P   KPP +KPP    P    P   
Sbjct: 116 IVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPP---PSTPKPPHHKPPPTPCPP-PTPTPT 171

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   
Sbjct: 172 PPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPT 231

Query: 359 PPVYKPPVEKPPVYKP 406
           PPV  PP   PP   P
Sbjct: 232 PPVVTPPTPTPPTPIP 247

 Score =  115 bits (287), Expect = 2e-24
 Identities = 69/142 (48%), Positives = 76/142 (53%), Gaps = 10/142 (7%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP   P   KPP++  P+ KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP  K
Sbjct: 29  PPKPSPAPHKPPKH--PV-KPP--KPPAVKPP--KPPAVKPPTPKPPTVKPH-PKPPTVK 80

Query: 194 P--------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPP-VYK 343
           P        P  KPP  KPP  KPP    P  KPP+ KPP + PP   KPP + PP   K
Sbjct: 81  PHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPK 140

Query: 344 PPVEKPPVYKPPVEKPPVYKPP 409
           PP  KPP   P   KPP +KPP
Sbjct: 141 PPTTKPP---PSTPKPPHHKPP 159

[59][TOP]
>UniRef100_B5UN98 Cell surface protein n=1 Tax=Bacillus cereus AH1134
           RepID=B5UN98_BACCE
          Length = 814

 Score =  132 bits (333), Expect = 9e-30
 Identities = 69/117 (58%), Positives = 70/117 (59%)
 Frame = +2

Query: 41  KPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 220
           K  E  P + KP  EKP V KP  EKP V KP  EKP V KP  EKP V KP  EKP V 
Sbjct: 318 KNEEKQPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVE 377

Query: 221 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 391
           KP  EKP V KP  EKP   KP  EKP   KP VEKP V KP VEKP V KP VEKP
Sbjct: 378 KPEAEKPEVEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKPEVEKP 434

 Score =  132 bits (331), Expect = 2e-29
 Identities = 68/112 (60%), Positives = 69/112 (61%)
 Frame = +2

Query: 71  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 250
           +P VEKP   KP VEKP   KP VEKP   KP VEKP   KP VEKP   KP VEKP   
Sbjct: 323 QPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAE 382

Query: 251 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           KP VEKP   KP  EKP   KP  EKP V KP VEKP V KP VEKP V KP
Sbjct: 383 KPEVEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKPEVEKP 434

 Score =  129 bits (323), Expect = 1e-28
 Identities = 66/112 (58%), Positives = 68/112 (60%)
 Frame = +2

Query: 26  KPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 205
           +P VEKP    P + KP  EKP V KP  EKP V KP  EKP V KP  EKP V KP  E
Sbjct: 323 QPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAE 382

Query: 206 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           KP V KP  EKP   KP  EKP   KP VEKP V KP VEKP V KP VEKP
Sbjct: 383 KPEVEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKPEVEKP 434

 Score =  127 bits (320), Expect = 3e-28
 Identities = 69/117 (58%), Positives = 69/117 (58%), Gaps = 1/117 (0%)
 Frame = +2

Query: 38  EKPPEYTPP-IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 214
           EK PE   P   KP VEKP   KP VEKP   KP VEKP   KP VEKP   KP VEKP 
Sbjct: 321 EKQPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPE 380

Query: 215 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 385
             KP VEKP   KP  EKP   KP  EKP V KP VEKP V KP VEKP V KP  E
Sbjct: 381 AEKPEVEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKPEVEKPDAE 437

 Score =  126 bits (316), Expect = 9e-28
 Identities = 66/116 (56%), Positives = 68/116 (58%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           ++P V KP  EKP    P   KP VEKP   KP VEKP   KP VEKP   KP VEKP  
Sbjct: 322 KQPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEA 381

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
            KP VEKP   KP  EKP   KP  EKP V KP VEKP V KP VEKP V KP  E
Sbjct: 382 EKPEVEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKPEVEKPDAE 437

 Score =  126 bits (316), Expect = 9e-28
 Identities = 65/109 (59%), Positives = 66/109 (60%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKP   KP VEKP    P + KP  EKP V KP  EKP V KP  EKP V KP  EKP 
Sbjct: 326 VEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPE 385

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
           V KP  EKP   KP  EKP   KP VEKP V KP VEKP V KP VEKP
Sbjct: 386 VEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKPEVEKP 434

 Score =  124 bits (312), Expect = 3e-27
 Identities = 64/108 (59%), Positives = 66/108 (61%)
 Frame = +2

Query: 83  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 262
           ++P V KP  EKP V KP  EKP V KP  EKP V KP  EKP V KP  EKP V KP  
Sbjct: 322 KQPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEA 381

Query: 263 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           EKP V KP  EKP   KP  EKP   KP VEKP V KP VEKP V KP
Sbjct: 382 EKPEVEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKP 429

[60][TOP]
>UniRef100_UPI00019859A1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019859A1
          Length = 377

 Score =  132 bits (332), Expect = 1e-29
 Identities = 72/146 (49%), Positives = 74/146 (50%), Gaps = 14/146 (9%)
 Frame = +2

Query: 14  PPVYK-------PPVEKPPEYTPPIYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKP 166
           PPVYK       PPV  PP + P  YK P   PPV  YK P   PPVY PP   P  YK 
Sbjct: 52  PPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKS 111

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
           P   PPVY PP   P  YK P   PPVY PP   P  YK P   PPVY PP   P  YK 
Sbjct: 112 PPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKS 171

Query: 347 PVEKPPVYK-----PPVEKPPVYKPP 409
           P   PPVYK     PP +KP  YK P
Sbjct: 172 PPPPPPVYKYKSPPPPHKKPYKYKSP 197

 Score =  124 bits (312), Expect = 3e-27
 Identities = 69/144 (47%), Positives = 71/144 (49%), Gaps = 12/144 (8%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEK-------PPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PPVY PP   P +Y  P   PPV K       PPVY PP   P  YK P   PPVY PP 
Sbjct: 64  PPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPH 123

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--- 343
             P  YK P   PPVY PP   P  YK P   PPVY PP   P  YK P   PPVYK   
Sbjct: 124 HPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKS 183

Query: 344 --PPVEKPPVYKPPVEKPPVYKPP 409
             PP +KP  YK P   PP Y  P
Sbjct: 184 PPPPHKKPYKYKSP--PPPPYNLP 205

 Score =  120 bits (300), Expect = 6e-26
 Identities = 64/126 (50%), Positives = 64/126 (50%), Gaps = 4/126 (3%)
 Frame = +2

Query: 44  PPEYTPPIYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKP 211
           PP Y    YK P   PPVYK   P   PPVY PP   P  YK P   PPV  YK P   P
Sbjct: 40  PPPY---YYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPP 96

Query: 212 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 391
           PVY PP   P  YK P   PPVY PP   P  YK P   PPVY PP   P  YK P   P
Sbjct: 97  PVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPP 156

Query: 392 PVYKPP 409
           PVY PP
Sbjct: 157 PVYSPP 162

 Score =  120 bits (300), Expect = 6e-26
 Identities = 72/165 (43%), Positives = 76/165 (46%), Gaps = 33/165 (20%)
 Frame = +2

Query: 14  PPVYK-------PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PPVYK       PPV  PP + P  YK P   PPVY PP   P  YK P   PPVY PP 
Sbjct: 84  PPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPH 143

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKPPVYKPP------ 319
             P  YK P   PPVY PP   P  YK P   PPVYK     PP +KP  YK P      
Sbjct: 144 HPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYN 203

Query: 320 -----------VEKPP--VYKPPVEKPPV--YKPPVEKPPVYKPP 409
                       + PP   YK P   PPV  YK P   PPV+ PP
Sbjct: 204 LPSGTSADEYEYKSPPPYKYKSPPPPPPVYKYKSPPPPPPVHSPP 248

 Score =  117 bits (294), Expect = 3e-25
 Identities = 66/135 (48%), Positives = 66/135 (48%), Gaps = 3/135 (2%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPV 187
           P  YK P   PP Y    YK P   PPVY PP   P  YK P   PPVYK   P   PPV
Sbjct: 42  PYYYKSPPPPPPVYK---YKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPV 98

Query: 188 YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           Y  P   PP  YK P   PPVY PP   P  YK P   PPVY PP   P  YK P   PP
Sbjct: 99  YS-PPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPP 157

Query: 365 VYKPPVEKPPVYKPP 409
           VY PP   P  YK P
Sbjct: 158 VYSPPHHPPYKYKSP 172

 Score =  115 bits (289), Expect = 1e-24
 Identities = 72/172 (41%), Positives = 77/172 (44%), Gaps = 42/172 (24%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PPVY PP   P +Y      PP+Y PP   P  YK P   PPVY PP   P  YK P   
Sbjct: 96  PPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPP 155

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKPPVYKPP-----------------V 292
           PPVY PP   P  YK P   PPVYK     PP +KP  YK P                  
Sbjct: 156 PPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEY 215

Query: 293 EKPPVYK-------PPVEK-------PPVYKPPVEKPPV-YKPPVEKPPVYK 403
           + PP YK       PPV K       PPV+ PP   PP  YK P   PPVYK
Sbjct: 216 KSPPPYKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYK 267

 Score =  106 bits (265), Expect = 7e-22
 Identities = 69/156 (44%), Positives = 73/156 (46%), Gaps = 23/156 (14%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVE 175
           K P   PPV  PP + P  YK P   PPVY PP   P  YK P   PPVYK     PP +
Sbjct: 130 KSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHK 189

Query: 176 KPPVYKPPVEKPPVYKPP---------VEKPP--VYKPPVEKPPV--YKPPVEKPPVYKP 316
           KP  YK P   PP Y  P          + PP   YK P   PPV  YK P   PPV+ P
Sbjct: 190 KPYKYKSP--PPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKYKSPPPPPPVHSP 247

Query: 317 PVEKPPV-YKPPVEKPPVYK----PPVEKPPVYKPP 409
           P   PP  YK P   PPVYK    PP   P  YK P
Sbjct: 248 PPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSP 283

 Score =  104 bits (260), Expect = 3e-21
 Identities = 64/141 (45%), Positives = 68/141 (48%), Gaps = 9/141 (6%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYK--PPVEKPPVYKPPVEKPPV-YKPPVEKPPVYK----P 166
           + PP YK     PP   PP+YK   P   PPV+ PP   PP  YK P   PPVYK    P
Sbjct: 216 KSPPPYKYKSPPPP---PPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPP 272

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--Y 340
           P   P  YK P   P  YK P   P  YK P   P  YK P   PPVYK     PPV  Y
Sbjct: 273 PPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKY 332

Query: 341 KPPVEKPPVYKPPVEKPPVYK 403
           K P   P +YK P   PPVYK
Sbjct: 333 KSPPPPPYMYKSPPPPPPVYK 353

 Score =  104 bits (259), Expect = 4e-21
 Identities = 69/160 (43%), Positives = 74/160 (46%), Gaps = 28/160 (17%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYK-----PPVEKPPVYK 163
           PPVY PP   P +Y      PP+Y PP   P  YK P   PPVYK     PP +KP  YK
Sbjct: 136 PPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYK 195

Query: 164 PPVEKPPVYKPP---------VEKPP--VYKPPVEKPPV--YKPPVEKPPVYKPPVEKPP 304
            P   PP Y  P          + PP   YK P   PPV  YK P   PPV+ PP   PP
Sbjct: 196 SP--PPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPP 253

Query: 305 V-YKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYKPP 409
             YK P   PPVYK    PP   P  YK P   P  YK P
Sbjct: 254 YKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSP 293

 Score =  102 bits (255), Expect = 1e-20
 Identities = 65/144 (45%), Positives = 68/144 (47%), Gaps = 12/144 (8%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPV-YKPPVEKPPVYK----PPVEKPPVYKPPVEK 178
           PPVYK     PP   PP++ PP   PP  YK P   PPVYK    PP   P  YK P   
Sbjct: 230 PPVYKYKSPPPP---PPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPP 286

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPV 352
           P  YK P   P  YK P   P  YK P   PPVYK     PPV  YK P   P +YK P 
Sbjct: 287 PYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPYMYKSPP 346

Query: 353 EKPPVYK---PPVEKPPVY--KPP 409
             PPVYK   PP   P  Y   PP
Sbjct: 347 PPPPVYKYKSPPPPPPKYYYSSPP 370

 Score =  100 bits (249), Expect = 5e-20
 Identities = 68/166 (40%), Positives = 73/166 (43%), Gaps = 36/166 (21%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYK-----PPVEKPPVYKPP-----------------V 112
           PPVY PP   P +Y      PP+YK     PP +KP  YK P                  
Sbjct: 156 PPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEY 215

Query: 113 EKPPVYK--PPVEKPPVYK--PPVEKPPVYKPPVEKPPV-YKPPVEKPPVYK----PPVE 265
           + PP YK   P   PPVYK   P   PPV+ PP   PP  YK P   PPVYK    PP  
Sbjct: 216 KSPPPYKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPS 275

Query: 266 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
            P  YK P   P  YK P   P  YK P   P  YK P   PPVYK
Sbjct: 276 PPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYK 321

 Score =  100 bits (249), Expect = 5e-20
 Identities = 68/156 (43%), Positives = 72/156 (46%), Gaps = 26/156 (16%)
 Frame = +2

Query: 14  PPVYK-----PPVEKPPEYT---PPIYKPP---------VEKPPVYK--PPVEKPPVYK- 133
           PPVYK     PP +KP +Y    PP Y  P          + PP YK   P   PPVYK 
Sbjct: 176 PPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKY 235

Query: 134 -PPVEKPPVYKPPVEKPPV-YKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYKPPVE 295
             P   PPV+ PP   PP  YK P   PPVYK    PP   P  YK P   P  YK P  
Sbjct: 236 KSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPP 295

Query: 296 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
            P  YK P   P  YK P   PPVYK     PPVYK
Sbjct: 296 PPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYK 331

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 51/136 (37%), Positives = 55/136 (40%), Gaps = 3/136 (2%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           + + PP   PP +         YK P   P  YK P   P  YK P   P  YK P   P
Sbjct: 267 KYKSPPPPSPPYK---------YKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPP 317

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PVYK     PPVYK        YK P   P +YK P   PPVYK        YK P   P
Sbjct: 318 PVYKYKSPPPPVYK--------YKSPPPPPYMYKSPPPPPPVYK--------YKSPPPPP 361

Query: 362 PVY---KPPVEKPPVY 400
           P Y    PP   P  Y
Sbjct: 362 PKYYYSSPPPPPPHHY 377

[61][TOP]
>UniRef100_Q40336 Proline-rich cell wall protein n=1 Tax=Medicago sativa
           RepID=Q40336_MEDSA
          Length = 381

 Score =  131 bits (330), Expect = 2e-29
 Identities = 86/165 (52%), Positives = 96/165 (58%), Gaps = 33/165 (20%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVY--------------KPP-VEKPPVY-KPPVE 145
           PP+ KPPV K  +Y+ P  KPPV KPP Y              KPP V KPP + KPPV 
Sbjct: 40  PPIVKPPVHKRRKYS-PTPKPPVHKPPRYPPKPSPCPPPSSTPKPPHVPKPPHHPKPPVV 98

Query: 146 KPP-VYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPP-VEKPPVY 310
            PP V KPPV  P V KPP+ KPP+  PP V KPPV KPP  V KPPV +PP V KPPV 
Sbjct: 99  HPPHVPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPPYVPKPPVV 158

Query: 311 ---KPPVEKPPVYKPP-VEKPPVY--------KPPVEKPPVYKPP 409
               P V KPPV +PP V KPPV         KPP+ KPP+  PP
Sbjct: 159 PVTPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPIVKPPIVFPP 203

 Score =  129 bits (325), Expect = 8e-29
 Identities = 80/173 (46%), Positives = 93/173 (53%), Gaps = 40/173 (23%)
 Frame = +2

Query: 11  KPPVYKPP-VEKPPEYTPPIYKPPVEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPP-VE 175
           KPPV  PP V KPP + P + KPP+ KPP+  PP V KPPV KPP  V KPPV +PP V 
Sbjct: 94  KPPVVHPPHVPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPPYVP 153

Query: 176 KPPVY---KPPVEKPPVYKPP-VEKPPVY--------KPPVEKPPVYKPP-------VEK 298
           KPPV     P V KPPV +PP V KPPV         KPP+ KPP+  PP       V  
Sbjct: 154 KPPVVPVTPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPIVKPPIVFPPHVPLPPVVPS 213

Query: 299 PPVY--KPPVEKPPVYKPP--------------VEKPPVYKPPVEKPPVYKPP 409
           PP Y   PP+ KPP+  PP              V+ PP+  PP   PP+  PP
Sbjct: 214 PPPYVPSPPIVKPPIVFPPHVPLPPVVPVTPPYVQPPPIVTPPTPTPPIVTPP 266

 Score =  128 bits (322), Expect = 2e-28
 Identities = 81/169 (47%), Positives = 90/169 (53%), Gaps = 34/169 (20%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPP-VEKPPVYKPP--VEKPPVYKPP-VEKPPVYK--- 163
           V KPPV+ P V KPP   PPI  PP V KPPV KPP  V KPPV +PP V KPPV     
Sbjct: 103 VPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPPYVPKPPVVPVTP 162

Query: 164 PPVEKPPVYKPP-VEKPPVY--------KPPVEKPPVYKPP-------VEKPPVY--KPP 289
           P V KPPV +PP V KPPV         KPP+ KPP+  PP       V  PP Y   PP
Sbjct: 163 PYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPIVKPPIVFPPHVPLPPVVPSPPPYVPSPP 222

Query: 290 VEKPPVYKP---------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           + KPP+  P         PV  P V  PP+  PP   PP+  PPV  PP
Sbjct: 223 IVKPPIVFPPHVPLPPVVPVTPPYVQPPPIVTPPTPTPPIVTPPVVSPP 271

 Score =  127 bits (319), Expect = 4e-28
 Identities = 86/168 (51%), Positives = 93/168 (55%), Gaps = 42/168 (25%)
 Frame = +2

Query: 32  PVEKPPEYTPPIYKPPVEK----PPVYKPPVEKPPVY--------------KPP-VEKPP 154
           P  KPP + PPI KPPV K     P  KPPV KPP Y              KPP V KPP
Sbjct: 31  PSPKPPTHHPPIVKPPVHKRRKYSPTPKPPVHKPPRYPPKPSPCPPPSSTPKPPHVPKPP 90

Query: 155 VY-KPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPP 319
            + KPPV  PP V KPPV  P V KPP+ KPP+  PP V KPPV KPP  V KPPV +PP
Sbjct: 91  HHPKPPVVHPPHVPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPP 150

Query: 320 -VEKPPVY--------KPPVEKPP-VYKPP--------VEKPPVYKPP 409
            V KPPV         KPPV +PP V KPP        V KPP+ KPP
Sbjct: 151 YVPKPPVVPVTPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPIVKPP 198

 Score =  105 bits (263), Expect = 1e-21
 Identities = 74/170 (43%), Positives = 83/170 (48%), Gaps = 35/170 (20%)
 Frame = +2

Query: 5   VEKPPVYKPP--VEKPPEYTPP-IYKPPV--------EKPPVYKPP-VEKPPVY------ 130
           V KPPV KPP  V KPP   PP + KPPV         KPPV +PP V KPPV       
Sbjct: 129 VPKPPVVKPPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPVVRPPYVPKPPVVPVTPPY 188

Query: 131 --KPPVEKPPVYKPP--------------VEKPPVYKPPVEKPP-VYKPPVEKPPVYKPP 259
             KPP+ KPP+  PP              V  PP+ KPP+  PP V  PPV   PV  P 
Sbjct: 189 VPKPPIVKPPIVFPPHVPLPPVVPSPPPYVPSPPIVKPPIVFPPHVPLPPV--VPVTPPY 246

Query: 260 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           V+ PP+  PP   PP+  PPV  PP   PP E P    P V  PP   PP
Sbjct: 247 VQPPPIVTPPTPTPPIVTPPVVSPPT--PPSETPCPPPPLVPYPPT--PP 292

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 60/135 (44%), Positives = 71/135 (52%), Gaps = 17/135 (12%)
 Frame = +2

Query: 5   VEKPPVYKPP-VEKPP--EYTPP-IYKPPVEKPPVYKPP-------VEKPPVY--KPPVE 145
           V KPPV +PP V KPP    TPP + KPP+ KPP+  PP       V  PP Y   PP+ 
Sbjct: 165 VPKPPVVRPPYVPKPPVVPVTPPYVPKPPIVKPPIVFPPHVPLPPVVPSPPPYVPSPPIV 224

Query: 146 KPPVYKPP-VEKPPVYK---PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 313
           KPP+  PP V  PPV     P V+ PP+  PP   PP+  PPV  PP   PP E P    
Sbjct: 225 KPPIVFPPHVPLPPVVPVTPPYVQPPPIVTPPTPTPPIVTPPVVSPPT--PPSETPCPPP 282

Query: 314 PPVEKPPVYKPPVEK 358
           P V  PP   PP ++
Sbjct: 283 PLVPYPPT--PPAQQ 295

[62][TOP]
>UniRef100_Q5XGC9-2 Isoform 2 of Serum response factor-binding protein 1 n=1
           Tax=Xenopus (Silurana) tropicalis RepID=Q5XGC9-2
          Length = 530

 Score =  131 bits (329), Expect = 3e-29
 Identities = 62/128 (48%), Positives = 86/128 (67%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+P V +P VE+P    P + +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 216 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 275

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE P V +PPVE PP
Sbjct: 276 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPP 335

Query: 365 VYKPPVEK 388
             K  +E+
Sbjct: 336 KKKACLEQ 343

 Score =  130 bits (326), Expect = 6e-29
 Identities = 61/123 (49%), Positives = 83/123 (67%)
 Frame = +2

Query: 35  VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 214
           VE+P    P + +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 216 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 275

Query: 215 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 394
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE P V +PPVE PP
Sbjct: 276 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPP 335

Query: 395 VYK 403
             K
Sbjct: 336 KKK 338

 Score =  129 bits (323), Expect = 1e-28
 Identities = 59/117 (50%), Positives = 81/117 (69%)
 Frame = +2

Query: 59  PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 238
           P + +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+
Sbjct: 219 PAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVER 278

Query: 239 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V  P VE+PPV  PP
Sbjct: 279 PAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPP 335

 Score =  124 bits (311), Expect = 3e-27
 Identities = 57/115 (49%), Positives = 80/115 (69%)
 Frame = +2

Query: 65  IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 244
           + +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 216 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 275

Query: 245 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE P V +PP
Sbjct: 276 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPP 330

 Score =  119 bits (298), Expect = 1e-25
 Identities = 60/127 (47%), Positives = 82/127 (64%), Gaps = 4/127 (3%)
 Frame = +2

Query: 38  EKPPEYTPPIYKPP----VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 205
           E  PE T    + P    VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE
Sbjct: 198 ENLPEQTAENKEQPKAQDVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVE 257

Query: 206 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 385
           +P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE
Sbjct: 258 RPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVE 317

Query: 386 KPPVYKP 406
           +P V  P
Sbjct: 318 RPVVESP 324

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 47/109 (43%), Positives = 68/109 (62%)
 Frame = +2

Query: 80  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 259
           +E P V +   E+    K   +   V +P VE+P V +P VE+P V +P VE+P V +P 
Sbjct: 191 LELPYVQENLPEQTAENKEQPKAQDVERPAVERPAVERPAVERPAVERPAVERPAVERPA 250

Query: 260 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P
Sbjct: 251 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERP 299

[63][TOP]
>UniRef100_UPI000180B733 PREDICTED: similar to cell wall proline-rich protein n=1 Tax=Ciona
            intestinalis RepID=UPI000180B733
          Length = 1425

 Score =  130 bits (327), Expect = 5e-29
 Identities = 64/132 (48%), Positives = 65/132 (49%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP   PPV K P   PP+ K P   PPV K P   PPV K P   PPV K     PPV K
Sbjct: 660  PPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVK 719

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
             P   PPV K P   PPV K P   PPV K P   PPV K P   PPV K P    PV K
Sbjct: 720  SPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNSPVGK 779

Query: 374  PPVEKPPVYKPP 409
             P   PPV K P
Sbjct: 780  SPAGNPPVVKLP 791

 Score =  128 bits (322), Expect = 2e-28
 Identities = 65/135 (48%), Positives = 66/135 (48%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V K P   PPV K P   PP+ K P   PPV K P   PPV K     PPV K P   PP
Sbjct: 667  VVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVKSPAGNPP 726

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V K P   PPV K P   PPV K P   PPV K P   PPV K P    PV K P   PP
Sbjct: 727  VVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNSPVGKSPAGNPP 786

Query: 365  VYKPPVEKPPVYKPP 409
            V K P E  PV K P
Sbjct: 787  VVKLPAENFPVVKSP 801

 Score =  125 bits (315), Expect = 1e-27
 Identities = 62/132 (46%), Positives = 63/132 (47%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP    P   PP   PP+ K P   PPV K P   PPV K P   PPV K P   PPV K
Sbjct: 650  PPGLTLPARIPPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVK 709

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
                 PPV K P   PPV K P   PPV K P   PPV K P   PPV K P   PPV K
Sbjct: 710  SSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVK 769

Query: 374  PPVEKPPVYKPP 409
             P    PV K P
Sbjct: 770  SPAGNSPVGKSP 781

 Score =  124 bits (312), Expect = 3e-27
 Identities = 63/131 (48%), Positives = 64/131 (48%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V K P   PPV K P   PP+ K P   PPV K     PPV K P   PPV K P   PP
Sbjct: 677  VVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPP 736

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V K P   PPV K P   PPV K P   PPV K P    PV K P   PPV K P E  P
Sbjct: 737  VVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNSPVGKSPAGNPPVVKLPAENFP 796

Query: 365  VYKPPVEKPPV 397
            V K P   PPV
Sbjct: 797  VVKSPAGNPPV 807

 Score =  122 bits (307), Expect = 1e-26
 Identities = 62/130 (47%), Positives = 62/130 (47%)
 Frame = +2

Query: 20   VYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 199
            V K     PP  T P   PP   PPV K P   PPV K P   PPV K P   PPV K P
Sbjct: 642  VEKVSNRNPPGLTLPARIPPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSP 701

Query: 200  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 379
               PPV K     PPV K P   PPV K P   PPV K P   PPV K P   PPV K P
Sbjct: 702  AGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSP 761

Query: 380  VEKPPVYKPP 409
               PPV K P
Sbjct: 762  AGNPPVVKSP 771

 Score =  105 bits (261), Expect = 2e-21
 Identities = 58/139 (41%), Positives = 59/139 (42%), Gaps = 5/139 (3%)
 Frame = +2

Query: 8    EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEK-----PPVYKPPV 172
            E  P    P    P     + K     PP    P   PP   PPV K     PPV K P 
Sbjct: 623  ESSPYVSNPTGNLPFTDANVEKVSNRNPPGLTLPARIPPAGNPPVVKSPAGNPPVVKSPA 682

Query: 173  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
              PPV K P   PPV K P   PPV K     PPV K P   PPV K P   PPV K P 
Sbjct: 683  GNPPVVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPA 742

Query: 353  EKPPVYKPPVEKPPVYKPP 409
              PPV K P   PPV K P
Sbjct: 743  GNPPVVKSPAGNPPVVKSP 761

[64][TOP]
>UniRef100_O82066 Proline-rich protein n=1 Tax=Solanum tuberosum RepID=O82066_SOLTU
          Length = 491

 Score =  130 bits (327), Expect = 5e-29
 Identities = 89/191 (46%), Positives = 100/191 (52%), Gaps = 60/191 (31%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPV--YK----PPVEK-----------PPVYKPPVE 145
           PVYKP  + PP    P+YKP  + PPV  YK    PPV+K           PPV KP   
Sbjct: 271 PVYKPKPKPPPV---PVYKPKPKPPPVPTYKPKPEPPVKKPCPPSVPKPKPPPVKKPCPP 327

Query: 146 KPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKP-----PVYKPPV 292
           K P YKP P  +PPV KP     PVYKPPV KP     PVYKPPV KP     PVYKPPV
Sbjct: 328 KVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPV 387

Query: 293 EKP-----PVYK------------PPVEKP-----PVYKPPVEKP-----PVYKPPVEKP 391
            KP     P+YK            PP+ KP     P+Y PPV KP     P+Y+PPV KP
Sbjct: 388 VKPLPPPVPIYKKPCPPFPHLPPLPPIVKPLPPPVPIYVPPVVKPLPPPVPIYEPPVVKP 447

Query: 392 -----PVYKPP 409
                P+YKPP
Sbjct: 448 LPPPVPIYKPP 458

 Score =  128 bits (322), Expect = 2e-28
 Identities = 78/162 (48%), Positives = 87/162 (53%), Gaps = 29/162 (17%)
 Frame = +2

Query: 11  KPPVYKP-PVEKPPEYTPPIYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKP- 181
           +PPV KP P   P    PP+ KP   K P YKP P  +PPV KP     PVYKPPV KP 
Sbjct: 302 EPPVKKPCPPSVPKPKPPPVKKPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPL 361

Query: 182 ----PVYKPPVEKP-----PVYKPPVEKP-----PVYKPPVEK-------PPVYKPPVEK 298
               PVYKPPV KP     PVYKPPV KP     P+YK P          PP+ KP    
Sbjct: 362 PPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPIYKKPCPPFPHLPPLPPIVKPLPPP 421

Query: 299 PPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPP 409
            P+Y PPV KP     P+Y+PPV KP     P+ KPP YK P
Sbjct: 422 VPIYVPPVVKPLPPPVPIYEPPVVKPLPPPVPIYKPPFYKKP 463

 Score =  125 bits (314), Expect = 1e-27
 Identities = 81/158 (51%), Positives = 90/158 (56%), Gaps = 27/158 (17%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPV--YKPPVEKPPV--YKPPVEKPPV--YKP---- 166
           P  +PPV KP     P+YKP  + PPV  YKP  + PPV  YKP  + PPV  YKP    
Sbjct: 244 PTPEPPVVKPLPPPVPVYKPKPKPPPVPVYKPKPKPPPVPVYKPKPKPPPVPTYKPKPEP 303

Query: 167 PVEKP-PVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKP--- 331
           PV+KP P   P  + PPV KP   K P YKP P  +PPV KP     PVYKPPV KP   
Sbjct: 304 PVKKPCPPSVPKPKPPPVKKPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPP 363

Query: 332 --PVYKPPVEKP-----PVYKPPVEKP-----PVYKPP 409
             PVYKPPV KP     PVYKPPV KP     P+YK P
Sbjct: 364 PVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPIYKKP 401

 Score =  120 bits (302), Expect = 4e-26
 Identities = 84/171 (49%), Positives = 94/171 (54%), Gaps = 39/171 (22%)
 Frame = +2

Query: 14  PPVYK----PPVEKPPEYTPPIYKP---PVEKPPVYKPPVEKPPVYKPPVEKPPV--YKP 166
           PP++K    PP+ KPP    P+Y P   P  +PPV KP     PVYKP  + PPV  YKP
Sbjct: 219 PPLFKKPCPPPLVKPPV---PVYNPTPKPTPEPPVVKPLPPPVPVYKPKPKPPPVPVYKP 275

Query: 167 PVEKPPV--YKPPVEKPPV--YKP----PVEKP-PVYKPPVEKPPVYKPPVEKPPVYK-- 313
             + PPV  YKP  + PPV  YKP    PV+KP P   P  + PPV KP   K P YK  
Sbjct: 276 KPKPPPVPVYKPKPKPPPVPTYKPKPEPPVKKPCPPSVPKPKPPPVKKPCPPKVPTYKPK 335

Query: 314 ----PPVEKP-----PVYKPPVEKP-----PVYKPPVEKP-----PVYKPP 409
               PPV KP     PVYKPPV KP     PVYKPPV KP     PVYKPP
Sbjct: 336 PKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPP 386

 Score =  119 bits (297), Expect = 1e-25
 Identities = 79/165 (47%), Positives = 88/165 (53%), Gaps = 34/165 (20%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-PIYKPPVEKP-----PVYKPPVEKP-----PVYKPPVEKP--- 151
           PPV KP   K P Y P P  +PPV KP     PVYKPPV KP     PVYKPPV KP   
Sbjct: 319 PPVKKPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPP 378

Query: 152 --PVYKPPVEKP-----PVYKPPVEK-------PPVYKPPVEKPPVYKPPVEKP-----P 274
             PVYKPPV KP     P+YK P          PP+ KP     P+Y PPV KP     P
Sbjct: 379 PVPVYKPPVVKPLPPPVPIYKKPCPPFPHLPPLPPIVKPLPPPVPIYVPPVVKPLPPPVP 438

Query: 275 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKP 406
           +Y+PPV KP     P+ KPP YK P   PP+  PP  K PP + P
Sbjct: 439 IYEPPVVKPLPPPVPIYKPPFYKKPC--PPL--PPFPKIPPFHHP 479

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 60/136 (44%), Positives = 72/136 (52%), Gaps = 5/136 (3%)
 Frame = +2

Query: 17  PVYKPPVEKP-----PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           PVYKPPV KP     P Y PP+ KP     P+YK P    P + PP+  PP+ KP     
Sbjct: 366 PVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPIYKKPCPPFP-HLPPL--PPIVKPLPPPV 422

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           P+Y PPV KP    PPV   P+Y+PPV KP     P+ KPP YK P   PP+  PP  K 
Sbjct: 423 PIYVPPVVKP--LPPPV---PIYEPPVVKPLPPPVPIYKPPFYKKPC--PPL--PPFPKI 473

Query: 362 PVYKPPVEKPPVYKPP 409
           P +  P+  P   K P
Sbjct: 474 PPFHHPLFPPLPPKIP 489

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/82 (41%), Positives = 42/82 (51%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP+ KP     P Y PP+ KP     P+Y+PPV KP     P+ KPP YK P   PP+  
Sbjct: 412 PPIVKPLPPPVPIYVPPVVKPLPPPVPIYEPPVVKPLPPPVPIYKPPFYKKPC--PPL-- 467

Query: 194 PPVEKPPVYKPPVEKPPVYKPP 259
           PP  K P +  P+  P   K P
Sbjct: 468 PPFPKIPPFHHPLFPPLPPKIP 489

[65][TOP]
>UniRef100_A7S8Z4 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis
           RepID=A7S8Z4_NEMVE
          Length = 160

 Score =  130 bits (327), Expect = 5e-29
 Identities = 75/137 (54%), Positives = 81/137 (59%), Gaps = 2/137 (1%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           RV KP V KP V KP    P   KP V KP V KP V KP   KP V KP V+KP V KP
Sbjct: 21  RVYKPCVLKPLVHKPRVLKPRALKPLVHKPRVLKPCVHKPRALKPCVHKPCVHKPRVHKP 80

Query: 182 PVYKPPVEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
            V+KP V  P V+KP   V KP V+KP V KP V KP V KP V KP   KP V  P V 
Sbjct: 81  RVHKPLVHNPRVHKPRPHVHKPRVHKPRVHKPRVLKPHVHKPRVLKPLALKPLVNNPRVH 140

Query: 356 KPPVYKPPVEKPPVYKP 406
           KP V+KP V KP V+KP
Sbjct: 141 KPRVHKPHVHKPSVHKP 157

 Score =  128 bits (322), Expect = 2e-28
 Identities = 72/134 (53%), Positives = 85/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KP V+KP V KP    P ++KP V KP V+KP   KP V+KP V KP V+KP V KP 
Sbjct: 27  VLKPLVHKPRVLKPRALKPLVHKPRVLKPCVHKPRALKPCVHKPCVHKPRVHKPRVHKPL 86

Query: 185 VYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           V+ P V KP   V+KP V KP V+KP V KP V+KP V KP   KP V  P V+KP V K
Sbjct: 87  VHNPRVHKPRPHVHKPRVHKPRVHKPRVLKPHVHKPRVLKPLALKPLVNNPRVHKPRVHK 146

Query: 359 PPVYKPPVEKPPVY 400
           P V+KP V KP V+
Sbjct: 147 PHVHKPSVHKPRVH 160

 Score =  127 bits (320), Expect = 3e-28
 Identities = 73/142 (51%), Positives = 85/142 (59%), Gaps = 7/142 (4%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           RV KP ++KP V KP    P ++KP V KP   KP V KP V KP V KP   KP V KP
Sbjct: 11  RVLKPLLHKPRVYKPCVLKPLVHKPRVLKPRALKPLVHKPRVLKPCVHKPRALKPCVHKP 70

Query: 182 PVYKPPVEKPPVYKPPVE-------KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
            V+KP V KP V+KP V        +P V+KP V KP V+KP V KP V+KP V KP   
Sbjct: 71  CVHKPRVHKPRVHKPLVHNPRVHKPRPHVHKPRVHKPRVHKPRVLKPHVHKPRVLKPLAL 130

Query: 341 KPPVEKPPVYKPPVEKPPVYKP 406
           KP V  P V+KP V KP V+KP
Sbjct: 131 KPLVNNPRVHKPRVHKPHVHKP 152

 Score =  126 bits (316), Expect = 9e-28
 Identities = 72/134 (53%), Positives = 83/134 (61%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V K  V+KP V KP  + P +YKP V KP V+KP V KP   KP V KP V KP V KP 
Sbjct: 2   VHKLLVHKPRVLKPLLHKPRVYKPCVLKPLVHKPRVLKPRALKPLVHKPRVLKPCVHKPR 61

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
             KP V KP V+KP V KP V+KP V  P V+KP   +P V+KP V KP V+KP V KP 
Sbjct: 62  ALKPCVHKPCVHKPRVHKPRVHKPLVHNPRVHKP---RPHVHKPRVHKPRVHKPRVLKPH 118

Query: 365 VYKPPVEKPPVYKP 406
           V+KP V KP   KP
Sbjct: 119 VHKPRVLKPLALKP 132

 Score =  123 bits (308), Expect = 7e-27
 Identities = 70/130 (53%), Positives = 80/130 (61%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           PV+K  V KP    P ++KP V KP V KP V KP V KP   KP V+KP V KP V+KP
Sbjct: 1   PVHKLLVHKPRVLKPLLHKPRVYKPCVLKPLVHKPRVLKPRALKPLVHKPRVLKPCVHKP 60

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
              KP V+KP V KP V+KP V KP V+ P V KP   +P V KP V+KP V KP V KP
Sbjct: 61  RALKPCVHKPCVHKPRVHKPRVHKPLVHNPRVHKP---RPHVHKPRVHKPRVHKPRVLKP 117

Query: 377 PVEKPPVYKP 406
            V KP V KP
Sbjct: 118 HVHKPRVLKP 127

 Score =  118 bits (296), Expect = 2e-25
 Identities = 66/125 (52%), Positives = 77/125 (61%), Gaps = 2/125 (1%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           RV KP   KP V KP    P ++KP   KP V+KP V KP V+KP V KP V+ P V KP
Sbjct: 36  RVLKPRALKPLVHKPRVLKPCVHKPRALKPCVHKPCVHKPRVHKPRVHKPLVHNPRVHKP 95

Query: 182 P--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
              V+KP V KP V+KP V KP V+KP V KP   KP V  P V+KP V KP V+KP V 
Sbjct: 96  RPHVHKPRVHKPRVHKPRVLKPHVHKPRVLKPLALKPLVNNPRVHKPRVHKPHVHKPSVH 155

Query: 356 KPPVY 370
           KP V+
Sbjct: 156 KPRVH 160

[66][TOP]
>UniRef100_A9VJK7 NEAr transporter n=1 Tax=Bacillus weihenstephanensis KBAB4
           RepID=A9VJK7_BACWK
          Length = 1147

 Score =  130 bits (326), Expect = 6e-29
 Identities = 69/101 (68%), Positives = 69/101 (68%)
 Frame = +2

Query: 83  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 262
           EKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP V
Sbjct: 459 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEV 518

Query: 263 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 385
           EKP V KP VEKP V KP VEKP V KP VEKP V  P  E
Sbjct: 519 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENPDAE 559

 Score =  129 bits (324), Expect = 1e-28
 Identities = 68/97 (70%), Positives = 68/97 (70%)
 Frame = +2

Query: 71  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 250
           KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V 
Sbjct: 460 KPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVE 519

Query: 251 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           KP VEKP V KP VEKP V KP VEKP V KP VE P
Sbjct: 520 KPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENP 556

 Score =  129 bits (324), Expect = 1e-28
 Identities = 68/97 (70%), Positives = 68/97 (70%)
 Frame = +2

Query: 101 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 280
           KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V 
Sbjct: 460 KPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVE 519

Query: 281 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 391
           KP VEKP V KP VEKP V KP VEKP V KP VE P
Sbjct: 520 KPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENP 556

 Score =  128 bits (322), Expect = 2e-28
 Identities = 68/98 (69%), Positives = 68/98 (69%)
 Frame = +2

Query: 113 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 292
           EKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP V
Sbjct: 459 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEV 518

Query: 293 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           EKP V KP VEKP V KP VEKP V KP VEKP V  P
Sbjct: 519 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENP 556

 Score =  126 bits (317), Expect = 7e-28
 Identities = 67/102 (65%), Positives = 68/102 (66%)
 Frame = +2

Query: 50  EYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 229
           E  P + KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP 
Sbjct: 458 EEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPE 517

Query: 230 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
           VEKP V KP VEKP V KP VEKP V KP VEKP V  P  E
Sbjct: 518 VEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENPDAE 559

 Score =  123 bits (309), Expect = 6e-27
 Identities = 65/98 (66%), Positives = 66/98 (67%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           EKP V KP VEKP    P + KP VEKP V KP VEKP V KP VEKP V KP VEKP V
Sbjct: 459 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEV 518

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 301
            KP VEKP V KP VEKP V KP VEKP V KP VE P
Sbjct: 519 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENP 556

 Score =  123 bits (309), Expect = 6e-27
 Identities = 65/98 (66%), Positives = 66/98 (67%)
 Frame = +2

Query: 38  EKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 217
           EKP    P + KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V
Sbjct: 459 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEV 518

Query: 218 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
            KP VEKP V KP VEKP V KP VEKP V KP VE P
Sbjct: 519 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENP 556

 Score =  119 bits (297), Expect = 1e-25
 Identities = 63/97 (64%), Positives = 64/97 (65%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEKP V KP VEKP    P + KP VEKP V KP VEKP V KP VEKP V KP VEKP 
Sbjct: 463 VEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPE 522

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 295
           V KP VEKP V KP VEKP V KP VEKP V  P  E
Sbjct: 523 VEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENPDAE 559

[67][TOP]
>UniRef100_B4H1H8 GL22613 n=1 Tax=Drosophila persimilis RepID=B4H1H8_DROPE
          Length = 346

 Score =  130 bits (326), Expect = 6e-29
 Identities = 57/121 (47%), Positives = 83/121 (68%)
 Frame = +2

Query: 35  VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 214
           VE+P +  PP  +PP E+P   +PP E+PP  +PP E+PP  +PP + PP+ +PP E PP
Sbjct: 212 VEEPQQVEPPKEEPPKEEPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPP 271

Query: 215 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 394
             +PP EKPP  +PP E+PP  +PP E+PP  +P  E+PP  + P E+PP+ +PP+E+PP
Sbjct: 272 KEEPPKEKPPKEEPPKEEPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPPMEEPP 331

Query: 395 V 397
           +
Sbjct: 332 M 332

 Score =  129 bits (325), Expect = 8e-29
 Identities = 57/121 (47%), Positives = 83/121 (68%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+P   +PP E+PP+  P   +PP E+PP  +PP E+PP  +PP + PP+ +PP E PP
Sbjct: 212 VEEPQQVEPPKEEPPKEEPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPP 271

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
             +PP EKPP  +PP E+PP  +PP E+PP  +P  E+PP  + P E+PP+ +PP+E+PP
Sbjct: 272 KEEPPKEKPPKEEPPKEEPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPPMEEPP 331

Query: 365 V 367
           +
Sbjct: 332 M 332

 Score =  125 bits (315), Expect = 1e-27
 Identities = 56/117 (47%), Positives = 79/117 (67%)
 Frame = +2

Query: 59  PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 238
           P   +PP E+PP  +P  E+PP  +PP E+PP  +PP E+PP   PP+E+PP   PP E+
Sbjct: 215 PQQVEPPKEEPPKEEPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPPKEE 274

Query: 239 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PP  KPP E+PP  +PP E+PP  +PP E+P   +PP E+ P  +PP+E+PP+ +PP
Sbjct: 275 PPKEKPPKEEPPKEEPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPPMEEPP 331

 Score =  125 bits (313), Expect = 2e-27
 Identities = 55/116 (47%), Positives = 80/116 (68%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  +PP E+P +  PP  +PP E+PP  +PP E+PP   PP+E+PP   PP E+PP  
Sbjct: 219 EPPKEEPPKEEPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPPKEEPPKE 278

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           KPP E+PP  +PP E+PP  +PP E+P   +PP E+ P  +PP+E+PP+ +PP+E+
Sbjct: 279 KPPKEEPPKEEPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPPMEEPPMEE 334

 Score =  117 bits (294), Expect = 3e-25
 Identities = 52/115 (45%), Positives = 76/115 (66%)
 Frame = +2

Query: 65  IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 244
           + +P   +PP  +PP E+P   +PP E+PP  +PP E+PP  +PP + PP+ +PP E PP
Sbjct: 212 VEEPQQVEPPKEEPPKEEPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPP 271

Query: 245 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
             +PP EKPP  +PP E+PP  +PP E+PP  +P  E+PP  + P E+PP+ +PP
Sbjct: 272 KEEPPKEKPPKEEPPKEEPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPP 326

 Score =  115 bits (289), Expect = 1e-24
 Identities = 51/107 (47%), Positives = 74/107 (69%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           E+P   +PP E+PP+  PP  +PP E+PP   PP+E+PP   PP E+PP  KPP E+PP 
Sbjct: 228 EEPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPPKEEPPKEKPPKEEPPK 287

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
            +PP E+PP  +PP E+P   +PP E+ P  +PP+E+PP+ +PP+E+
Sbjct: 288 EEPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPPMEEPPMEE 334

 Score =  113 bits (282), Expect = 8e-24
 Identities = 49/102 (48%), Positives = 71/102 (69%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           R E+PP  +PP E+PP+  PP  +PP + PP+ +PP E PP  +PP EKPP  +PP E+P
Sbjct: 231 RKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPPKEEPPKEKPPKEEPPKEEP 290

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 307
           P  +PP E+PP  +P  E+PP  + P E+PP+ +PP+E+PP+
Sbjct: 291 PKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPPMEEPPM 332

[68][TOP]
>UniRef100_A8DV67 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis
           RepID=A8DV67_NEMVE
          Length = 140

 Score =  128 bits (322), Expect = 2e-28
 Identities = 72/134 (53%), Positives = 84/134 (62%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V K  V+KP V KP  + P + KP V KP V +P V KP V +P V KP V KP V KP 
Sbjct: 2   VHKLLVHKPRVLKPLVHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPR 61

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
             KP V KP V+KP V KP V+KP V KP V+KP V KP V+KP V  P V+KP V +P 
Sbjct: 62  ALKPLVHKPCVHKPCVHKPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQPH 121

Query: 365 VYKPPVEKPPVYKP 406
           V+KP V KP V KP
Sbjct: 122 VHKPLVNKPRVLKP 135

 Score =  128 bits (321), Expect = 2e-28
 Identities = 72/134 (53%), Positives = 85/134 (63%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KP V KP V KP    P ++KP V +P V+KP V +P V+KP V KP V+KP   KP 
Sbjct: 7   VHKPRVLKPLVHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPL 66

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V+KP V KP V+KP V KP V+KP V KP V+KP V KP V+ P V KP V +P V KP 
Sbjct: 67  VHKPCVHKPCVHKPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQPHVHKPL 126

Query: 365 VYKPPVEKPPVYKP 406
           V KP V KP   KP
Sbjct: 127 VNKPRVLKPLALKP 140

 Score =  125 bits (314), Expect = 1e-27
 Identities = 70/130 (53%), Positives = 85/130 (65%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           PV+K  V KP    P ++KP V KP V+KP V +P V+KP V +P V+KP V KP V+KP
Sbjct: 1   PVHKLLVHKPRVLKPLVHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKP 60

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
              KP V+KP V KP V+KP V KP V+KP V KP V+KP V KP V+ P V KP V +P
Sbjct: 61  RALKPLVHKPCVHKPCVHKPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQP 120

Query: 377 PVEKPPVYKP 406
            V KP V KP
Sbjct: 121 HVHKPLVNKP 130

 Score =  125 bits (314), Expect = 1e-27
 Identities = 70/130 (53%), Positives = 82/130 (63%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           RV KP V+KP V KP  + P + +P V KP V +P V KP V KP V KP   KP V KP
Sbjct: 11  RVLKPLVHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPLVHKP 70

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
            V+KP V KP V+KP V KP V+KP V KP V+KP V  P V+KP V +P V+KP V KP
Sbjct: 71  CVHKPCVHKPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQPHVHKPLVNKP 130

Query: 362 PVYKPPVEKP 391
            V KP   KP
Sbjct: 131 RVLKPLALKP 140

[69][TOP]
>UniRef100_A8NQG1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130
           RepID=A8NQG1_COPC7
          Length = 418

 Score =  127 bits (320), Expect = 3e-28
 Identities = 100/175 (57%), Positives = 100/175 (57%), Gaps = 42/175 (24%)
 Frame = +2

Query: 11  KPPVY--KPPVEKP-PEYTPPIYKPPVE--KPPVY--KPPVEKPPVYKPPVEKPPVYKPP 169
           KPPV   KPPVE P P   PP  KPPVE  KPPV   KPPVE P   KPPVE P   KPP
Sbjct: 89  KPPVEPPKPPVEPPKPPVEPP--KPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPP 146

Query: 170 VE--KPPVY-----KPPVEKPPVYKPPVE--KPPVY-----KPPVE--KPPVY-----KP 286
           VE  KPPV      KPPVE P   KPPVE  KPPV      KPPVE  KPPV      KP
Sbjct: 147 VEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKP 206

Query: 287 PVEKPPVYKPPVE--KPPVY-----KPPVE--KPPVY-----KPPVEKPPVYKPP 409
           PVE P   KPPVE  KPPV      KPPVE  KPPV      KPPVE P   KPP
Sbjct: 207 PVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPVPPKPP 261

 Score =  126 bits (316), Expect = 9e-28
 Identities = 98/169 (57%), Positives = 98/169 (57%), Gaps = 37/169 (21%)
 Frame = +2

Query: 11  KPPVY--KPPVEKP-PEYTPPIYKPPVE--KPPVY--KPPVEKPPVYKPPVEKPPVYKPP 169
           KPPV   KPPVE P P   PP  KPPVE  KPPV   KPPVE P   KPPVE P   KPP
Sbjct: 82  KPPVEPPKPPVEPPKPPVEPP--KPPVEPPKPPVEPPKPPVEPP---KPPVEPPKPPKPP 136

Query: 170 VEKPPVYKPPVE--KPPVY-----KPPVEKPPVYKPPVE--KPPVY-----KPPVE--KP 301
           VE P   KPPVE  KPPV      KPPVE P   KPPVE  KPPV      KPPVE  KP
Sbjct: 137 VEPPVPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKP 196

Query: 302 PVY-----KPPVEKPPVYKPPVE--KPPVY-----KPPVE--KPPVYKP 406
           PV      KPPVE P   KPPVE  KPPV      KPPVE  KPPV  P
Sbjct: 197 PVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPP 245

 Score =  125 bits (314), Expect = 1e-27
 Identities = 97/168 (57%), Positives = 99/168 (58%), Gaps = 36/168 (21%)
 Frame = +2

Query: 11  KPPVYKP-PVEKPPEYTPPIYKPPVE--KPPVY--KPPVE--KPPVY--KPPVE--KPPV 157
           KPPV  P P  +PP+ T    KPPVE  KPPV   KPPVE  KPPV   KPPVE  KPPV
Sbjct: 61  KPPVDPPKPTVEPPKPTVAPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPV 120

Query: 158 Y--KPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY-----KPPVEKPPVYKPPVE--KPP 304
              KPPVE P   KPPVE P   KPPVE  KPPV      KPPVE P   KPPVE  KPP
Sbjct: 121 EPPKPPVEPPKPPKPPVEPPVPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPP 180

Query: 305 VY-----KPPVE--KPPVY-----KPPVEKPPVYKPPVE--KPPVYKP 406
           V      KPPVE  KPPV      KPPVE P   KPPVE  KPPV  P
Sbjct: 181 VVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPP 228

 Score =  120 bits (302), Expect = 4e-26
 Identities = 81/146 (55%), Positives = 82/146 (56%), Gaps = 11/146 (7%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIY--KPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPV 172
           VE P   KPPVE P    PP+   KPPV  P   KPPVE P   KPPVE  KPPV  P  
Sbjct: 127 VEPPKPPKPPVEPPVPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFP 186

Query: 173 EKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVY--KPPVEKPP 334
            KPPV   KPPV  P   KPPVE P   KPPVE  KPPV  P   KPPV   KPPV  P 
Sbjct: 187 PKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPF 246

Query: 335 VYKPPVEKPPVYKPPVEKP-PVYKPP 409
             KPPVE P   KPPVE P P   PP
Sbjct: 247 PPKPPVEPPVPPKPPVEPPKPTAVPP 272

 Score =  118 bits (296), Expect = 2e-25
 Identities = 82/145 (56%), Positives = 82/145 (56%), Gaps = 11/145 (7%)
 Frame = +2

Query: 5   VEKPPVYKPPVE--KPPEYTPPIYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVY--KP 166
           VE P   KPPVE  KPP   P   KPPVE P   KPPVE  KPPV  P   KPPV   KP
Sbjct: 137 VEPPVPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKP 196

Query: 167 PVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPP 334
           PV  P   KPPVE P   KPPVE  KPPV  P   KPPV   KPPV  P   KPPVE P 
Sbjct: 197 PVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPV 256

Query: 335 VYKPPVEKP-PVYKPPVEKPPVYKP 406
             KPPVE P P   PP  KPPV  P
Sbjct: 257 PPKPPVEPPKPTAVPP--KPPVVPP 279

 Score =  117 bits (292), Expect = 5e-25
 Identities = 93/162 (57%), Positives = 94/162 (58%), Gaps = 34/162 (20%)
 Frame = +2

Query: 26  KPPVEKP-PEYTPPIYKPPVEKPPVYKPPVE--KPPVY--KPPVE--KPPVY--KPPVE- 175
           KPPV+ P P   PP  KP V  P   KPPVE  KPPV   KPPVE  KPPV   KPPVE 
Sbjct: 61  KPPVDPPKPTVEPP--KPTVAPP---KPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEP 115

Query: 176 -KPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY-----KPPVEKPPVYKPPVE 325
            KPPV   KPPVE P   KPPVE P   KPPVE  KPPV      KPPVE P   KPPVE
Sbjct: 116 PKPPVEPPKPPVEPPKPPKPPVEPPVPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVE 175

Query: 326 --KPPVY-----KPPVE--KPPVY-----KPPVEKPPVYKPP 409
             KPPV      KPPVE  KPPV      KPPVE P   KPP
Sbjct: 176 PPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPP 217

 Score =  109 bits (273), Expect = 8e-23
 Identities = 75/137 (54%), Positives = 75/137 (54%), Gaps = 3/137 (2%)
 Frame = +2

Query: 5   VEKPPVYKPPVE--KPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           VE P   KPPVE  KPP   P   KPPVE P   KPPV  P   KPPVE P   KPPVE 
Sbjct: 164 VEPPAPPKPPVEPPKPPVVPPFPPKPPVEPP---KPPVVPPFPPKPPVEPPAPPKPPVEP 220

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVE 355
           P   KPPV  P   KPPVE P   KPPV  P   KPPVE P   KPPVE P P   PP  
Sbjct: 221 P---KPPVVPPFPPKPPVEPP---KPPVVPPFPPKPPVEPPVPPKPPVEPPKPTAVPP-- 272

Query: 356 KPPVYKPPVEKPPVYKP 406
           KPPV  P   KP V  P
Sbjct: 273 KPPVVPPLPPKPTVVPP 289

 Score =  108 bits (269), Expect = 2e-22
 Identities = 76/145 (52%), Positives = 81/145 (55%), Gaps = 12/145 (8%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           +P +  P    PP+ T    KPPV+ P P  +PP       KPPVE P   KPPVE P  
Sbjct: 41  QPTILPPWPPVPPQPTDLPTKPPVDPPKPTVEPPKPTVAPPKPPVEPP---KPPVEPP-- 95

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE 355
            KPPVE P   KPPVE P   KPPVE  KPPV   KPPVE P   KPPVE P   KPPVE
Sbjct: 96  -KPPVEPP---KPPVEPP---KPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPPVE 148

Query: 356 --KPPVY-----KPPVEKPPVYKPP 409
             KPPV      KPPVE P   KPP
Sbjct: 149 PPKPPVVPPFPPKPPVEPPAPPKPP 173

 Score =  103 bits (258), Expect = 5e-21
 Identities = 77/148 (52%), Positives = 77/148 (52%), Gaps = 16/148 (10%)
 Frame = +2

Query: 11  KPPVY-----KPPVEKP-PEYTPPI-YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVY- 160
           KPPV      KPPVE P P   PP   KPPVE P   KPPVE  KPPV  P   KPPV  
Sbjct: 178 KPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEP 237

Query: 161 -KPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVY--KPPVEK 328
            KPPV  P   KPPVE P   KPPVE P P   PP  KPPV  P   KP V   KPPV  
Sbjct: 238 PKPPVVPPFPPKPPVEPPVPPKPPVEPPKPTAVPP--KPPVVPPLPPKPTVVPPKPPVVP 295

Query: 329 PPVYKPP--VEKPPVYKPPVEKPPVYKP 406
           P   KP     KPPV  P   KP V  P
Sbjct: 296 PAPPKPTDVPPKPPVVPPAPPKPTVVPP 323

 Score =  100 bits (249), Expect = 5e-20
 Identities = 73/141 (51%), Positives = 74/141 (52%), Gaps = 9/141 (6%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE--KPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEK 178
           KPPV  P   KPP   P   KPPVE  KPPV  P   KPPV   KPPV  P   KPPVE 
Sbjct: 195 KPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEP 254

Query: 179 PPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPP 349
           P   KPPVE P P   PP  KPPV  P   KP V   KPPV  PP    P + PP  KPP
Sbjct: 255 PVPPKPPVEPPKPTAVPP--KPPVVPPLPPKPTVVPPKPPV-VPPAPPKPTDVPP--KPP 309

Query: 350 VEKPPVYKPPV--EKPPVYKP 406
           V  P   KP V   KPPV  P
Sbjct: 310 VVPPAPPKPTVVPPKPPVVPP 330

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 76/152 (50%), Positives = 76/152 (50%), Gaps = 18/152 (11%)
 Frame = +2

Query: 5   VEKPPVYKPPVE--KPPEYTPPIYKPPVE--KPPVY-----KPPVEKPPVYKPPVEKP-P 154
           VE P   KPPVE  KPP   P   KPPVE  KPPV      KPPVE P   KPPVE P P
Sbjct: 208 VEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPVPPKPPVEPPKP 267

Query: 155 VYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPP--VEKPPVYKPPVEKPPVY--KP 316
              PP  KPPV  P   KP V   KPPV  P   KP     KPPV  P   KP V   KP
Sbjct: 268 TAVPP--KPPVVPPLPPKPTVVPPKPPVVPPAPPKPTDVPPKPPVVPPAPPKPTVVPPKP 325

Query: 317 PVEKPPVYKPPV--EKPPVYKPPVEKPPVYKP 406
           PV  P   KP V   KPPV  P   KP V  P
Sbjct: 326 PVVPPAPPKPTVAPPKPPVVPPAPPKPTVVPP 357

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 82/162 (50%), Positives = 84/162 (51%), Gaps = 32/162 (19%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY---------K 163
           P    PV   P   PP        PPV   P + P   KPPV+  KP V          K
Sbjct: 32  PTLVIPVPGQPTILPPW-------PPVPPQPTDLPT--KPPVDPPKPTVEPPKPTVAPPK 82

Query: 164 PPVE--KPPVY--KPPVE--KPPVY--KPPVE--KPPVY--KPPVEKPPVYKPPVEKPPV 307
           PPVE  KPPV   KPPVE  KPPV   KPPVE  KPPV   KPPVE P   KPPVE P  
Sbjct: 83  PPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVP 142

Query: 308 YKPPVE--KPPVY-----KPPVEKPPVYKPPVE--KPPVYKP 406
            KPPVE  KPPV      KPPVE P   KPPVE  KPPV  P
Sbjct: 143 PKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPP 184

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 74/148 (50%), Positives = 75/148 (50%), Gaps = 16/148 (10%)
 Frame = +2

Query: 11  KPPVY-----KPPVE--KPPEYTPPIYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKP 166
           KPPV      KPPVE  KPP   P   KPPVE P   KPPVE P P   PP  KPPV  P
Sbjct: 222 KPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPVPPKPPVEPPKPTAVPP--KPPVVPP 279

Query: 167 PVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPP 334
              KP V   KPPV  PP    P + PP  KPPV  P   KP V   KPPV  P   KP 
Sbjct: 280 LPPKPTVVPPKPPV-VPPAPPKPTDVPP--KPPVVPPAPPKPTVVPPKPPVVPPAPPKPT 336

Query: 335 VY--KPPVEKPPVYKPPV--EKPPVYKP 406
           V   KPPV  P   KP V   KPPV  P
Sbjct: 337 VAPPKPPVVPPAPPKPTVVPPKPPVVPP 364

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 72/163 (44%), Positives = 72/163 (44%), Gaps = 31/163 (19%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE---------KPPVYKPPVEKPPVY--KPPV----- 142
           KPPV  P   KPP   P   KPPVE         KPPV  P   KP V   KPPV     
Sbjct: 239 KPPVVPPFPPKPPVEPPVPPKPPVEPPKPTAVPPKPPVVPPLPPKPTVVPPKPPVVPPAP 298

Query: 143 -------EKPPVYKPPVEKPPVY--KPPVEKPPVYKPPV--EKPPVYKPPVEKPPVY--K 283
                   KPPV  P   KP V   KPPV  P   KP V   KPPV  P   KP V   K
Sbjct: 299 PKPTDVPPKPPVVPPAPPKPTVVPPKPPVVPPAPPKPTVAPPKPPVVPPAPPKPTVVPPK 358

Query: 284 PPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           PPV  P   KP V   KPPV  P   KP V  P   KPPV  P
Sbjct: 359 PPVVPPAPPKPTVAPPKPPVVPPAPPKPTVVPPSPPKPPVVPP 401

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 61/134 (45%), Positives = 62/134 (46%), Gaps = 2/134 (1%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPP 184
           KPPV  P   KP +  P   KPPV  P   KP V   KPPV  P   KP V  P   KPP
Sbjct: 290 KPPVVPPAPPKPTDVPP---KPPVVPPAPPKPTVVPPKPPVVPPAPPKPTVAPP---KPP 343

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V  P   KP V  P   KPPV  P   KP V  P   KPPV  P   KP V  P   KPP
Sbjct: 344 VVPPAPPKPTVVPP---KPPVVPPAPPKPTVAPP---KPPVVPPAPPKPTVVPPSPPKPP 397

Query: 365 VYKPPVEKPPVYKP 406
           V  P   KP V  P
Sbjct: 398 VVPPFPPKPTVVPP 411

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 55/119 (46%), Positives = 55/119 (46%), Gaps = 2/119 (1%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPP 184
           KPPV  PP    P   PP  KPPV  P   KP V   KPPV  P   KP V  P   KPP
Sbjct: 307 KPPVV-PPAPPKPTVVPP--KPPVVPPAPPKPTVAPPKPPVVPPAPPKPTVVPP---KPP 360

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           V  P   KP V  P   KPPV  P   KP V  P   KPPV  PP    P   PP  KP
Sbjct: 361 VVPPAPPKPTVAPP---KPPVVPPAPPKPTVVPPSPPKPPVV-PPFPPKPTVVPPKPKP 415

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 60/119 (50%), Positives = 62/119 (52%), Gaps = 23/119 (19%)
 Frame = +2

Query: 122 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY---------KPPVE- 265
           P    PV   P   PP   PPV   P + P   KPPV+  KP V          KPPVE 
Sbjct: 32  PTLVIPVPGQPTILPPW--PPVPPQPTDLPT--KPPVDPPKPTVEPPKPTVAPPKPPVEP 87

Query: 266 -KPPVY--KPPVE--KPPVY--KPPVE--KPPVY--KPPVEKPPVYKPPVEKPPVYKPP 409
            KPPV   KPPVE  KPPV   KPPVE  KPPV   KPPVE P   KPPVE P   KPP
Sbjct: 88  PKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPP 146

[70][TOP]
>UniRef100_B9RUF0 Extensin, proline-rich protein, putative n=1 Tax=Ricinus communis
           RepID=B9RUF0_RICCO
          Length = 234

 Score =  127 bits (319), Expect = 4e-28
 Identities = 72/133 (54%), Positives = 76/133 (57%), Gaps = 6/133 (4%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKP-PVYKPPVEK-PPVYKPPVEKPPVYKPP---VEKP 181
           PV  PPV KP   TPP+YKPP     PV KPP    PPV KPP   PPVYKPP   V KP
Sbjct: 43  PVPAPPVVKPTPTTPPVYKPPATPTTPVVKPPTSPAPPVVKPPTPSPPVYKPPTTPVIKP 102

Query: 182 PVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           P    PV KPP V  PPV KPP Y PPV KPP   PPV KP    P    PP++KPP   
Sbjct: 103 PNAPSPVVKPPTVPAPPVVKPPTYSPPVAKPPTPAPPVVKP----PSTPAPPMFKPPTPL 158

Query: 359 PPVYKPPVEKPPV 397
           PP    P+  PPV
Sbjct: 159 PPPSGTPL--PPV 169

 Score =  124 bits (311), Expect = 3e-27
 Identities = 66/115 (57%), Positives = 68/115 (59%), Gaps = 4/115 (3%)
 Frame = +2

Query: 77  PVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVY 250
           PV  PPV KP    PPVYKPP     PV KPP    PPV KPP   PPVYKPP    PV 
Sbjct: 43  PVPAPPVVKPTPTTPPVYKPPATPTTPVVKPPTSPAPPVVKPPTPSPPVYKPPTT--PVI 100

Query: 251 KPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP 409
           KPP    PV KPP V  PPV KPP   PPV KPP   PPV KPP    PP++KPP
Sbjct: 101 KPPNAPSPVVKPPTVPAPPVVKPPTYSPPVAKPPTPAPPVVKPPSTPAPPMFKPP 155

 Score =  113 bits (282), Expect = 8e-24
 Identities = 61/117 (52%), Positives = 66/117 (56%), Gaps = 9/117 (7%)
 Frame = +2

Query: 14  PPVYKPP-------VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP- 169
           PPVYKPP       V+ P    PP+ KPP   PPVYKPP    PV KPP    PV KPP 
Sbjct: 57  PPVYKPPATPTTPVVKPPTSPAPPVVKPPTPSPPVYKPPTT--PVIKPPNAPSPVVKPPT 114

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPV 337
           V  PPV KPP   PPV KPP   PPV KPP    PP++KPP   PP    P+  PPV
Sbjct: 115 VPAPPVVKPPTYSPPVAKPPTPAPPVVKPPSTPAPPMFKPPTPLPPPSGTPL--PPV 169

 Score =  101 bits (252), Expect = 2e-20
 Identities = 56/104 (53%), Positives = 61/104 (58%), Gaps = 3/104 (2%)
 Frame = +2

Query: 5   VEKPPVYK-PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEK 178
           V KPP    PPV KPP  +PP+YKPP    PV KPP    PV KPP V  PPV KPP   
Sbjct: 70  VVKPPTSPAPPVVKPPTPSPPVYKPPT--TPVIKPPNAPSPVVKPPTVPAPPVVKPPTYS 127

Query: 179 PPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPV 307
           PPV KPP   PPV KPP    PP++KPP   PP    P+  PPV
Sbjct: 128 PPVAKPPTPAPPVVKPPSTPAPPMFKPPTPLPPPSGTPL--PPV 169

[71][TOP]
>UniRef100_Q39949 Hydroxyproline-rich protein n=1 Tax=Helianthus annuus
           RepID=Q39949_HELAN
          Length = 263

 Score =  125 bits (315), Expect = 1e-27
 Identities = 93/173 (53%), Positives = 101/173 (58%), Gaps = 41/173 (23%)
 Frame = +2

Query: 14  PPVYK---PPVEKPPEYTPPIYK---PPVEK---PPVYK--PPVEKPPVYKPPVEKPPVY 160
           PPVYK   PPV K P   PP++K   PPV K   PPVYK  PP +KP VYK P   PPV+
Sbjct: 60  PPVYKSPPPPVYKSPP--PPVHKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVH 117

Query: 161 K---PPVEK---PPVYK---PPVEK---PPVYK---PPVEK---PPVYK--PPVEKPPVY 280
           K   PPV K   PPVY+   PPV K   PPVYK   PPV K   PPVYK  PP +KP VY
Sbjct: 118 KSPPPPVYKSPPPPVYESPPPPVYKSPPPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYVY 177

Query: 281 KPPVEKPPVYKPPVEKPPVYK---PPVEKP---PVYKPPV----EKPPVYKPP 409
           K P   PPV+K P   PPVYK   PPV K    PVYK P+      PPVYK P
Sbjct: 178 KSPPPPPPVHKSP--PPPVYKSPTPPVHKSPPHPVYKSPLPVHKSPPPVYKSP 228

 Score =  122 bits (305), Expect = 2e-26
 Identities = 85/157 (54%), Positives = 92/157 (58%), Gaps = 25/157 (15%)
 Frame = +2

Query: 14  PPVYK--PPVEKPPEYTPPIYKPPVEK---PPVYKPPVEKPPVYK---PPVEK---PPVY 160
           PPVYK  PP +KP  Y  P   PPV K   PPVYK P   PPVY+   PPV K   PPVY
Sbjct: 92  PPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSP--PPPVYESPPPPVYKSPPPPVY 149

Query: 161 K---PPVEK---PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 316
           K   PPV K   PPVYK  PP +KP VYK P   PPV+K P   PPVYK P   PPV+K 
Sbjct: 150 KSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSP--PPPVYKSPT--PPVHKS 205

Query: 317 PVEKPPVYKPPV----EKPPVYK--PPVEKPPVYKPP 409
           P    PVYK P+      PPVYK  PP +KP VYK P
Sbjct: 206 PPH--PVYKSPLPVHKSPPPVYKSPPPPKKPYVYKSP 240

 Score =  120 bits (302), Expect = 4e-26
 Identities = 86/166 (51%), Positives = 94/166 (56%), Gaps = 34/166 (20%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT------PPIYKPPVEKPPVYKPPVEKPPVYK---PPVEK---PPV 157
           PP   PP     +Y       PP+YK P   PPVYK P   PPV+K   PPV K   PPV
Sbjct: 39  PPKKSPPPPPKQQYVYKSPPPPPVYKSP--PPPVYKSP--PPPVHKSPPPPVHKSPPPPV 94

Query: 158 YK--PPVEKPPVYKPPVEKPPVYK---PPVEK---PPVYK---PPVEK---PPVYK---P 286
           YK  PP +KP VYK P   PPV+K   PPV K   PPVY+   PPV K   PPVYK   P
Sbjct: 95  YKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPPPPVYESPPPPVYKSPPPPVYKSPPP 154

Query: 287 PVEK---PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PV K   PPVYK  PP +KP VYK P   PPV+K P   PPVYK P
Sbjct: 155 PVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSP--PPPVYKSP 198

 Score =  119 bits (297), Expect = 1e-25
 Identities = 85/164 (51%), Positives = 94/164 (57%), Gaps = 35/164 (21%)
 Frame = +2

Query: 23  YKPPVEKPPEYTPP-------IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPV 172
           Y  P   PP+ +PP       +YK P   PPVYK P   PPVYK P   PPV+K   PPV
Sbjct: 32  YSSPPPPPPKKSPPPPPKQQYVYKSP-PPPPVYKSP--PPPVYKSP--PPPVHKSPPPPV 86

Query: 173 EK---PPVYK--PPVEKPPVYKPPVEKPPVYK---PPVEK---PPVYK---PPVEK---P 301
            K   PPVYK  PP +KP VYK P   PPV+K   PPV K   PPVY+   PPV K   P
Sbjct: 87  HKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPPPPVYESPPPPVYKSPPP 146

Query: 302 PVYK---PPVEK---PPVYK--PPVEKPPVYKPPVEKPPVYKPP 409
           PVYK   PPV K   PPVYK  PP +KP VYK P   PPV+K P
Sbjct: 147 PVYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSP 190

 Score =  110 bits (274), Expect = 6e-23
 Identities = 82/149 (55%), Positives = 88/149 (59%), Gaps = 20/149 (13%)
 Frame = +2

Query: 14  PPVYK---PPV-EKPPEYTPPIYKPPVEKPPVYK---PPVEK---PPVYK--PPVEKPPV 157
           PPVYK   PPV E PP   PP+YK P   PPVYK   PPV K   PPVYK  PP +KP V
Sbjct: 122 PPVYKSPPPPVYESPP---PPVYKSP--PPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYV 176

Query: 158 YKPPVEKPPVYKPPVEKPPVYK---PPVEKP---PVYKPPVEKPPVYKPPVEKPPVYK-- 313
           YK P   PPV+K P   PPVYK   PPV K    PVYK P+   PV+K P   PPVYK  
Sbjct: 177 YKSPPPPPPVHKSP--PPPVYKSPTPPVHKSPPHPVYKSPL---PVHKSP---PPVYKSP 228

Query: 314 PPVEKPPVYKPPVEKPPVYKPPVEKPPVY 400
           PP +KP VYK P   PPV K P   PP Y
Sbjct: 229 PPPKKPYVYKSP--PPPVKKHP---PPHY 252

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 62/123 (50%), Positives = 69/123 (56%), Gaps = 4/123 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PPVYK P   PP   P +YK P   PPV+K P   PPVYK P   PPV+K P    PVYK
Sbjct: 162 PPVYKSP---PPPKKPYVYKSPPPPPPVHKSP--PPPVYKSPT--PPVHKSPPH--PVYK 212

Query: 194 PPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKP 361
            P+   PV+K P   PPVYK  PP +KP VYK P   PPV K P   PP  +Y  P   P
Sbjct: 213 SPL---PVHKSP---PPVYKSPPPPKKPYVYKSP--PPPVKKHP---PPHYIYSSP---P 258

Query: 362 PVY 370
           P Y
Sbjct: 259 PPY 261

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 51/111 (45%), Positives = 59/111 (53%), Gaps = 10/111 (9%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYT---PPIYK---PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           +KP VYK P   PP +    PP+YK   PPV K P +       PVYK P+   PV+K P
Sbjct: 172 KKPYVYKSPPPPPPVHKSPPPPVYKSPTPPVHKSPPH-------PVYKSPL---PVHKSP 221

Query: 170 VEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVY 310
              PPVYK  PP +KP VYK P   PPV K P   PP  +Y  P   PP Y
Sbjct: 222 ---PPVYKSPPPPKKPYVYKSP--PPPVKKHP---PPHYIYSSP---PPPY 261

[72][TOP]
>UniRef100_Q39353 Cell wall-plasma membrane linker protein n=1 Tax=Brassica napus
           RepID=Q39353_BRANA
          Length = 376

 Score =  125 bits (314), Expect = 1e-27
 Identities = 66/133 (49%), Positives = 67/133 (50%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP +KPP   PP    P   PPV  PP   PP   PPV  PP   PPV  PP   PPV 
Sbjct: 160 KPPTHKPPTVCPPPTPTPT--PPVVTPPT--PPTPTPPVVTPPTPAPPVVTPPTPTPPVV 215

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV 
Sbjct: 216 TPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PPVV 269

Query: 371 KPPVEKPPVYKPP 409
            PP   PPV  PP
Sbjct: 270 TPPTPTPPVVTPP 282

 Score =  124 bits (312), Expect = 3e-27
 Identities = 68/139 (48%), Positives = 69/139 (49%), Gaps = 6/139 (4%)
 Frame = +2

Query: 11  KPPVYKPPVEKP-PEYTPPIYKPP--VEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPV 172
           KPP  KPP   P P   PP  KPP    KPP +KPP   P   P   PPV  PP   PP 
Sbjct: 132 KPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTHKPPTVCPPPTPTPTPPVVTPPT--PPT 189

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
             PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP 
Sbjct: 190 PTPPVVTPPTPAPPVVTPPTPTPPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPT 247

Query: 353 EKPPVYKPPVEKPPVYKPP 409
             PPV  PP   PPV  PP
Sbjct: 248 --PPVVTPPTPTPPVVTPP 264

 Score =  122 bits (306), Expect = 1e-26
 Identities = 69/151 (45%), Positives = 71/151 (47%), Gaps = 16/151 (10%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKP-PEYTPPIYKPPVEKP-PVYKPPVEKPPVYKP-PVEKPPVYKPP-- 169
           + KPP  KPP   P P   PP  KPP   P P  KPP  KPP   P P  KPP  KPP  
Sbjct: 98  IPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPS 157

Query: 170 VEKPPVYKPPVEKPPVY-----------KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 316
             KPP +KPP   PP              PP   PPV  PP   PPV  PP   PPV  P
Sbjct: 158 TPKPPTHKPPTVCPPPTPTPTPPVVTPPTPPTPTPPVVTPPTPAPPVVTPPTPTPPVVTP 217

Query: 317 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           P   PPV  PP   PPV  PP   PPV  PP
Sbjct: 218 PTPTPPVVTPPT--PPVVTPPTPTPPVVTPP 246

 Score =  120 bits (300), Expect = 6e-26
 Identities = 71/152 (46%), Positives = 73/152 (48%), Gaps = 19/152 (12%)
 Frame = +2

Query: 11  KPPVYKP-PVEKPPEYTPPIYKPPVEKPPVYKP-PVEKPPVYKPPVE------KPPVYKP 166
           KPP  +P P  KPP    PI KPP  KPP   P P  KPP  KPP        KPP  KP
Sbjct: 79  KPPTVRPHPHPKPPTKPHPIPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKP 138

Query: 167 PVE------KPPVYKPP--VEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPVEKPPVYK 313
           P        KPP  KPP    KPP +KPP   P   P   PPV  PP   PP   PPV  
Sbjct: 139 PPSTPKPPTKPPTVKPPPSTPKPPTHKPPTVCPPPTPTPTPPVVTPPT--PPTPTPPVVT 196

Query: 314 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PP   PPV  PP   PPV  PP   PPV  PP
Sbjct: 197 PPTPAPPVVTPPTPTPPVVTPPTPTPPVVTPP 228

 Score =  117 bits (292), Expect = 5e-25
 Identities = 59/117 (50%), Positives = 60/117 (51%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PPV  PP   PP  TPP+  PP   PPV  PP   PPV  PP   PPV  PP   PPV  
Sbjct: 179 PPVVTPPT--PPTPTPPVVTPPTPAPPVVTPPTPTPPVVTPPTPTPPVVTPPT--PPVVT 234

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 235 PPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPTPTPP 287

 Score =  113 bits (283), Expect = 6e-24
 Identities = 70/144 (48%), Positives = 75/144 (52%), Gaps = 12/144 (8%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVY 190
           PP   P   KPP++     KPP  KPP  KPP  KPP  KPP  KPP  KP P  KPP  
Sbjct: 29  PPKPSPRPHKPPKHPVKPPKPPAAKPP--KPPAVKPP--KPPT-KPPTLKPHPHPKPPTV 83

Query: 191 KP-PVEKPPVYKPPVEKPPVYKPPVE------KPPVYKPPVEKP-PVYKPPVEKPPVYKP 346
           +P P  KPP    P+ KPP  KPP        KPP  KPP   P P  KPP  KPP   P
Sbjct: 84  RPHPHPKPPTKPHPIPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTP 143

Query: 347 -PVEKPPVYKPP--VEKPPVYKPP 409
            P  KPP  KPP    KPP +KPP
Sbjct: 144 KPPTKPPTVKPPPSTPKPPTHKPP 167

 Score =  111 bits (278), Expect = 2e-23
 Identities = 71/138 (51%), Positives = 75/138 (54%), Gaps = 5/138 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKPP 184
           KPP  KPP  KPP+  PP  KPP  KPP  KPP  KP P  KPP  +P P  KPP +  P
Sbjct: 45  KPP--KPPAAKPPK--PPAVKPP--KPPT-KPPTLKPHPHPKPPTVRPHPHPKPPTKPHP 97

Query: 185 VYKPPVEKPPVYKP-PVEKPPVYKPPVEKP-PVYKPPVEKPPVYKP-PVEKPPVYKPPVE 355
           + KPP  KPP   P P  KPP  KPP   P P  KPP  KPP   P P  KPP  KPP  
Sbjct: 98  IPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPS 157

Query: 356 KPPVYKPPVEKPPVYKPP 409
            P   KPP  KPP   PP
Sbjct: 158 TP---KPPTHKPPTVCPP 172

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 50/100 (50%), Positives = 51/100 (51%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP   PPV  PP  TPP+  PP   PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 194 VVTPPTPAPPVVTPPTPTPPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PP 249

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 304
           V  PP   PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 250 VVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPTPTPP 287

[73][TOP]
>UniRef100_Q8LBI7 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8LBI7_ARATH
          Length = 275

 Score =  125 bits (313), Expect = 2e-27
 Identities = 72/140 (51%), Positives = 79/140 (56%), Gaps = 8/140 (5%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP  KPPV+ P     P+ KPPV  PP+  PPV+ PP YKPP    P  KPP  +PP Y
Sbjct: 70  KPPTTKPPVKPPTTSVTPV-KPPVSTPPIKLPPVQ-PPTYKPPT---PTVKPPSVQPPTY 124

Query: 191 KPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPV 352
           KPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV KPP   PPV
Sbjct: 125 KPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPV 182

Query: 353 EKPPVYKPPVE--KPPVYKP 406
           + PP Y PP    KPP   P
Sbjct: 183 Q-PPTYNPPTTPVKPPTAPP 201

 Score =  124 bits (311), Expect = 3e-27
 Identities = 73/145 (50%), Positives = 79/145 (54%), Gaps = 12/145 (8%)
 Frame = +2

Query: 11  KPPV--YKPPVEKPPEYTPPIYKPPVEKPPV----YKPPVEKPPVYKPPVEKPPVYKPPV 172
           KPP   YKPP        PP  KPPV+ P       KPPV  PP+  PPV+ PP YKPP 
Sbjct: 53  KPPTPSYKPPTLPTTPIKPPTTKPPVKPPTTSVTPVKPPVSTPPIKLPPVQ-PPTYKPPT 111

Query: 173 EKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPP 334
              P  KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP
Sbjct: 112 ---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPP 167

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKPP 409
              PPV KPP   PPV+ PP Y PP
Sbjct: 168 TTTPPV-KPPTTTPPVQ-PPTYNPP 190

 Score =  112 bits (280), Expect = 1e-23
 Identities = 65/130 (50%), Positives = 69/130 (53%), Gaps = 4/130 (3%)
 Frame = +2

Query: 32  PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 211
           P  KPP    P  KPP    P YKPP       KPP  KPPV KPP       KPPV  P
Sbjct: 43  PATKPPS---PALKPPT---PSYKPPTLPTTPIKPPTTKPPV-KPPTTSVTPVKPPVSTP 95

Query: 212 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPP 379
           P+  PPV+ PP YKPP    P  KPP  +PP YKPP    KPP   P  P   PPV  PP
Sbjct: 96  PIKLPPVQ-PPTYKPPT---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPP 151

Query: 380 VEKPPVYKPP 409
           V+ PP YKPP
Sbjct: 152 VQ-PPTYKPP 160

 Score =  107 bits (268), Expect = 3e-22
 Identities = 69/138 (50%), Positives = 74/138 (53%), Gaps = 4/138 (2%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP+  PPV+      PP YKPP    P  KPP  +PP YKPP    P  KPP   P 
Sbjct: 92  VSTPPIKLPPVQ------PPTYKPPT---PTVKPPSVQPPTYKPPT---PTVKPPTTSP- 138

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE- 355
             KPP   PPV  PPV+ PP YKPP    KPP   PPV KPP   PPV+ PP Y PP   
Sbjct: 139 -VKPPT-TPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTP 193

Query: 356 -KPPVYKPPVEKPPVYKP 406
            KPP   PPV KPP   P
Sbjct: 194 VKPPT-APPV-KPPTPPP 209

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 61/114 (53%), Positives = 64/114 (56%), Gaps = 10/114 (8%)
 Frame = +2

Query: 11  KPPVYKPPVE--KPPEYTPPIYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPV 172
           +PP YKPP    KPP   PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP 
Sbjct: 103 QPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPT 161

Query: 173 E--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPV 322
              KPP   PPV KPP   PPV+ PP Y PP    KPP   PPV KPP   PPV
Sbjct: 162 SPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPV-KPPT-PPPV 210

[74][TOP]
>UniRef100_A3VGH7 Putative uncharacterized protein n=1 Tax=Rhodobacterales bacterium
            HTCC2654 RepID=A3VGH7_9RHOB
          Length = 7434

 Score =  124 bits (312), Expect = 2e-27
 Identities = 80/136 (58%), Positives = 81/136 (59%)
 Frame = -1

Query: 411  TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
            TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  
Sbjct: 7190 TGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGD 7249

Query: 231  TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
            TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  
Sbjct: 7250 TGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGD 7309

Query: 51   SGGFSTGGLYTGGFST 4
            +GG  TGG  TGG  T
Sbjct: 7310 TGGGDTGGGDTGGGDT 7325

 Score =  124 bits (312), Expect = 2e-27
 Identities = 80/136 (58%), Positives = 81/136 (59%)
 Frame = -1

Query: 411  TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
            TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  
Sbjct: 7195 TGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGD 7254

Query: 231  TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
            TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  
Sbjct: 7255 TGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGD 7314

Query: 51   SGGFSTGGLYTGGFST 4
            +GG  TGG  TGG  T
Sbjct: 7315 TGGGDTGGGDTGGGDT 7330

 Score =  124 bits (312), Expect = 2e-27
 Identities = 80/136 (58%), Positives = 81/136 (59%)
 Frame = -1

Query: 411  TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
            TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  
Sbjct: 7200 TGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGD 7259

Query: 231  TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
            TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  
Sbjct: 7260 TGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGD 7319

Query: 51   SGGFSTGGLYTGGFST 4
            +GG  TGG  TGG  T
Sbjct: 7320 TGGGDTGGGDTGGGDT 7335

 Score =  124 bits (312), Expect = 2e-27
 Identities = 80/136 (58%), Positives = 81/136 (59%)
 Frame = -1

Query: 411  TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
            TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  
Sbjct: 7205 TGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGD 7264

Query: 231  TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
            TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  
Sbjct: 7265 TGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGD 7324

Query: 51   SGGFSTGGLYTGGFST 4
            +GG  TGG  TGG  T
Sbjct: 7325 TGGGDTGGGDTGGGDT 7340

 Score =  124 bits (312), Expect = 2e-27
 Identities = 80/136 (58%), Positives = 81/136 (59%)
 Frame = -1

Query: 411  TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
            TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  
Sbjct: 7210 TGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGD 7269

Query: 231  TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
            TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  
Sbjct: 7270 TGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGD 7329

Query: 51   SGGFSTGGLYTGGFST 4
            +GG  TGG  TGG  T
Sbjct: 7330 TGGGDTGGGDTGGRDT 7345

 Score =  117 bits (292), Expect = 5e-25
 Identities = 75/129 (58%), Positives = 76/129 (58%)
 Frame = -1

Query: 390  GFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTG 211
            G  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TG
Sbjct: 7187 GGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTG 7246

Query: 210  GFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVYSGGFSTG 31
            G  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  +GG  TG
Sbjct: 7247 GGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTG 7306

Query: 30   GLYTGGFST 4
            G  TGG  T
Sbjct: 7307 GGDTGGGDT 7315

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 65/118 (55%), Positives = 67/118 (56%)
 Frame = -1

Query: 357  FSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 178
            F+  G    G  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7178 FNVFGPDGDGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7237

Query: 177  FSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVYSGGFSTGGLYTGGFST 4
              TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  +GG  TGG  TGG  T
Sbjct: 7238 GDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7295

[75][TOP]
>UniRef100_Q39614 Cuscuta reflexa proline-rich protein n=1 Tax=Cuscuta reflexa
           RepID=Q39614_CUSRE
          Length = 329

 Score =  124 bits (312), Expect = 3e-27
 Identities = 71/146 (48%), Positives = 85/146 (58%), Gaps = 13/146 (8%)
 Frame = +2

Query: 11  KPPVY-KPPVEKPPEYTP--PIYKPPVEKPPVYKPPV--EKPPVYKPPVEKPP-VYKPPV 172
           KPP + KPP  KPP   P  P+Y P V  PPV  PP     PP+  PPV KPP + +PPV
Sbjct: 65  KPPHFPKPPTVKPPHLPPKPPVYPPHVPNPPVVTPPTVPRLPPIVTPPVVKPPPIVEPPV 124

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPP-VYKPPVE-KPPVY 340
             PP + PP  +PPVY P +  PPV  PP   + PP+  PPV KPP + +PPV   PPV 
Sbjct: 125 VIPPPHIPP--QPPVYPPYIPNPPVVTPPTVPKLPPIVTPPVVKPPPIVEPPVVIPPPVV 182

Query: 341 KPPVE---KPPVYKPPVEKPPVYKPP 409
           KPP     +PPVY P +  PPV  PP
Sbjct: 183 KPPPHIQPQPPVYPPYIPNPPVVTPP 208

 Score =  117 bits (293), Expect = 4e-25
 Identities = 68/137 (49%), Positives = 81/137 (59%), Gaps = 8/137 (5%)
 Frame = +2

Query: 23  YKPPVEKPPEYTPPIY-KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYK 193
           + P   KPP   PP + KPP  KPP + PP  KPPVY P V  PPV  PP     PP+  
Sbjct: 54  FPPHFPKPPTVKPPHFPKPPTVKPP-HLPP--KPPVYPPHVPNPPVVTPPTVPRLPPIVT 110

Query: 194 PPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEK-P 361
           PPV K PP+ +PPV  PP + PP  +PPVY P +  PPV  PP   + PP+  PPV K P
Sbjct: 111 PPVVKPPPIVEPPVVIPPPHIPP--QPPVYPPYIPNPPVVTPPTVPKLPPIVTPPVVKPP 168

Query: 362 PVYKPPVE-KPPVYKPP 409
           P+ +PPV   PPV KPP
Sbjct: 169 PIVEPPVVIPPPVVKPP 185

 Score =  103 bits (257), Expect = 6e-21
 Identities = 62/138 (44%), Positives = 75/138 (54%), Gaps = 7/138 (5%)
 Frame = +2

Query: 14  PPVYKPP-VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPP 184
           PPV KPP + +PP   PP + PP  +PPVY P +  PPV  PP   + PP+  PPV KPP
Sbjct: 111 PPVVKPPPIVEPPVVIPPPHIPP--QPPVYPPYIPNPPVVTPPTVPKLPPIVTPPVVKPP 168

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP---VEKPPVYKPP-V 352
              P VE P V  PPV KPP +  P  +PPVY P +  PPV  PP   +    V  PP V
Sbjct: 169 ---PIVEPPVVIPPPVVKPPPHIQP--QPPVYPPYIPNPPVVTPPPIVIPTRQVLPPPYV 223

Query: 353 EKPPVYKPPVEKPPVYKP 406
             PP  + P   PP  +P
Sbjct: 224 PSPPPDEKPCPPPPEKQP 241

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 38/93 (40%), Positives = 45/93 (48%), Gaps = 3/93 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP---VE 175
           V+ PP+ +PPV  P         PPV KPP +  P  +PPVY P +  PPV  PP   + 
Sbjct: 165 VKPPPIVEPPVVIP---------PPVVKPPPHIQP--QPPVYPPYIPNPPVVTPPPIVIP 213

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 274
              V  PP    P   PP EKP    PP EK P
Sbjct: 214 TRQVLPPPYVPSP---PPDEKP--CPPPPEKQP 241

[76][TOP]
>UniRef100_Q9LFR3 Putative uncharacterized protein F2G14_40 n=1 Tax=Arabidopsis
           thaliana RepID=Q9LFR3_ARATH
          Length = 275

 Score =  124 bits (310), Expect = 4e-27
 Identities = 74/146 (50%), Positives = 81/146 (55%), Gaps = 13/146 (8%)
 Frame = +2

Query: 11  KPPV--YKPPVE-----KPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           KPP   YKPP       KPP   PP+  P +   PV KPPV  PP+  PPV+ PP YKPP
Sbjct: 53  KPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPVQ-PPTYKPP 110

Query: 170 VEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KP 331
               P  KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP    KP
Sbjct: 111 T---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKP 166

Query: 332 PVYKPPVEKPPVYKPPVEKPPVYKPP 409
           P   PPV KPP   PPV+ PP Y PP
Sbjct: 167 PTTTPPV-KPPTTTPPVQ-PPTYNPP 190

 Score =  124 bits (310), Expect = 4e-27
 Identities = 72/140 (51%), Positives = 79/140 (56%), Gaps = 8/140 (5%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP  KPPV+ P     P+ KPPV  PP+  PPV+ PP YKPP    P  KPP  +PP Y
Sbjct: 70  KPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPVQ-PPTYKPPT---PTVKPPSVQPPTY 124

Query: 191 KPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPV 352
           KPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV KPP   PPV
Sbjct: 125 KPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPV 182

Query: 353 EKPPVYKPPVE--KPPVYKP 406
           + PP Y PP    KPP   P
Sbjct: 183 Q-PPTYNPPTTPVKPPTAPP 201

 Score =  112 bits (281), Expect = 1e-23
 Identities = 65/130 (50%), Positives = 70/130 (53%), Gaps = 4/130 (3%)
 Frame = +2

Query: 32  PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 211
           P  KPP    P  KPP    P YKPP       KPP  KPPV  P +   PV KPPV  P
Sbjct: 43  PATKPPS---PALKPPT---PSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPV-KPPVSTP 95

Query: 212 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPP 379
           P+  PPV+ PP YKPP    P  KPP  +PP YKPP    KPP   P  P   PPV  PP
Sbjct: 96  PIKLPPVQ-PPTYKPPT---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPP 151

Query: 380 VEKPPVYKPP 409
           V+ PP YKPP
Sbjct: 152 VQ-PPTYKPP 160

 Score =  107 bits (268), Expect = 3e-22
 Identities = 69/138 (50%), Positives = 74/138 (53%), Gaps = 4/138 (2%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP+  PPV+      PP YKPP    P  KPP  +PP YKPP    P  KPP   P 
Sbjct: 92  VSTPPIKLPPVQ------PPTYKPPT---PTVKPPSVQPPTYKPPT---PTVKPPTTSP- 138

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE- 355
             KPP   PPV  PPV+ PP YKPP    KPP   PPV KPP   PPV+ PP Y PP   
Sbjct: 139 -VKPPT-TPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTP 193

Query: 356 -KPPVYKPPVEKPPVYKP 406
            KPP   PPV KPP   P
Sbjct: 194 VKPPT-APPV-KPPTPPP 209

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 61/114 (53%), Positives = 64/114 (56%), Gaps = 10/114 (8%)
 Frame = +2

Query: 11  KPPVYKPPVE--KPPEYTPPIYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPV 172
           +PP YKPP    KPP   PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP 
Sbjct: 103 QPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPT 161

Query: 173 E--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPV 322
              KPP   PPV KPP   PPV+ PP Y PP    KPP   PPV KPP   PPV
Sbjct: 162 SPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPV-KPPT-PPPV 210

[77][TOP]
>UniRef100_Q5DNZ7 Putative proline-rich protein (Fragment) n=1 Tax=Nicotiana tabacum
           RepID=Q5DNZ7_TOBAC
          Length = 195

 Score =  124 bits (310), Expect = 4e-27
 Identities = 59/110 (53%), Positives = 69/110 (62%)
 Frame = +2

Query: 59  PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 238
           PP+ KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 2   PPVVKPPINLPPVV-PPVIKPPIGIPPVTVPPVVKPPINLPPVV-PPVIKPPIGIPPVTV 59

Query: 239 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 388
           PPV KPP+  PP+ KPP+  PP+  PPV  PPV  P  +  P   PP  K
Sbjct: 60  PPVLKPPIGLPPIVKPPINLPPIGIPPVTVPPVITPSPKGKPCPPPPTTK 109

 Score =  122 bits (307), Expect = 1e-26
 Identities = 59/107 (55%), Positives = 68/107 (63%)
 Frame = +2

Query: 89  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 268
           PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 2   PPVVKPPINLPPVV-PPVIKPPIGIPPVTVPPVVKPPINLPPVV-PPVIKPPIGIPPVTV 59

Query: 269 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PPV KPP+  PP+ KPP+  PP+  PPV  PPV  P  +  P   PP
Sbjct: 60  PPVLKPPIGLPPIVKPPINLPPIGIPPVTVPPVITPSPKGKPCPPPP 106

 Score =  120 bits (302), Expect = 4e-26
 Identities = 59/110 (53%), Positives = 68/110 (61%)
 Frame = +2

Query: 29  PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 208
           PPV KPP   PP+  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 2   PPVVKPPINLPPVV-PPVIKPPIGIPPVTVPPVVKPPINLPPVV-PPVIKPPIGIPPVTV 59

Query: 209 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PPV KPP+  PP+ KPP+  PP+  PPV  PPV  P  +  P   PP  K
Sbjct: 60  PPVLKPPIGLPPIVKPPINLPPIGIPPVTVPPVITPSPKGKPCPPPPTTK 109

 Score =  119 bits (297), Expect = 1e-25
 Identities = 60/110 (54%), Positives = 68/110 (61%)
 Frame = +2

Query: 74  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 253
           PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 2   PPVVKPPINLPPVV-PPVIKPPIGIPPVTVPPVVKPPINLPPVV-PPVIKPPIGIPPVTV 59

Query: 254 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
           PPV KPP+  PP+ KPP+  PP+  PPV  PPV  P     P   PP  K
Sbjct: 60  PPVLKPPIGLPPIVKPPINLPPIGIPPVTVPPVITPSPKGKPCPPPPTTK 109

 Score =  114 bits (286), Expect = 3e-24
 Identities = 55/109 (50%), Positives = 65/109 (59%), Gaps = 4/109 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVE----KPPVYKPPVEKP 181
           PPV KPP+  PP   PP+ KPP+  PPV  PPV KPP+  PPV     KPP+  PPV  P
Sbjct: 2   PPVVKPPINLPP-VVPPVIKPPIGIPPVTVPPVVKPPINLPPVVPPVIKPPIGIPPVTVP 60

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
           PV KPP+  PP+ KPP+  PP+  PPV  PPV  P  +  P   PP  K
Sbjct: 61  PVLKPPIGLPPIVKPPINLPPIGIPPVTVPPVITPSPKGKPCPPPPTTK 109

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 42/88 (47%), Positives = 49/88 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PPV KPP+  PP        PPV KPP+  PPV  PPV KPP+  PP+ KPP+  PP
Sbjct: 28  VTVPPVVKPPINLPP------VVPPVIKPPIGIPPVTVPPVLKPPIGLPPIVKPPINLPP 81

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEK 268
           +  PPV  PPV  P  +  P   PP  K
Sbjct: 82  IGIPPVTVPPVITPSPKGKPCPPPPTTK 109

[78][TOP]
>UniRef100_Q2V375 Putative uncharacterized protein At5g14920.2 n=1 Tax=Arabidopsis
           thaliana RepID=Q2V375_ARATH
          Length = 223

 Score =  124 bits (310), Expect = 4e-27
 Identities = 74/146 (50%), Positives = 81/146 (55%), Gaps = 13/146 (8%)
 Frame = +2

Query: 11  KPPV--YKPPVE-----KPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
           KPP   YKPP       KPP   PP+  P +   PV KPPV  PP+  PPV+ PP YKPP
Sbjct: 53  KPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPVQ-PPTYKPP 110

Query: 170 VEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KP 331
               P  KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP    KP
Sbjct: 111 T---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKP 166

Query: 332 PVYKPPVEKPPVYKPPVEKPPVYKPP 409
           P   PPV KPP   PPV+ PP Y PP
Sbjct: 167 PTTTPPV-KPPTTTPPVQ-PPTYNPP 190

 Score =  124 bits (310), Expect = 4e-27
 Identities = 72/140 (51%), Positives = 79/140 (56%), Gaps = 8/140 (5%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KPP  KPPV+ P     P+ KPPV  PP+  PPV+ PP YKPP    P  KPP  +PP Y
Sbjct: 70  KPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPVQ-PPTYKPPT---PTVKPPSVQPPTY 124

Query: 191 KPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPV 352
           KPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV KPP   PPV
Sbjct: 125 KPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPV 182

Query: 353 EKPPVYKPPVE--KPPVYKP 406
           + PP Y PP    KPP   P
Sbjct: 183 Q-PPTYNPPTTPVKPPTAPP 201

 Score =  112 bits (281), Expect = 1e-23
 Identities = 65/130 (50%), Positives = 70/130 (53%), Gaps = 4/130 (3%)
 Frame = +2

Query: 32  PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 211
           P  KPP    P  KPP    P YKPP       KPP  KPPV  P +   PV KPPV  P
Sbjct: 43  PATKPPS---PALKPPT---PSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPV-KPPVSTP 95

Query: 212 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPP 379
           P+  PPV+ PP YKPP    P  KPP  +PP YKPP    KPP   P  P   PPV  PP
Sbjct: 96  PIKLPPVQ-PPTYKPPT---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPP 151

Query: 380 VEKPPVYKPP 409
           V+ PP YKPP
Sbjct: 152 VQ-PPTYKPP 160

 Score =  107 bits (268), Expect = 3e-22
 Identities = 69/138 (50%), Positives = 74/138 (53%), Gaps = 4/138 (2%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP+  PPV+      PP YKPP    P  KPP  +PP YKPP    P  KPP   P 
Sbjct: 92  VSTPPIKLPPVQ------PPTYKPPT---PTVKPPSVQPPTYKPPT---PTVKPPTTSP- 138

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE- 355
             KPP   PPV  PPV+ PP YKPP    KPP   PPV KPP   PPV+ PP Y PP   
Sbjct: 139 -VKPPT-TPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTP 193

Query: 356 -KPPVYKPPVEKPPVYKP 406
            KPP   PPV KPP   P
Sbjct: 194 VKPPT-APPV-KPPTPPP 209

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 61/114 (53%), Positives = 64/114 (56%), Gaps = 10/114 (8%)
 Frame = +2

Query: 11  KPPVYKPPVE--KPPEYTPPIYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPV 172
           +PP YKPP    KPP   PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP 
Sbjct: 103 QPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPT 161

Query: 173 E--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPV 322
              KPP   PPV KPP   PPV+ PP Y PP    KPP   PPV KPP   PPV
Sbjct: 162 SPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPV-KPPT-PPPV 210

[79][TOP]
>UniRef100_Q39835 Extensin n=1 Tax=Glycine max RepID=Q39835_SOYBN
          Length = 432

 Score =  122 bits (306), Expect = 1e-26
 Identities = 77/154 (50%), Positives = 78/154 (50%), Gaps = 22/154 (14%)
 Frame = +2

Query: 14  PPVYK----PPVEKPPEYTPPIYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPP 154
           PPVYK    PP  K P   PP YK P   PPVYK     PPV K    PP YK P   PP
Sbjct: 265 PPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 324

Query: 155 VYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 307
            YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PP 
Sbjct: 325 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYK-SPPPP 383

Query: 308 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           YK P   PP YK P   PPVYK     PPV+ PP
Sbjct: 384 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVHSPP 417

 Score =  120 bits (302), Expect = 4e-26
 Identities = 77/152 (50%), Positives = 77/152 (50%), Gaps = 22/152 (14%)
 Frame = +2

Query: 14  PPVYK----PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           PPVYK    PP  K P   PP YK P   PPVYK     PPVYK     PP YK P   P
Sbjct: 226 PPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK-SPPPPYKYPSPPP 284

Query: 182 PVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PP 319
           P YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PP
Sbjct: 285 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 344

Query: 320 VEK----PPVYKPPVEKPPVYKPPVEKPPVYK 403
           V K    PP YK P   PP YK P   PPVYK
Sbjct: 345 VYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYK 376

 Score =  119 bits (298), Expect = 1e-25
 Identities = 82/171 (47%), Positives = 83/171 (48%), Gaps = 41/171 (23%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKP 151
           PP YK P   PP Y      PP+YK     PPV K    PP YK P   PP YK P   P
Sbjct: 235 PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPP 294

Query: 152 PVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPV 277
           PVYK     PPV K    PP YK P   PP YK P   PPVYK     PPV K    PP 
Sbjct: 295 PVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 354

Query: 278 YKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK 403
           YK P   PP YK     PPV K    PP YK P   PP YK P   PPVYK
Sbjct: 355 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYK 405

 Score =  106 bits (265), Expect = 7e-22
 Identities = 67/142 (47%), Positives = 69/142 (48%), Gaps = 13/142 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT----PPIYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PP 154
           PPVYK     PP Y     PP YK P   PP YK P   PPVYK     PPV K    PP
Sbjct: 294 PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 353

Query: 155 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
            YK P   PP YK P   PPVYK     PP YK P   PP YK P   PPVYK     PP
Sbjct: 354 PYKYPSPPPPPYKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 412

Query: 335 VYKPPVEKPPVYKPPVEKPPVY 400
           V+ PP   PP Y      PP +
Sbjct: 413 VHSPP---PPHYIYASPPPPYH 431

 Score =  104 bits (259), Expect = 4e-21
 Identities = 74/158 (46%), Positives = 77/158 (48%), Gaps = 26/158 (16%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY----TPPIYKPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKPP 169
           PP + PP   PP Y     PP + PP   PP Y     PP +KP  YK P   PPVYK  
Sbjct: 181 PPKHSPP---PPYYYHSPPPPKHSPP---PPYYYKSPPPPPKKP--YKYPSPPPPVYKYK 232

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPV 322
              PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P 
Sbjct: 233 -SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPS 291

Query: 323 EKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPP 409
             PPVYK     PPV K    PP YK P   PP YK P
Sbjct: 292 PPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYP 329

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 69/149 (46%), Positives = 73/149 (48%), Gaps = 19/149 (12%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY----TPPIYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY----K 163
           PP + PP   PP Y     PP + PP   PP Y   PP   PP + PP   PP Y     
Sbjct: 165 PPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYKSPP 212

Query: 164 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK 328
           PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK     PPV K
Sbjct: 213 PPPKKP--YKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 269

Query: 329 ----PPVYKPPVEKPPVYKPPVEKPPVYK 403
               PP YK P   PP YK P   PPVYK
Sbjct: 270 YKSPPPPYKYPSPPPPPYKYPSPPPPVYK 298

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 66/151 (43%), Positives = 73/151 (48%), Gaps = 19/151 (12%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 175
           PP Y      PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 155 PPPYYYHSPPPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 203

Query: 176 KPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 343
            PP Y     PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK
Sbjct: 204 -PPYYYKSPPPPPKKP--YKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYK 259

Query: 344 -----PPVEK----PPVYKPPVEKPPVYKPP 409
                PPV K    PP YK P   PP YK P
Sbjct: 260 YKSPPPPVYKYKSPPPPYKYPSPPPPPYKYP 290

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 64/168 (38%), Positives = 72/168 (42%), Gaps = 38/168 (22%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 175
           PP Y      PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 107 PPPYYYHSPPPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 155

Query: 176 KPPVY--KPPVEKPPVYKPPV------------EKPPVY-----KPPVEKPP---VYK-- 283
            PP Y   PP   PP + PP               PP Y      PP   PP    YK  
Sbjct: 156 -PPYYYHSPP---PPKHSPPPPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPPPPYYYKSP 211

Query: 284 -PPVEKP---PVYKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK 403
            PP +KP   P   PPV K    PP YK P   PP YK P   PPVYK
Sbjct: 212 PPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYK 259

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 58/146 (39%), Positives = 68/146 (46%), Gaps = 14/146 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 175
           PP Y      PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 43  PPPYYYHSPPPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 91

Query: 176 KPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 337
            PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP 
Sbjct: 92  -PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPK 135

Query: 338 YKPPVEKPPVY--KPPVEKPPVYKPP 409
           + PP   PP Y   PP   PP + PP
Sbjct: 136 HSPP---PPYYYHSPP---PPKHSPP 155

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 58/146 (39%), Positives = 68/146 (46%), Gaps = 14/146 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 175
           PP Y      PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 91  PPPYYYHSPPPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 139

Query: 176 KPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 337
            PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP 
Sbjct: 140 -PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPK 183

Query: 338 YKPPVEKPPVY--KPPVEKPPVYKPP 409
           + PP   PP Y   PP   PP + PP
Sbjct: 184 HSPP---PPYYYHSPP---PPKHSPP 203

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 62/154 (40%), Positives = 69/154 (44%), Gaps = 22/154 (14%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY----TPPIYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 169
           PP + PP   PP Y     PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 101 PPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 148

Query: 170 VEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPV 337
              PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP 
Sbjct: 149 ---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPY 190

Query: 338 Y--KPPVEK---PPVY-----KPPVEKPPVYKPP 409
           Y   PP  K   PP Y      PP +KP  Y  P
Sbjct: 191 YYHSPPPPKHSPPPPYYYKSPPPPPKKPYKYPSP 224

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 57/144 (39%), Positives = 68/144 (47%), Gaps = 14/144 (9%)
 Frame = +2

Query: 20  VYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKP 181
           +Y  P   PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP   P
Sbjct: 31  IYSSP--PPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---P 76

Query: 182 PVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYK 343
           P Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + 
Sbjct: 77  PYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHS 121

Query: 344 PPVEKPPVY--KPPVEKPPVYKPP 409
           PP   PP Y   PP   PP + PP
Sbjct: 122 PP---PPYYYHSPP---PPKHSPP 139

[80][TOP]
>UniRef100_O81765 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=O81765_ARATH
          Length = 699

 Score =  122 bits (306), Expect = 1e-26
 Identities = 69/136 (50%), Positives = 81/136 (59%), Gaps = 4/136 (2%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT--PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PPVY PP   PP ++  PP++ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV
Sbjct: 528 PPVYSPPPPPPPVHSPPPPVHSPP--PPPVYSPPPPPPPVHSPP---PPVFSPP---PPV 579

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           Y PP   PPV+ PP   PPV+ PP    PV+ PP   PPV+ PP   PPVY PP   PPV
Sbjct: 580 YSPP---PPVHSPP---PPVHSPP-PPAPVHSPP---PPVHSPP-PPPPVYSPP---PPV 625

Query: 368 YKPPVEKPP--VYKPP 409
           + PP  + P  VY PP
Sbjct: 626 FSPPPSQSPPVVYSPP 641

 Score =  120 bits (301), Expect = 5e-26
 Identities = 69/135 (51%), Positives = 79/135 (58%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP   PPV  PP   PP++ PP   PPV+ PP   PPVY PP   PPV+ PP   PP
Sbjct: 523 VNSPP---PPVYSPPPPPPPVHSPP---PPVHSPP--PPPVYSPPPPPPPVHSPP---PP 571

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V+ PP   PPVY PP   PPV+ PP   PPV+ PP    PV+ PP   PPV+ PP   PP
Sbjct: 572 VFSPP---PPVYSPP---PPVHSPP---PPVHSPP-PPAPVHSPP---PPVHSPP-PPPP 617

Query: 365 VYKPPVEKPPVYKPP 409
           VY PP   PPV+ PP
Sbjct: 618 VYSPP---PPVFSPP 629

 Score =  114 bits (286), Expect = 3e-24
 Identities = 73/161 (45%), Positives = 84/161 (52%), Gaps = 26/161 (16%)
 Frame = +2

Query: 5   VEKP-PVYKPPVEKP------PEYTPPIYKPPVEK-------------PPVYKPPVEKPP 124
           V+KP PV   PV+KP      P+   P  + PV K             PPVY PP   PP
Sbjct: 480 VDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPP 539

Query: 125 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 304
           V+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPVY PP   PP
Sbjct: 540 VHSPP---PPVHSPP--PPPVYSPPPPPPPVHSPP---PPVFSPP---PPVYSPP---PP 585

Query: 305 VYKPPVEKPPVYKPP------VEKPPVYKPPVEKPPVYKPP 409
           V+ PP   PPV+ PP         PPV+ PP   PPVY PP
Sbjct: 586 VHSPP---PPVHSPPPPAPVHSPPPPVHSPP-PPPPVYSPP 622

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 58/138 (42%), Positives = 69/138 (50%), Gaps = 9/138 (6%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPP----VYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           PPVY PP   PP ++PP   PPV  PP    V+ PP   PPV+ PP   PPVY PP   P
Sbjct: 577 PPVYSPP---PPVHSPP---PPVHSPPPPAPVHSPP---PPVHSPP-PPPPVYSPP---P 623

Query: 182 PVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEK---PPVYKPPVEKPPVYKP 346
           PV+ PP  + P  VY PP   P +  PPV+ PP    PVEK   PP + P         P
Sbjct: 624 PVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPP--PAPVEKKETPPAHAPAPSDDEFIIP 681

Query: 347 PVEKPPVYKPPVEKPPVY 400
           P        PP   PP++
Sbjct: 682 PFIGHQYASPP---PPMF 696

[81][TOP]
>UniRef100_C5Z6N9 Putative uncharacterized protein Sb10g025210 n=1 Tax=Sorghum
           bicolor RepID=C5Z6N9_SORBI
          Length = 309

 Score =  122 bits (306), Expect = 1e-26
 Identities = 67/136 (49%), Positives = 78/136 (57%), Gaps = 3/136 (2%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           KP   KPP  K P Y  P ++ P + P   PV +PPV  PP  K PV +PPV +PPV  P
Sbjct: 68  KPKNPKPP--KGPAYPAPGHQQPPKSPSYPPVTRPPVVGPP--KGPVTRPPVTRPPVVGP 123

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV  PP+  PPV +PPV  PPV  PP+  PP   PPV  PPV  PP+  PP   PP+  P
Sbjct: 124 PVTYPPIIGPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPPSTTPPITGP 182

Query: 362 PVYKPPVEKPPVYKPP 409
           P   PPV  PPV  PP
Sbjct: 183 PSTTPPVTGPPVTYPP 198

 Score =  118 bits (296), Expect = 2e-25
 Identities = 68/153 (44%), Positives = 78/153 (50%), Gaps = 17/153 (11%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTP-PIYKPPVEKP---PVYK-------------PPVEKPPVY 130
           +  KP    PP  KP   +P P  KP   KP   P Y              PPV +PPV 
Sbjct: 44  KAPKPSHSHPPKTKPSHPSPSPSPKPKNPKPPKGPAYPAPGHQQPPKSPSYPPVTRPPVV 103

Query: 131 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 310
            PP  K PV +PPV +PPV  PPV  PP+  PPV +PPV  PPV  PP+  PP   PPV 
Sbjct: 104 GPP--KGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVTYPPITGPPT-TPPVV 160

Query: 311 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PPV  PP+  PP   PP+  PP   PPV  PP
Sbjct: 161 GPPVTYPPITGPPSTTPPITGPPSTTPPVTGPP 193

 Score =  115 bits (287), Expect = 2e-24
 Identities = 64/136 (47%), Positives = 72/136 (52%), Gaps = 4/136 (2%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           K P Y PPV +PP   PP  K PV +PPV +PPV  PPV  PP+  PPV +PPV  PPV 
Sbjct: 90  KSPSY-PPVTRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVT 146

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP----VEK 358
            PP+  PP   PPV  PPV  PP+  PP   PP+  PP   PPV  PPV  PP       
Sbjct: 147 YPPITGPPT-TPPVVGPPVTYPPITGPPSTTPPITGPPSTTPPVTGPPVTYPPGGGGGSS 205

Query: 359 PPVYKPPVEKPPVYKP 406
            P   PP    P   P
Sbjct: 206 TPCPPPPPPSTPTPTP 221

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 52/113 (46%), Positives = 58/113 (51%), Gaps = 4/113 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V +PPV +PPV  PP   PPI  PPV +PPV  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 110 VTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPP 168

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPP----VYKPPVEKPPVYKPPVEKP 331
           +  PP   PP+  PP   PPV  PPV  PP        P   PP    P   P
Sbjct: 169 ITGPPSTTPPITGPPSTTPPVTGPPVTYPPGGGGGSSTPCPPPPPPSTPTPTP 221

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 58/136 (42%), Positives = 66/136 (48%), Gaps = 27/136 (19%)
 Frame = +2

Query: 83  EKPPVYKPPVEKPPVYKP------PVEKP--------PVYK-------------PPVEKP 181
           +KP   KP    PP  KP      P  KP        P Y              PPV +P
Sbjct: 41  DKPKAPKPSHSHPPKTKPSHPSPSPSPKPKNPKPPKGPAYPAPGHQQPPKSPSYPPVTRP 100

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV  PP  K PV +PPV +PPV  PPV  PP+  PPV +PPV  PPV  PP+  PP   P
Sbjct: 101 PVVGPP--KGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVTYPPITGPPT-TP 157

Query: 362 PVYKPPVEKPPVYKPP 409
           PV  PPV  PP+  PP
Sbjct: 158 PVVGPPVTYPPITGPP 173

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 58/128 (45%), Positives = 65/128 (50%)
 Frame = +2

Query: 26  KPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 205
           KP   KP    PP  KP    P     P  KP   KPP  K P Y  P  + P       
Sbjct: 42  KPKAPKPSHSHPPKTKPSHPSPS----PSPKPKNPKPP--KGPAYPAPGHQQP------P 89

Query: 206 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 385
           K P Y PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+  PPV +PPV  PPV 
Sbjct: 90  KSPSY-PPVTRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVT 146

Query: 386 KPPVYKPP 409
            PP+  PP
Sbjct: 147 YPPITGPP 154

[82][TOP]
>UniRef100_B9S3J8 Repetitive proline-rich cell wall protein 2, putative n=1
           Tax=Ricinus communis RepID=B9S3J8_RICCO
          Length = 299

 Score =  122 bits (305), Expect = 2e-26
 Identities = 74/143 (51%), Positives = 84/143 (58%), Gaps = 12/143 (8%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYT---PPIYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP-VEKP 181
           P  KPP   PP+Y    PP  KPP    P  +PP  KPP  KPP V KPP+ KPP + KP
Sbjct: 33  PPSKPPPGHPPKYPPRHPPKVKPPFHPKPPKQPPHVKPPHPKPPHVPKPPIVKPPTIPKP 92

Query: 182 PVYKPP-VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPPVEKPPVY 340
           P+ +PP + KPPV  PP  V KPPV  PP  V KPPV  PP  V KPP+  PP   PPV 
Sbjct: 93  PIVRPPYIPKPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFVPKPPIVYPP--NPPV- 149

Query: 341 KPPVEKPPVYKPPVEKPPVYKPP 409
            PP   P + KPPV  PP+ KPP
Sbjct: 150 TPPSSPPYIPKPPVVTPPI-KPP 171

 Score =  121 bits (303), Expect = 3e-26
 Identities = 73/142 (51%), Positives = 84/142 (59%), Gaps = 9/142 (6%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPP-VEKPPVYKPP-VEKPPVYKPP-VEKPPVYKPP--VE 175
           KPP +  P ++PP   PP  KPP V KPP+ KPP + KPP+ +PP + KPPV  PP  V 
Sbjct: 54  KPPFHPKPPKQPPHVKPPHPKPPHVPKPPIVKPPTIPKPPIVRPPYIPKPPVVNPPPFVP 113

Query: 176 KPPVYKPP--VEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 343
           KPPV  PP  V KPPV  PP  V KPP+  PP   PPV  PP   P + KPPV  PP+ K
Sbjct: 114 KPPVVNPPPFVPKPPVVNPPPFVPKPPIVYPP--NPPV-TPPSSPPYIPKPPVVTPPI-K 169

Query: 344 PPVEKPPVYKPPVEKPPVYKPP 409
           PP       KPPV  PP  KPP
Sbjct: 170 PPTPPTLPPKPPVITPPT-KPP 190

 Score =  120 bits (302), Expect = 4e-26
 Identities = 76/149 (51%), Positives = 86/149 (57%), Gaps = 17/149 (11%)
 Frame = +2

Query: 14  PPVYKP---PVEKPPEYTPPIYKPPVEKPPVYKPP-VEKPPVYKPP-VEKPPVYKPP-VE 175
           PP Y P   P  KPP +  P  +PP  KPP  KPP V KPP+ KPP + KPP+ +PP + 
Sbjct: 42  PPKYPPRHPPKVKPPFHPKPPKQPPHVKPPHPKPPHVPKPPIVKPPTIPKPPIVRPPYIP 101

Query: 176 KPPVYKPP--VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPV 337
           KPPV  PP  V KPPV  PP  V KPPV  PP  V KPP+  PP   PPV  PP   P +
Sbjct: 102 KPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFVPKPPIVYPP--NPPV-TPPSSPPYI 158

Query: 338 YKPPVEKPPVYKPPV-----EKPPVYKPP 409
            KPPV  PP+ KPP       KPPV  PP
Sbjct: 159 PKPPVVTPPI-KPPTPPTLPPKPPVITPP 186

 Score =  112 bits (281), Expect = 1e-23
 Identities = 72/151 (47%), Positives = 83/151 (54%), Gaps = 22/151 (14%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYT-PPIYKPP-VEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPP- 169
           ++PP  KPP  KPP    PPI KPP + KPP+ +PP + KPPV  PP  V KPPV  PP 
Sbjct: 63  KQPPHVKPPHPKPPHVPKPPIVKPPTIPKPPIVRPPYIPKPPVVNPPPFVPKPPVVNPPP 122

Query: 170 -VEKPPVYKPP--VEKPPVYKPP------------VEKPPVYKPPVEKP-PVYKPPVEKP 301
            V KPPV  PP  V KPP+  PP            + KPPV  PP++ P P   PP  KP
Sbjct: 123 FVPKPPVVNPPPFVPKPPIVYPPNPPVTPPSSPPYIPKPPVVTPPIKPPTPPTLPP--KP 180

Query: 302 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 394
           PV  PP  KPP  + P   PP   PPV  PP
Sbjct: 181 PVITPPT-KPPTPETPCPPPP--PPPVPCPP 208

 Score =  109 bits (272), Expect = 1e-22
 Identities = 67/149 (44%), Positives = 77/149 (51%), Gaps = 20/149 (13%)
 Frame = +2

Query: 23  YKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPP 199
           Y  P  KPP   PP Y P         PP  KPP +  P ++PP  KPP  KPP V KPP
Sbjct: 30  YPTPPSKPPPGHPPKYPPR-------HPPKVKPPFHPKPPKQPPHVKPPHPKPPHVPKPP 82

Query: 200 VEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP--VEK 358
           + KPP     + KPP+ +PP + KPPV  PP  V KPPV  PP  V KPPV  PP  V K
Sbjct: 83  IVKPPT----IPKPPIVRPPYIPKPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFVPK 138

Query: 359 PPVYKPP------------VEKPPVYKPP 409
           PP+  PP            + KPPV  PP
Sbjct: 139 PPIVYPPNPPVTPPSSPPYIPKPPVVTPP 167

 Score =  109 bits (272), Expect = 1e-22
 Identities = 76/148 (51%), Positives = 83/148 (56%), Gaps = 15/148 (10%)
 Frame = +2

Query: 11  KPPVYKPP-VEKPPEYTPP-IYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPP--VE 175
           KPP  KPP V KPP   PP I KPP+ +PP + KPPV  PP   P V KPPV  PP  V 
Sbjct: 69  KPPHPKPPHVPKPPIVKPPTIPKPPIVRPPYIPKPPVVNPP---PFVPKPPVVNPPPFVP 125

Query: 176 KPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV-----EKPP 334
           KPPV  PP  V KPP+  PP   PPV  PP   P + KPPV  PP+ KPP       KPP
Sbjct: 126 KPPVVNPPPFVPKPPIVYPP--NPPV-TPPSSPPYIPKPPVVTPPI-KPPTPPTLPPKPP 181

Query: 335 VYKPPVEKPPVYK---PPVEKPPVYKPP 409
           V  PP  KPP  +   PP   PPV  PP
Sbjct: 182 VITPPT-KPPTPETPCPPPPPPPVPCPP 208

 Score =  101 bits (252), Expect = 2e-20
 Identities = 70/148 (47%), Positives = 80/148 (54%), Gaps = 22/148 (14%)
 Frame = +2

Query: 11  KPP-VYKPPVEKPPEYT-PPIYKPP-VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP 169
           KPP V KPP+ KPP    PPI +PP + KPPV  PP  V KPPV  PP  V KPPV  PP
Sbjct: 74  KPPHVPKPPIVKPPTIPKPPIVRPPYIPKPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPP 133

Query: 170 --VEKPPVYKPP------------VEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPP 304
             V KPP+  PP            + KPPV  PP++ P P   PP  KPPV  PP  KPP
Sbjct: 134 PFVPKPPIVYPPNPPVTPPSSPPYIPKPPVVTPPIKPPTPPTLPP--KPPVITPPT-KPP 190

Query: 305 VYKPPVEKPPVYKPPVEKPPVYKPPVEK 388
             + P   PP   PPV  PP   PP ++
Sbjct: 191 TPETPCPPPP--PPPVPCPP--PPPKQE 214

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 58/137 (42%), Positives = 71/137 (51%), Gaps = 19/137 (13%)
 Frame = +2

Query: 5   VEKPPVYKPP-VEKPPEYTPPIY--KPPVEKPPVY--KPPVEKPPVY--KPPVEKPP--- 154
           + KPP+ +PP + KPP   PP +  KPPV  PP +  KPPV  PP +  KPP+  PP   
Sbjct: 89  IPKPPIVRPPYIPKPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFVPKPPIVYPPNPP 148

Query: 155 ---------VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 307
                    + KPPV  PP+ KPP   PP   P   KPPV  PP  KPP  + P   PP 
Sbjct: 149 VTPPSSPPYIPKPPVVTPPI-KPPT--PPTLPP---KPPVITPPT-KPPTPETPCPPPP- 200

Query: 308 YKPPVEKPPVYKPPVEK 358
             PPV  PP   PP ++
Sbjct: 201 -PPPVPCPP--PPPKQE 214

[83][TOP]
>UniRef100_Q25460 Adhesive plaque matrix protein (Fragment) n=1 Tax=Mytilus edulis
           RepID=FP1_MYTED
          Length = 875

 Score =  122 bits (305), Expect = 2e-26
 Identities = 59/131 (45%), Positives = 63/131 (48%), Gaps = 1/131 (0%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           PPVYKP +  PP Y P P Y P  +  P YKP +  PP YK     P  YKP    PP Y
Sbjct: 72  PPVYKPKMTYPPTYKPKPSYPPTYKSKPTYKPKITYPPTYKAKPSYPSSYKPKKTYPPTY 131

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           KP +  PP YKP    PP YKP    PP YK     P  YK     PP YK     PP Y
Sbjct: 132 KPKLTYPPTYKPKPSYPPTYKPKPSYPPSYKTKKTYPSSYKAKPSYPPTYKAKPSYPPTY 191

Query: 371 KPPVEKPPVYK 403
           K     PP YK
Sbjct: 192 KAKPSYPPTYK 202

 Score =  110 bits (276), Expect = 4e-23
 Identities = 54/127 (42%), Positives = 58/127 (45%)
 Frame = +2

Query: 26   KPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 205
            KP  +  P Y PP YK     PP YKP    PP YK     P  YKP    PP YKP + 
Sbjct: 746  KPTYKAKPTY-PPTYKAKPSYPPTYKPKPSYPPTYKSKSIYPSSYKPKKTYPPTYKPKLT 804

Query: 206  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 385
             PP YKP    PP YKP +  P  YK     PP YK     PP Y   +  P  YK    
Sbjct: 805  YPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTSYPPTYNKKISYPSSYKAKTS 864

Query: 386  KPPVYKP 406
             PP YKP
Sbjct: 865  YPPAYKP 871

 Score =  107 bits (266), Expect = 5e-22
 Identities = 53/129 (41%), Positives = 56/129 (43%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P Y    +  P Y P  YK     PP YK     P  YKP    PP YKP +   P YKP
Sbjct: 459 PTYPSTYKAKPSY-PASYKAKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKP 517

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
               PP YKP    PP YKP +  PP YK     P  YK     PP YK     PP YK 
Sbjct: 518 KPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPSYPATYKAKPSYPPTYKAKPSYPPTYKA 577

Query: 377 PVEKPPVYK 403
               PP YK
Sbjct: 578 KPSYPPTYK 586

 Score =  106 bits (265), Expect = 7e-22
 Identities = 55/129 (42%), Positives = 59/129 (45%), Gaps = 2/129 (1%)
 Frame = +2

Query: 23  YKPPVEKPPEYTP--PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           Y P  +K   Y P    Y      PPVYKP +  PP YKP    PP YK      P YKP
Sbjct: 48  YLPLAKKLSSYKPIKTTYNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYK----SKPTYKP 103

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
            +  PP YK     P  YKP    PP YKP +  PP YKP    PP YKP    PP YK 
Sbjct: 104 KITYPPTYKAKPSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPPSYKT 163

Query: 377 PVEKPPVYK 403
               P  YK
Sbjct: 164 KKTYPSSYK 172

 Score =  106 bits (265), Expect = 7e-22
 Identities = 60/161 (37%), Positives = 62/161 (38%), Gaps = 31/161 (19%)
 Frame = +2

Query: 14  PPVYKP-----PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP     P  KP    PP YKP    PP YKP +  PP YK     P  YK     
Sbjct: 502 PPTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPSYPATYKAKPSY 561

Query: 179 PPVYKPPVEKPPVYK-----PPVEK---------------------PPVYKPPVEKPPVY 280
           PP YK     PP YK     PP  K                     PP YK     PP Y
Sbjct: 562 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTY 621

Query: 281 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
           K     PP YK     P  YK     PP YKP +  PP YK
Sbjct: 622 KAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYK 662

 Score =  106 bits (264), Expect = 9e-22
 Identities = 55/132 (41%), Positives = 58/132 (43%), Gaps = 2/132 (1%)
 Frame = +2

Query: 14  PPVYK--PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PP YK  P  +  P Y P  YK     P  YK     PP YK     P  YKP    PP 
Sbjct: 446 PPTYKAKPTYKAKPTY-PSTYKAKPSYPASYKAKPSYPPTYKSKSSYPSSYKPKKTYPPT 504

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           YKP +   P YKP    PP YKP    PP YKP +  PP YK     P  YK     PP 
Sbjct: 505 YKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPSYPATYKAKPSYPPT 564

Query: 368 YKPPVEKPPVYK 403
           YK     PP YK
Sbjct: 565 YKAKPSYPPTYK 576

 Score =  105 bits (263), Expect = 1e-21
 Identities = 54/131 (41%), Positives = 56/131 (42%), Gaps = 1/131 (0%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           PP YK     PP Y   P YK     P  YK     P  YK     PP YK     P  Y
Sbjct: 436 PPSYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPASYKAKPSYPPTYKSKSSYPSSY 495

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           KP    PP YKP +   P YKP    PP YKP    PP YKP +  PP YK     P  Y
Sbjct: 496 KPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPSYPATY 555

Query: 371 KPPVEKPPVYK 403
           K     PP YK
Sbjct: 556 KAKPSYPPTYK 566

 Score =  105 bits (262), Expect = 2e-21
 Identities = 58/140 (41%), Positives = 66/140 (47%), Gaps = 8/140 (5%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPP-IYKPPVEKPPVYKPPVEKPPVYKP-------PVEKPPVYKP 166
           KPP Y+P ++K  +Y P   Y P       Y P  +K   YKP           PPVYKP
Sbjct: 19  KPPTYQP-LKKKVDYRPTKSYPPTYGSKTNYLPLAKKLSSYKPIKTTYNAKTNYPPVYKP 77

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
            +  PP YKP    PP YK      P YKP +  PP YK     P  YKP    PP YKP
Sbjct: 78  KMTYPPTYKPKPSYPPTYK----SKPTYKPKITYPPTYKAKPSYPSSYKPKKTYPPTYKP 133

Query: 347 PVEKPPVYKPPVEKPPVYKP 406
            +  PP YKP    PP YKP
Sbjct: 134 KLTYPPTYKPKPSYPPTYKP 153

 Score =  105 bits (262), Expect = 2e-21
 Identities = 57/141 (40%), Positives = 61/141 (43%), Gaps = 11/141 (7%)
 Frame = +2

Query: 14  PPVYK-----PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     P   KP +  PP YKP +   P YKP    PP YKP    PP YKP +  
Sbjct: 482 PPTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISY 541

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEK----PPVY 340
           PP YK     P  YK     PP YK     PP YK     PP YK  P  +     P  Y
Sbjct: 542 PPTYKAKPSYPATYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYKAKPTYPSTY 601

Query: 341 KPPVEKPPVYKPPVEKPPVYK 403
           K     PP YK     PP YK
Sbjct: 602 KAKPSYPPTYKAKPSYPPTYK 622

 Score =  105 bits (262), Expect = 2e-21
 Identities = 58/141 (41%), Positives = 59/141 (41%), Gaps = 11/141 (7%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           P  YKP    PP Y P     P YKP    PP YKP    PP YKP +  PP YK     
Sbjct: 492 PSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPSY 551

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEK-----PPVYKPPVEKPPVY 340
           P  YK     PP YK     PP YK     PP YK  P  K     P  YK     PP Y
Sbjct: 552 PATYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYKAKPTYPSTYKAKPSYPPTY 611

Query: 341 KPPVEKPPVYKPPVEKPPVYK 403
           K     PP YK     PP YK
Sbjct: 612 KAKPSYPPTYKAKPSYPPTYK 632

 Score =  105 bits (262), Expect = 2e-21
 Identities = 55/137 (40%), Positives = 59/137 (43%), Gaps = 7/137 (5%)
 Frame = +2

Query: 14   PPVYK--PPVEKPPEY-----TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
            PP YK  P  +  P Y       P YK     PP YK     PP YKP    PP YK   
Sbjct: 724  PPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKS 783

Query: 173  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
              P  YKP    PP YKP +  PP YKP    PP YKP +  P  YK     PP YK   
Sbjct: 784  IYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKT 843

Query: 353  EKPPVYKPPVEKPPVYK 403
              PP Y   +  P  YK
Sbjct: 844  SYPPTYNKKISYPSSYK 860

 Score =  103 bits (258), Expect = 5e-21
 Identities = 54/136 (39%), Positives = 59/136 (43%), Gaps = 7/136 (5%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           P YKP +  PP Y      P  YKP    PP YKP +  PP YKP    PP YKP    P
Sbjct: 99  PTYKPKITYPPTYKAKPSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYP 158

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 355
           P YK     P  YK     PP YK     PP YK     PP Y  KP  +  P Y    +
Sbjct: 159 PSYKTKKTYPSSYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYK 218

Query: 356 KPPVYKPPVEKPPVYK 403
             P Y P  +  P YK
Sbjct: 219 AKPSYPPTYKAKPTYK 234

 Score =  103 bits (257), Expect = 6e-21
 Identities = 55/137 (40%), Positives = 58/137 (42%), Gaps = 7/137 (5%)
 Frame = +2

Query: 17   PVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVE 175
            P YK     P  Y      PP YK     PP YK     PP YK  P  +  P Y    +
Sbjct: 685  PTYKAKPTNPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYK 744

Query: 176  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
              P YK     PP YK     PP YKP    PP YK     P  YKP    PP YKP + 
Sbjct: 745  AKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSIYPSSYKPKKTYPPTYKPKLT 804

Query: 356  KPPVYKPPVEKPPVYKP 406
             PP YKP    PP YKP
Sbjct: 805  YPPTYKPKPSYPPSYKP 821

 Score =  103 bits (257), Expect = 6e-21
 Identities = 52/121 (42%), Positives = 55/121 (45%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP YK      P Y PP YKP    PP YK     P  YKP    PP YKP +  PP YK
Sbjct: 756  PPTYKA----KPSY-PPTYKPKPSYPPTYKSKSIYPSSYKPKKTYPPTYKPKLTYPPTYK 810

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            P    PP YKP +  P  YK     PP YK     PP Y   +  P  YK     PP YK
Sbjct: 811  PKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTSYPPTYNKKISYPSSYKAKTSYPPAYK 870

Query: 374  P 376
            P
Sbjct: 871  P 871

 Score =  102 bits (254), Expect = 1e-20
 Identities = 52/131 (39%), Positives = 55/131 (41%), Gaps = 1/131 (0%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           P  YK     PP Y   P Y P  +  P YK     P  YK     P  YK     PP Y
Sbjct: 426 PSTYKAKPSYPPSYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPASYKAKPSYPPTY 485

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           K     P  YKP    PP YKP +   P YKP    PP YKP    PP YKP +  PP Y
Sbjct: 486 KSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTY 545

Query: 371 KPPVEKPPVYK 403
           K     P  YK
Sbjct: 546 KAKPSYPATYK 556

 Score =  102 bits (253), Expect = 2e-20
 Identities = 57/137 (41%), Positives = 60/137 (43%), Gaps = 8/137 (5%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEY-TPPIYKPPVEKPPVYK--PPVEKPPVYKPPVEK-----PPVYKPP 169
            PP YK     PP Y   P YK     P  YK  P  +  P Y PP  K     PP YKP 
Sbjct: 714  PPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTY-PPTYKAKPSYPPTYKPK 772

Query: 170  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
               PP YK     P  YKP    PP YKP +  PP YKP    PP YKP +  P  YK  
Sbjct: 773  PSYPPTYKSKSIYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLK 832

Query: 350  VEKPPVYKPPVEKPPVY 400
               PP YK     PP Y
Sbjct: 833  PSYPPTYKSKTSYPPTY 849

 Score =  101 bits (252), Expect = 2e-20
 Identities = 57/138 (41%), Positives = 61/138 (44%), Gaps = 8/138 (5%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEY-TPPIYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEK-- 178
            PP YK     PP Y   P Y P  +  P YK     P  YK  P  +  P Y PP  K  
Sbjct: 704  PPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTY-PPTYKAK 762

Query: 179  ---PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
               PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YKP 
Sbjct: 763  PSYPPTYKPKPSYPPTYKSKSIYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPK 822

Query: 350  VEKPPVYKPPVEKPPVYK 403
            +  P  YK     PP YK
Sbjct: 823  ITYPSTYKLKPSYPPTYK 840

 Score =  100 bits (250), Expect = 4e-20
 Identities = 53/141 (37%), Positives = 59/141 (41%), Gaps = 7/141 (4%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YK     P  Y      PP YKP +  PP YKP    PP YKP    PP YK 
Sbjct: 104 KITYPPTYKAKPSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPPSYKT 163

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY 340
               P  YK     PP YK     PP YK     PP Y  KP  +  P Y    +  P Y
Sbjct: 164 KKTYPSSYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSY 223

Query: 341 KPPVEKPPVYKPPVEKPPVYK 403
            P  +  P YK     PP YK
Sbjct: 224 PPTYKAKPTYKAKPSYPPTYK 244

 Score =  100 bits (250), Expect = 4e-20
 Identities = 53/137 (38%), Positives = 58/137 (42%), Gaps = 7/137 (5%)
 Frame = +2

Query: 14  PPVYK--PPVEKPPEY-----TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PP YK  P  +  P Y       P Y P  +  P Y P  +  P YK     P  YK   
Sbjct: 410 PPTYKAKPTYKAKPTYPSTYKAKPSYPPSYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKP 469

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
             P  YK     PP YK     P  YKP    PP YKP +   P YKP    PP YKP  
Sbjct: 470 SYPASYKAKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKPKT 529

Query: 353 EKPPVYKPPVEKPPVYK 403
             PP YKP +  PP YK
Sbjct: 530 TYPPTYKPKISYPPTYK 546

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 56/138 (40%), Positives = 57/138 (41%), Gaps = 7/138 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEK--- 178
           PP YK     PP Y   P YK     P  YK     PP YK     PP YK  P  K   
Sbjct: 400 PPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPSYKAKPSYPPTYKAKPTYKAKP 459

Query: 179 --PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
             P  YK     P  YK     PP YK     P  YKP    PP YKP +   P YKP  
Sbjct: 460 TYPSTYKAKPSYPASYKAKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKP 519

Query: 353 EKPPVYKPPVEKPPVYKP 406
             PP YKP    PP YKP
Sbjct: 520 SYPPSYKPKTTYPPTYKP 537

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 52/133 (39%), Positives = 55/133 (41%), Gaps = 2/133 (1%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KP    PP  KP    PP YKP    PP YKP    PP YK     P  YK     PP Y
Sbjct: 122 KPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPPSYKTKKTYPSSYKAKPSYPPTY 181

Query: 191 KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           K     PP YK     PP Y  KP  +  P Y    +  P Y P  +  P YK     PP
Sbjct: 182 KAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPSYPP 241

Query: 365 VYKPPVEKPPVYK 403
            YK     PP YK
Sbjct: 242 TYKAKPSYPPTYK 254

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 51/129 (39%), Positives = 53/129 (41%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P Y P  +  P Y PP YK     PP YK     P  YK     PP YKP +  PP YK 
Sbjct: 605 PSYPPTYKAKPSY-PPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYKA 663

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
               PP YK     PP YK      P YK     P  YK     PP YK     PP YK 
Sbjct: 664 KPSYPPTYKAKPSYPPTYKAK----PTYKAKPTNPSTYKAKPSYPPTYKAKPSYPPTYKA 719

Query: 377 PVEKPPVYK 403
               PP YK
Sbjct: 720 KPSYPPTYK 728

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 55/138 (39%), Positives = 57/138 (41%), Gaps = 8/138 (5%)
 Frame = +2

Query: 14  PPVYK--PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PP YK  P  +  P Y P  YK     PP YK     PP YK     PP YK     P  
Sbjct: 582 PPTYKAKPSYKAKPTY-PSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYPST 640

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKP-PVYKPPVEKPPVYKPP 349
           YK     PP YKP +  PP YK     PP YK     PP  K  P YK     P  YK  
Sbjct: 641 YKAKPSYPPTYKPKISYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTNPSTYKAK 700

Query: 350 VEKPPVYKPPVEKPPVYK 403
              PP YK     PP YK
Sbjct: 701 PSYPPTYKAKPSYPPTYK 718

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 62/183 (33%), Positives = 66/183 (36%), Gaps = 53/183 (28%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYK---------------------PPVE 115
            PP YKP +  PP Y      PP YK     PP YK                     PP  
Sbjct: 648  PPTYKPKISYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTNPSTYKAKPSYPPTY 707

Query: 116  K-----PPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 274
            K     PP YK     PP YK  P  +  P Y    +  P YK     PP YK     PP
Sbjct: 708  KAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTYPPTYKAKPSYPP 767

Query: 275  VYKPPVEKPPVYK---------------PPVEKP-----PVYKPPVEKPPVYKPPVEKPP 394
             YKP    PP YK               PP  KP     P YKP    PP YKP +  P 
Sbjct: 768  TYKPKPSYPPTYKSKSIYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPKITYPS 827

Query: 395  VYK 403
             YK
Sbjct: 828  TYK 830

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 52/136 (38%), Positives = 54/136 (39%), Gaps = 7/136 (5%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
            PP YK     PP Y      PP YK     P  YK     PP YKP +  PP YK     
Sbjct: 608  PPTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYKAKPSY 667

Query: 179  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
            PP YK     PP YK      P YK     P  YK     PP YK     PP YK     
Sbjct: 668  PPTYKAKPSYPPTYKAK----PTYKAKPTNPSTYKAKPSYPPTYKAKPSYPPTYKAKPSY 723

Query: 359  PPVY--KPPVEKPPVY 400
            PP Y  KP  +  P Y
Sbjct: 724  PPTYKAKPTYKAKPTY 739

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 53/145 (36%), Positives = 56/145 (38%), Gaps = 15/145 (10%)
 Frame = +2

Query: 14  PPVYK--PPVEKPPEY-----TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PP YK  P  +  P Y       P Y P  +  P YK     PP YK     PP YK   
Sbjct: 198 PPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKP 257

Query: 173 EKPPVY--------KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
             PP Y        KP  +  P YK     PP YK     PP YK     PP YK     
Sbjct: 258 SYPPTYKAKPTYKAKPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 317

Query: 329 PPVYKPPVEKPPVYKPPVEKPPVYK 403
           PP YK     PP YK     PP YK
Sbjct: 318 PPTYKAKPSYPPTYKAKPSYPPTYK 342

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/145 (35%), Positives = 56/145 (38%), Gaps = 15/145 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PP YK     PP Y      PP YK  P  +  P Y    +  P Y P  +  P YK   
Sbjct: 178 PPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKP 237

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVY--------KPPVEKPPVYKPPVEKPPVYKPPVEK 328
             PP YK     PP YK     PP Y        KP  +  P YK     PP YK     
Sbjct: 238 SYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYKAKPTYKAKPSYPPTYKAKPSY 297

Query: 329 PPVYKPPVEKPPVYKPPVEKPPVYK 403
           PP YK     PP YK     PP YK
Sbjct: 298 PPTYKAKPSYPPTYKAKPSYPPTYK 322

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/133 (37%), Positives = 55/133 (41%), Gaps = 4/133 (3%)
 Frame = +2

Query: 17  PVYK--PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           P YK  P  +  P Y PP YK     PP YK     PP YK     PP YK     PP Y
Sbjct: 273 PTYKAKPTYKAKPSY-PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTY 331

Query: 191 KPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           K     PP Y  KP  +  P Y    +  P Y P  +  P Y P  +  P YK     PP
Sbjct: 332 KAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPSYPP 391

Query: 365 VYKPPVEKPPVYK 403
            YK     PP YK
Sbjct: 392 TYKAKPSYPPTYK 404

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 56/150 (37%), Positives = 59/150 (39%), Gaps = 18/150 (12%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYK-----PPVEKP-PVY 160
            PP YK     P  Y      PP YKP +  PP YK     PP YK     PP  K  P Y
Sbjct: 628  PPTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTY 687

Query: 161  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPP 334
            K     P  YK     PP YK     PP YK     PP YK  P  +  P Y    +  P
Sbjct: 688  KAKPTNPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKP 747

Query: 335  VYKPPVEKPPVYK-----PPVEKPPVYKPP 409
             YK     PP YK     PP  KP    PP
Sbjct: 748  TYKAKPTYPPTYKAKPSYPPTYKPKPSYPP 777

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 55/142 (38%), Positives = 57/142 (40%), Gaps = 11/142 (7%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPPIYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           PP YK     PP Y   P YK  P  +  P YK     PP YK     PP YK     PP
Sbjct: 250 PPTYKAKPSYPPTYKAKPTYKAKPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 309

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEK-----PPVYKPPVEKPPVYKP 346
            YK     PP YK     PP YK     PP YK  P  K     P  YK     PP YK 
Sbjct: 310 TYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKA 369

Query: 347 PVEKPPVY--KPPVEKPPVYKP 406
               PP Y  KP  +  P Y P
Sbjct: 370 KPSYPPTYKAKPTYKAKPSYPP 391

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/142 (37%), Positives = 58/142 (40%), Gaps = 12/142 (8%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P Y    +  P Y PP YK     P  YKP    PP YKP +   P YKP    PP YKP
Sbjct: 469 PSYPASYKAKPSY-PPTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKP 527

Query: 197 -----PVEKPPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY-- 340
                P  KP +  PP  K     P  YK     PP YK     PP YK     PP Y  
Sbjct: 528 KTTYPPTYKPKISYPPTYKAKPSYPATYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKA 587

Query: 341 KPPVEKPPVYKPPVEKPPVYKP 406
           KP  +  P Y    +  P Y P
Sbjct: 588 KPSYKAKPTYPSTYKAKPSYPP 609

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 53/145 (36%), Positives = 56/145 (38%), Gaps = 15/145 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-------TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PP YK     PP Y         P Y    +  P Y P  +  P YK     PP YK   
Sbjct: 188 PPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKP 247

Query: 173 EKPPVYKPPVEKPPVYK--PPVEKPPVYK-PPVEK-----PPVYKPPVEKPPVYKPPVEK 328
             PP YK     PP YK  P  +  P YK  P  K     PP YK     PP YK     
Sbjct: 248 SYPPTYKAKPSYPPTYKAKPTYKAKPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 307

Query: 329 PPVYKPPVEKPPVYKPPVEKPPVYK 403
           PP YK     PP YK     PP YK
Sbjct: 308 PPTYKAKPSYPPTYKAKPSYPPTYK 332

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 54/145 (37%), Positives = 58/145 (40%), Gaps = 15/145 (10%)
 Frame = +2

Query: 14  PPVYK--PPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKP 166
           PP YK  P  +  P Y P     P Y P  +  P Y P  +  P Y  KP  +  P YK 
Sbjct: 224 PPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYKAKPTYKA 283

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK- 343
               PP YK     PP YK     PP YK     PP YK     PP YK     PP YK 
Sbjct: 284 KPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKA 343

Query: 344 PPVEK-----PPVYKPPVEKPPVYK 403
            P  K     P  YK     PP YK
Sbjct: 344 KPTYKAKPTYPSTYKAKPSYPPTYK 368

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 54/142 (38%), Positives = 57/142 (40%), Gaps = 11/142 (7%)
 Frame = +2

Query: 14  PPVYK--PPVEKPPEY-TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           PP YK  P  +  P Y   P YK     PP YK     PP YK     PP YK     PP
Sbjct: 260 PPTYKAKPTYKAKPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 319

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKP-PVEK-----PPVYKPPVEKPPVYKPPVEKPPVYK- 343
            YK     PP YK     PP YK  P  K     P  YK     PP YK     PP YK 
Sbjct: 320 TYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKA 379

Query: 344 -PPVEKPPVYKPPVEKPPVYKP 406
            P  +  P Y P  +  P Y P
Sbjct: 380 KPTYKAKPSYPPTYKAKPSYPP 401

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 52/137 (37%), Positives = 53/137 (38%), Gaps = 7/137 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVE 175
           PP YK     PP Y   P Y P  +  P YK     P  YK     PP YK     PP  
Sbjct: 318 PPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTY 377

Query: 176 KP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           K  P YK     PP YK     PP YK     PP YK      P YK     P  YK   
Sbjct: 378 KAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK----AKPTYKAKPTYPSTYKAKP 433

Query: 353 EKPPVYKPPVEKPPVYK 403
             PP YK     PP YK
Sbjct: 434 SYPPSYKAKPSYPPTYK 450

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 52/154 (33%), Positives = 56/154 (36%), Gaps = 23/154 (14%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPP 184
           PP YK     PP Y   P YK     PP YK     PP YK     PP YK  P  +  P
Sbjct: 364 PPTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKP 423

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            Y    +  P Y P  +  P Y P  +  P YK     P  YK     P  YK     PP
Sbjct: 424 TYPSTYKAKPSYPPSYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPASYKAKPSYPP 483

Query: 365 VYK---------------PPVEKP-----PVYKP 406
            YK               PP  KP     P YKP
Sbjct: 484 TYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKP 517

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 34/82 (41%), Positives = 36/82 (43%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            KP    PP  KP    PP YKP    PP YKP +  P  YK     PP YK     PP Y
Sbjct: 790  KPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTSYPPTY 849

Query: 191  KPPVEKPPVYKPPVEKPPVYKP 256
               +  P  YK     PP YKP
Sbjct: 850  NKKISYPSSYKAKTSYPPAYKP 871

[84][TOP]
>UniRef100_UPI0001983484 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983484
          Length = 306

 Score =  121 bits (304), Expect = 2e-26
 Identities = 81/144 (56%), Positives = 94/144 (65%), Gaps = 14/144 (9%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVE-KPPVYKPPVEKP-PVYKPPVEKPPVYKPP--VEK 178
           KPP  K P   PPE+ P + KPP E K P   P  EKP P +KPP    P+ KPP   + 
Sbjct: 26  KPPPTKKP---PPEHKPSVEKPPPEHKSPTKPPKGEKPLPEHKPPT---PIGKPPKGEKP 79

Query: 179 PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKP-PVEKPPVYK 343
           PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KP P+EKPP  +
Sbjct: 80  PPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPTPLEKPPKGE 139

Query: 344 PPV--EKP--PVYKPPV-EKPPVY 400
            P+   KP  PV KPP  EKPP Y
Sbjct: 140 KPLPEHKPPTPVGKPPKGEKPPHY 163

 Score =  118 bits (296), Expect = 2e-25
 Identities = 88/166 (53%), Positives = 102/166 (61%), Gaps = 33/166 (19%)
 Frame = +2

Query: 11  KPPVYKPPVE-----KPPEYTPPI--YKPPVEKPPVYKPP--VEKPPVYKPPVEK-PPVY 160
           KP V KPP E     KPP+   P+  +KPP    P+ KPP   + PP +KPPVEK PP +
Sbjct: 38  KPSVEKPPPEHKSPTKPPKGEKPLPEHKPPT---PIGKPPKGEKPPPEHKPPVEKPPPEH 94

Query: 161 KPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKP-PVEKPPVYKPPV--EKP--PVYKP 316
           KPPVEK PP +KPPVEK PP +KPPVEK PP +KP P+EKPP  + P+   KP  PV KP
Sbjct: 95  KPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPTPLEKPPKGEKPLPEHKPPTPVGKP 154

Query: 317 PV-EKPPVY-----KPPVE------KP--PVYKPPV-EKPPVYKPP 409
           P  EKPP Y      PP E      KP  PV KPP  EKPP +K P
Sbjct: 155 PKGEKPPHYGHNPGHPPAENAEDSYKPPTPVGKPPKGEKPPEHKSP 200

 Score =  110 bits (274), Expect = 6e-23
 Identities = 72/128 (56%), Positives = 84/128 (65%), Gaps = 10/128 (7%)
 Frame = +2

Query: 56  TPPIYKPPVEKPPVYKPPVE-KPPVYKPPVE-KPPVYKPPVEKP-PVYKPPVEKPPVYKP 226
           TP +   P + PP  KPP E KP V KPP E K P   P  EKP P +KPP    P+ KP
Sbjct: 18  TPSLADYP-KPPPTKKPPPEHKPSVEKPPPEHKSPTKPPKGEKPLPEHKPPT---PIGKP 73

Query: 227 P--VEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKP-PVE 385
           P   + PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KP P+E
Sbjct: 74  PKGEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPTPLE 133

Query: 386 KPPVYKPP 409
           KPP  + P
Sbjct: 134 KPPKGEKP 141

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 84/222 (37%), Positives = 96/222 (43%), Gaps = 90/222 (40%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-------EYTPPIYKPPVEKPPV-YKPPVEKPPV-YKP-PVEKPPV-- 157
           PP +KPPVEKPP       E  PP +KPPVEKPP  +KPPVEKPP  +KP P+EKPP   
Sbjct: 80  PPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPTPLEKPPKGE 139

Query: 158 -----YKPPV--------EKPP----------------VYKPPV--------EKPPVYKP 226
                +KPP         EKPP                 YKPP         EKPP +K 
Sbjct: 140 KPLPEHKPPTPVGKPPKGEKPPHYGHNPGHPPAENAEDSYKPPTPVGKPPKGEKPPEHKS 199

Query: 227 PVEKP-------------------------PVYKPPV--------EKPPVY-----KPPV 292
           P + P                         P +KPP         EKPP Y      PPV
Sbjct: 200 PTKPPKGEKPLLEHKPPTPIGKPPKGEKQLPEHKPPTPVGKPPKGEKPPHYGHNPGHPPV 259

Query: 293 E-KPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPP 409
           E K   YKPP +  P   P   + P  KPP    KPP +KPP
Sbjct: 260 ESKEDSYKPPHKIEPPSAPKKPQAPEKKPPTPPHKPP-HKPP 300

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 46/114 (40%), Positives = 55/114 (48%), Gaps = 25/114 (21%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPI--YKPP--VEKPPV-------YKPPV--------EKPPVY 130
           EKPP +K P  KPP+   P+  +KPP  + KPP        +KPP         EKPP Y
Sbjct: 192 EKPPEHKSPT-KPPKGEKPLLEHKPPTPIGKPPKGEKQLPEHKPPTPVGKPPKGEKPPHY 250

Query: 131 -----KPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 274
                 PPVE K   YKPP +  P   P   + P  KPP    P +KPP  KPP
Sbjct: 251 GHNPGHPPVESKEDSYKPPHKIEPPSAPKKPQAPEKKPPT---PPHKPP-HKPP 300

[85][TOP]
>UniRef100_UPI000198347D PREDICTED: hypothetical protein isoform 2 n=1 Tax=Vitis vinifera
           RepID=UPI000198347D
          Length = 217

 Score =  121 bits (304), Expect = 2e-26
 Identities = 85/145 (58%), Positives = 91/145 (62%), Gaps = 14/145 (9%)
 Frame = +2

Query: 17  PVYK-PPVEKPP-EYTPP--IYKPP-VEKPP--VYKPP-VEK-PPVYKPPVEKPPVYK-P 166
           PVYK PP+ KPP EY PP  +YKPP VEKPP  VY+PP VEK PP YKPP    PVYK P
Sbjct: 37  PVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEKPPPEYKPPT---PVYKPP 93

Query: 167 PVEK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPP 334
           PVEK PP YKPP    PVYK PPVEK PP YKPP   KPP   PP  K P   P V +P 
Sbjct: 94  PVEKPPPEYKPPT---PVYKPPPVEKPPPEYKPPTPVKPP--PPPKHKTPTLPPRVVRP- 147

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKPP 409
              PP  KPP   P + +PP  K P
Sbjct: 148 ---PPTPKPPTLPPIIVRPPPTKEP 169

 Score =  114 bits (285), Expect = 3e-24
 Identities = 83/151 (54%), Positives = 92/151 (60%), Gaps = 22/151 (14%)
 Frame = +2

Query: 23  YKPPVEKPPEYTPPIYKPPVEKPPVYKPPVE-KP--PVYK-PPVEKP--PVYK-PPVEK- 178
           +KPP   P E+ PP+  P  + PP+ KPP E KP  PVYK PPVEKP  PVY+ PPVEK 
Sbjct: 25  HKPP---PYEHKPPL--PVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEKP 79

Query: 179 PPVYKPPVEKPPVYK-PPVEK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPV----EKPP 334
           PP YKPP    PVYK PPVEK PP YKPP    PVYK PPVEK PP YKPP       PP
Sbjct: 80  PPEYKPPT---PVYKPPPVEKPPPEYKPPT---PVYKPPPVEKPPPEYKPPTPVKPPPPP 133

Query: 335 VYKPP------VEKPPVYKPPVEKPPVYKPP 409
            +K P      V  PP  KPP   P + +PP
Sbjct: 134 KHKTPTLPPRVVRPPPTPKPPTLPPIIVRPP 164

 Score =  114 bits (284), Expect = 4e-24
 Identities = 80/146 (54%), Positives = 84/146 (57%), Gaps = 15/146 (10%)
 Frame = +2

Query: 17  PVYKP-PVEKPPEYTPPIYKPPVEK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPVEKPP 184
           PVYKP PVEKPP  TP    PPVEK PP YKPP    PVYK PPVEK PP YKPP    P
Sbjct: 56  PVYKPPPVEKPP--TPVYRPPPVEKPPPEYKPPT---PVYKPPPVEKPPPEYKPPT---P 107

Query: 185 VYK-PPVEK-PPVYKPPV----EKPPVYKPPVEKPPVYK-PPVEKPPVYKPPVEKPPVYK 343
           VYK PPVEK PP YKPP       PP +K P   P V + PP  KPP   P + +PP  K
Sbjct: 108 VYKPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPTK 167

Query: 344 PPVEKPPVY--KPPVEKPP--VYKPP 409
            P      Y   PPVE PP   YK P
Sbjct: 168 EPSPPQGHYPGHPPVETPPSTPYKKP 193

 Score =  108 bits (269), Expect = 2e-22
 Identities = 77/143 (53%), Positives = 83/143 (58%), Gaps = 13/143 (9%)
 Frame = +2

Query: 5   VEKPP--VYKPP-VEKPP-EYTPP--IYKPP-VEKPPV-YKPPVEKPPVYKPP-VEKPPV 157
           VEKPP  VY+PP VEKPP EY PP  +YKPP VEKPP  YKPP    PVYKPP VEKPP 
Sbjct: 63  VEKPPTPVYRPPPVEKPPPEYKPPTPVYKPPPVEKPPPEYKPPT---PVYKPPPVEKPPP 119

Query: 158 -YKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
            YKPP   KPP   PP  K P   P V +P    PP  KPP   P + +PP  K P    
Sbjct: 120 EYKPPTPVKPP--PPPKHKTPTLPPRVVRP----PPTPKPPTLPPIIVRPPPTKEPSPPQ 173

Query: 332 PVY--KPPVEKPPVYKPPVEKPP 394
             Y   PPVE PP    P +KPP
Sbjct: 174 GHYPGHPPVETPP--STPYKKPP 194

[86][TOP]
>UniRef100_C5YGB7 Putative uncharacterized protein Sb06g016310 n=1 Tax=Sorghum
           bicolor RepID=C5YGB7_SORBI
          Length = 283

 Score =  121 bits (304), Expect = 2e-26
 Identities = 82/169 (48%), Positives = 84/169 (49%), Gaps = 36/169 (21%)
 Frame = +2

Query: 11  KPPVYKPP--VEKPPEYTPPIYKPPVEKPPVY---KPPVEKPPVYKPPV----EKPPVYK 163
           K PVY PP     PP YTP   KPP  KPP Y   KPP  KPP   PPV     KPPV K
Sbjct: 101 KSPVYPPPPKASTPPTYTPSP-KPPATKPPTYPTPKPPATKPPT--PPVYTPSPKPPVTK 157

Query: 164 PPVEKP--PVY----KPPVEKPPVY----KPPVEK--PPVY----KPPVEKPPVY----K 283
           PP  KP  PVY    KPPV KPP +    KPP  K  PPVY    KPP   PP Y    K
Sbjct: 158 PPTPKPTPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTPSPKPPKPSPPTYTPTPK 217

Query: 284 PPVEKPPVYKPPVEKPPVYKP-PVEKPPVYK------PPVEKPPVYKPP 409
           PP  KPP   P   KP  + P P   PP YK      PP   PP Y PP
Sbjct: 218 PPATKPPTSTPTHPKPTPHTPIPKPTPPTYKPAPKPTPPAPTPPTYTPP 266

 Score =  119 bits (298), Expect = 1e-25
 Identities = 77/158 (48%), Positives = 80/158 (50%), Gaps = 25/158 (15%)
 Frame = +2

Query: 11  KPPVY---KPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKP--PVY----KPPVEKPPVY- 160
           KPP Y   KPP  KPP  TPP+Y P   KPPV KPP  KP  PVY    KPPV KPP + 
Sbjct: 127 KPPTYPTPKPPATKPP--TPPVYTPS-PKPPVTKPPTPKPTPPVYTPNPKPPVTKPPTHT 183

Query: 161 ---KPPVEKP--PVY----KPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKP-PVEK 298
              KPP  KP  PVY    KPP   PP Y    KPP  KPP   P   KP  + P P   
Sbjct: 184 PSPKPPTSKPTPPVYTPSPKPPKPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPIPKPT 243

Query: 299 PPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PP YKP P   PP   PP   PPV   P   PP   PP
Sbjct: 244 PPTYKPAPKPTPPAPTPPTYTPPVSHTPSSPPPPPPPP 281

 Score =  114 bits (286), Expect = 3e-24
 Identities = 84/187 (44%), Positives = 86/187 (45%), Gaps = 54/187 (28%)
 Frame = +2

Query: 11  KPPVYKPPVEKPP---------------EYTPPIYKP----------PVEKPPVYKP-PV 112
           KPP   P  EKPP               + TPP Y P          P   PP Y P P 
Sbjct: 40  KPPAKGPKPEKPPTKGHGHKPEKPPKEHKPTPPTYTPSPKPTPPPATPKPTPPTYTPSPK 99

Query: 113 EKPPVYKPP--VEKPPVY----KPPVEKPPVY---KPPVEK---PPVYKPPVEKPPVYKP 256
            K PVY PP     PP Y    KPP  KPP Y   KPP  K   PPVY P   KPPV KP
Sbjct: 100 PKSPVYPPPPKASTPPTYTPSPKPPATKPPTYPTPKPPATKPPTPPVYTPS-PKPPVTKP 158

Query: 257 PVEK--PPVY----KPPVEKPPVY----KPPVEK--PPVY----KPPVEKPPVYKPPVEK 388
           P  K  PPVY    KPPV KPP +    KPP  K  PPVY    KPP   PP Y  P  K
Sbjct: 159 PTPKPTPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTPSPKPPKPSPPTY-TPTPK 217

Query: 389 PPVYKPP 409
           PP  KPP
Sbjct: 218 PPATKPP 224

 Score =  112 bits (280), Expect = 1e-23
 Identities = 78/161 (48%), Positives = 82/161 (50%), Gaps = 28/161 (17%)
 Frame = +2

Query: 8   EKPPV----YKPPVEKPPEY---TPPIYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYK 163
           EKPP     +KP  EKPP+    TPP Y P  +  P    P   PP Y P P  K PVY 
Sbjct: 49  EKPPTKGHGHKP--EKPPKEHKPTPPTYTPSPKPTPPPATPKPTPPTYTPSPKPKSPVYP 106

Query: 164 PP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVY----KPPVEKPPVYK 313
           PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPVY    KPPV KPP  K
Sbjct: 107 PPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPVYTPSPKPPVTKPPTPK 162

Query: 314 PPVEKPPVY----KPPVEKPPVY----KPPVEK--PPVYKP 406
           P    PPVY    KPPV KPP +    KPP  K  PPVY P
Sbjct: 163 P---TPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTP 200

 Score =  109 bits (273), Expect = 8e-23
 Identities = 67/141 (47%), Positives = 69/141 (48%), Gaps = 11/141 (7%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEK--PPVY----KPPV 172
           KPPV KPP  KP   TPP+Y P   KPPV KPP   P   KPP  K  PPVY    KPP 
Sbjct: 152 KPPVTKPPTPKP---TPPVYTPN-PKPPVTKPPTHTPSP-KPPTSKPTPPVYTPSPKPPK 206

Query: 173 EKPPVY----KPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPV 337
             PP Y    KPP  KPP   P   KP  + P P   PP YKP     P   PP   PP 
Sbjct: 207 PSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPIPKPTPPTYKP----APKPTPPAPTPPT 262

Query: 338 YKPPVEKPPVYKPPVEKPPVY 400
           Y PPV   P   PP   PP Y
Sbjct: 263 YTPPVSHTPSSPPPPPPPPYY 283

 Score =  103 bits (257), Expect = 6e-21
 Identities = 69/153 (45%), Positives = 70/153 (45%), Gaps = 24/153 (15%)
 Frame = +2

Query: 23  YKPPVEKPPEYTPPIYKPPV-------EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           Y  P  KPP   P   KPP        EKPP    P   PP Y P  +  P    P   P
Sbjct: 34  YPTPTPKPPAKGPKPEKPPTKGHGHKPEKPPKEHKPT--PPTYTPSPKPTPPPATPKPTP 91

Query: 182 PVYKP-PVEKPPVYKPP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
           P Y P P  K PVY PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPVY
Sbjct: 92  PTYTPSPKPKSPVYPPPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPVY 147

Query: 341 ----KPPVEKPPVYKP------PVEKPPVYKPP 409
               KPPV KPP  KP      P  KPPV KPP
Sbjct: 148 TPSPKPPVTKPPTPKPTPPVYTPNPKPPVTKPP 180

[87][TOP]
>UniRef100_P24152 Extensin n=1 Tax=Sorghum bicolor RepID=EXTN_SORBI
          Length = 283

 Score =  121 bits (304), Expect = 2e-26
 Identities = 82/169 (48%), Positives = 84/169 (49%), Gaps = 36/169 (21%)
 Frame = +2

Query: 11  KPPVYKPP--VEKPPEYTPPIYKPPVEKPPVY---KPPVEKPPVYKPPV----EKPPVYK 163
           K PVY PP     PP YTP   KPP  KPP Y   KPP  KPP   PPV     KPPV K
Sbjct: 101 KSPVYPPPPKASTPPTYTPSP-KPPATKPPTYPTPKPPATKPPT--PPVYTPSPKPPVTK 157

Query: 164 PPVEKP--PVY----KPPVEKPPVY----KPPVEK--PPVY----KPPVEKPPVY----K 283
           PP  KP  PVY    KPPV KPP +    KPP  K  PPVY    KPP   PP Y    K
Sbjct: 158 PPTPKPTPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTPSPKPPKPSPPTYTPTPK 217

Query: 284 PPVEKPPVYKPPVEKPPVYKP-PVEKPPVYK------PPVEKPPVYKPP 409
           PP  KPP   P   KP  + P P   PP YK      PP   PP Y PP
Sbjct: 218 PPATKPPTSTPTHPKPTPHTPYPQAHPPTYKPAPKPSPPAPTPPTYTPP 266

 Score =  119 bits (299), Expect = 8e-26
 Identities = 77/158 (48%), Positives = 80/158 (50%), Gaps = 25/158 (15%)
 Frame = +2

Query: 11  KPPVY---KPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKP--PVY----KPPVEKPPVY- 160
           KPP Y   KPP  KPP  TPP+Y P   KPPV KPP  KP  PVY    KPPV KPP + 
Sbjct: 127 KPPTYPTPKPPATKPP--TPPVYTPS-PKPPVTKPPTPKPTPPVYTPNPKPPVTKPPTHT 183

Query: 161 ---KPPVEKP--PVY----KPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKP-PVEK 298
              KPP  KP  PVY    KPP   PP Y    KPP  KPP   P   KP  + P P   
Sbjct: 184 PSPKPPTSKPTPPVYTPSPKPPKPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPYPQAH 243

Query: 299 PPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PP YKP P   PP   PP   PPV   P   PP   PP
Sbjct: 244 PPTYKPAPKPSPPAPTPPTYTPPVSHTPSSPPPPPPPP 281

 Score =  114 bits (286), Expect = 3e-24
 Identities = 84/187 (44%), Positives = 86/187 (45%), Gaps = 54/187 (28%)
 Frame = +2

Query: 11  KPPVYKPPVEKPP---------------EYTPPIYKP----------PVEKPPVYKP-PV 112
           KPP   P  EKPP               + TPP Y P          P   PP Y P P 
Sbjct: 40  KPPAKGPKPEKPPTKGHGHKPEKPPKEHKPTPPTYTPSPKPTPPPATPKPTPPTYTPSPK 99

Query: 113 EKPPVYKPP--VEKPPVY----KPPVEKPPVY---KPPVEK---PPVYKPPVEKPPVYKP 256
            K PVY PP     PP Y    KPP  KPP Y   KPP  K   PPVY P   KPPV KP
Sbjct: 100 PKSPVYPPPPKASTPPTYTPSPKPPATKPPTYPTPKPPATKPPTPPVYTPS-PKPPVTKP 158

Query: 257 PVEK--PPVY----KPPVEKPPVY----KPPVEK--PPVY----KPPVEKPPVYKPPVEK 388
           P  K  PPVY    KPPV KPP +    KPP  K  PPVY    KPP   PP Y  P  K
Sbjct: 159 PTPKPTPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTPSPKPPKPSPPTY-TPTPK 217

Query: 389 PPVYKPP 409
           PP  KPP
Sbjct: 218 PPATKPP 224

 Score =  112 bits (280), Expect = 1e-23
 Identities = 78/161 (48%), Positives = 82/161 (50%), Gaps = 28/161 (17%)
 Frame = +2

Query: 8   EKPPV----YKPPVEKPPEY---TPPIYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYK 163
           EKPP     +KP  EKPP+    TPP Y P  +  P    P   PP Y P P  K PVY 
Sbjct: 49  EKPPTKGHGHKP--EKPPKEHKPTPPTYTPSPKPTPPPATPKPTPPTYTPSPKPKSPVYP 106

Query: 164 PP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVY----KPPVEKPPVYK 313
           PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPVY    KPPV KPP  K
Sbjct: 107 PPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPVYTPSPKPPVTKPPTPK 162

Query: 314 PPVEKPPVY----KPPVEKPPVY----KPPVEK--PPVYKP 406
           P    PPVY    KPPV KPP +    KPP  K  PPVY P
Sbjct: 163 P---TPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTP 200

 Score =  110 bits (274), Expect = 6e-23
 Identities = 67/141 (47%), Positives = 69/141 (48%), Gaps = 11/141 (7%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEK--PPVY----KPPV 172
           KPPV KPP  KP   TPP+Y P   KPPV KPP   P   KPP  K  PPVY    KPP 
Sbjct: 152 KPPVTKPPTPKP---TPPVYTPN-PKPPVTKPPTHTPSP-KPPTSKPTPPVYTPSPKPPK 206

Query: 173 EKPPVY----KPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPV 337
             PP Y    KPP  KPP   P   KP  + P P   PP YKP     P   PP   PP 
Sbjct: 207 PSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPYPQAHPPTYKP----APKPSPPAPTPPT 262

Query: 338 YKPPVEKPPVYKPPVEKPPVY 400
           Y PPV   P   PP   PP Y
Sbjct: 263 YTPPVSHTPSSPPPPPPPPYY 283

 Score =  103 bits (257), Expect = 6e-21
 Identities = 69/153 (45%), Positives = 70/153 (45%), Gaps = 24/153 (15%)
 Frame = +2

Query: 23  YKPPVEKPPEYTPPIYKPPV-------EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           Y  P  KPP   P   KPP        EKPP    P   PP Y P  +  P    P   P
Sbjct: 34  YPTPTPKPPAKGPKPEKPPTKGHGHKPEKPPKEHKPT--PPTYTPSPKPTPPPATPKPTP 91

Query: 182 PVYKP-PVEKPPVYKPP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
           P Y P P  K PVY PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPVY
Sbjct: 92  PTYTPSPKPKSPVYPPPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPVY 147

Query: 341 ----KPPVEKPPVYKP------PVEKPPVYKPP 409
               KPPV KPP  KP      P  KPPV KPP
Sbjct: 148 TPSPKPPVTKPPTPKPTPPVYTPNPKPPVTKPP 180

[88][TOP]
>UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RZI2_RICCO
          Length = 829

 Score =  121 bits (303), Expect = 3e-26
 Identities = 69/136 (50%), Positives = 78/136 (57%), Gaps = 4/136 (2%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPV 187
           PPVY PP   PP   PP++ PP   PPVY PP   PP  V+ PP   PPV+ PP   PPV
Sbjct: 665 PPVYSPPPPSPP---PPVHSPP---PPVYSPPPPSPPPPVHSPP---PPVHSPP---PPV 712

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           + PP   PPVY PP   PP   PP+    PPVY PP   PPV  PP   PPV+ PP   P
Sbjct: 713 HSPP---PPVYSPPPPSPPSPPPPMHSPPPPVYSPP--PPPVRSPP---PPVHSPP---P 761

Query: 362 PVYKPPVEKPPVYKPP 409
           PV+ PP   PP+Y PP
Sbjct: 762 PVHSPP---PPIYSPP 774

 Score =  115 bits (288), Expect = 2e-24
 Identities = 66/134 (49%), Positives = 76/134 (56%), Gaps = 2/134 (1%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PPVY PP   PP   PP++ PP   PPV+ PP   PPV+ PP   PPVY PP   PP   
Sbjct: 684 PPVYSPPPPSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPPPPSPPSPP 731

Query: 194 PPVEK--PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           PP+    PPVY PP   PPV  PP   PPV+ PP   PPV+ PP   PP+Y PP   PP 
Sbjct: 732 PPMHSPPPPVYSPP--PPPVRSPP---PPVHSPP---PPVHSPP---PPIYSPP---PPR 777

Query: 368 YKPPVEKPPVYKPP 409
           + PP   PP + PP
Sbjct: 778 FSPP---PPRFSPP 788

 Score =  112 bits (280), Expect = 1e-23
 Identities = 67/136 (49%), Positives = 74/136 (54%), Gaps = 2/136 (1%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           + PP   PPV  PP   PP+Y PP   PP   PPV  PP   PPV  PP   PP   PPV
Sbjct: 654 QSPP---PPVNSPP---PPVYSPPPPSPP---PPVHSPP---PPVYSPP---PPSPPPPV 698

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKP 361
           + PP   PPV+ PP   PPV+ PP   PPVY PP   PP   PP+    PPVY PP   P
Sbjct: 699 HSPP---PPVHSPP---PPVHSPP---PPVYSPPPPSPPSPPPPMHSPPPPVYSPP--PP 747

Query: 362 PVYKPPVEKPPVYKPP 409
           PV  PP   PPV+ PP
Sbjct: 748 PVRSPP---PPVHSPP 760

 Score =  108 bits (271), Expect = 1e-22
 Identities = 67/136 (49%), Positives = 73/136 (53%), Gaps = 4/136 (2%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP   PP   PP  +PP   PPV  PP   PPV  PP   PP   PPV+ PP   PPVY 
Sbjct: 644 PPGQSPP---PPTQSPP---PPVNSPP---PPVYSPP---PPSPPPPVHSPP---PPVYS 688

Query: 194 PPVEK--PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK--P 361
           PP     PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PP   PP+    P
Sbjct: 689 PPPPSPPPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPPPPSPPSPPPPMHSPPP 739

Query: 362 PVYKPPVEKPPVYKPP 409
           PVY PP   PPV  PP
Sbjct: 740 PVYSPP--PPPVRSPP 753

 Score =  107 bits (266), Expect = 5e-22
 Identities = 64/136 (47%), Positives = 71/136 (52%), Gaps = 4/136 (2%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP        PP  +PP   PP + PP   PPV  PP   PPV  PP   PP   PPV+ 
Sbjct: 634 PPTTPEQSPSPPGQSPP---PPTQSPP---PPVNSPP---PPVYSPP---PPSPPPPVHS 681

Query: 194 PPVEKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           PP   PPVY PP     PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PP 
Sbjct: 682 PP---PPVYSPPPPSPPPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPPPPSPPS 729

Query: 368 YKPPVEK--PPVYKPP 409
             PP+    PPVY PP
Sbjct: 730 PPPPMHSPPPPVYSPP 745

 Score =  103 bits (257), Expect = 6e-21
 Identities = 62/134 (46%), Positives = 71/134 (52%), Gaps = 2/134 (1%)
 Frame = +2

Query: 14  PPVYKPP--VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PPV+ PP  V  PP   PP++ PP   PPVY PP   PP   PP+  PP        PPV
Sbjct: 696 PPVHSPPPPVHSPP---PPVHSPP---PPVYSPPPPSPPSPPPPMHSPP--------PPV 741

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           Y PP   PPV  PP   PPV+ PP   PPV+ PP   PP+Y PP   PP + PP   PP 
Sbjct: 742 YSPP--PPPVRSPP---PPVHSPP---PPVHSPP---PPIYSPP---PPRFSPP---PPR 784

Query: 368 YKPPVEKPPVYKPP 409
           + PP   PP   PP
Sbjct: 785 FSPP---PPTSSPP 795

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 59/124 (47%), Positives = 68/124 (54%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PPV+ PP   PP Y+PP   PP   PP++ PP   PPVY PP   PPV  PP   PPV+ 
Sbjct: 710  PPVHSPP---PPVYSPPPPSPPSPPPPMHSPP---PPVYSPP--PPPVRSPP---PPVHS 758

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PP   PPV+ PP   PP+Y PP   PP + PP   PP + PP   PP   PP   P V  
Sbjct: 759  PP---PPVHSPP---PPIYSPP---PPRFSPP---PPRFSPP---PPTSSPP-PTPTVAA 802

Query: 374  PPVE 385
            PP E
Sbjct: 803  PPPE 806

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 59/130 (45%), Positives = 66/130 (50%), Gaps = 3/130 (2%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PPVY PP   PP   PP++ PP   PPVY PP   PPV  PP   PPV+ PP   PPV+ 
Sbjct: 717  PPVYSPPPPSPPSPPPPMHSPP---PPVYSPP--PPPVRSPP---PPVHSPP---PPVHS 765

Query: 194  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK---PP 364
            PP   PP+Y PP   PP + PP   PP + PP   PP   PP   P V  PP E    PP
Sbjct: 766  PP---PPIYSPP---PPRFSPP---PPRFSPP---PPTSSPP-PTPTVAAPPPEDFILPP 812

Query: 365  VYKPPVEKPP 394
                    PP
Sbjct: 813  NIGFQYSSPP 822

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 53/143 (37%), Positives = 59/143 (41%), Gaps = 11/143 (7%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVE----KPPVYKPPVEKP--PVYKPPVEKP--PVYKPP 169
           P     P  +P E T P   P  E    +P     P  +P  P   P  E P      P 
Sbjct: 562 PTTSPSPSPEPSEPTSPTTSPSPEYNSSEPSPTPSPESEPQSPTSTPSPESPLSSPTSPT 621

Query: 170 VEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
           +E+ P   PP + PP   P     PP   PP   PP   PP   PPV  PP   PPVY P
Sbjct: 622 LEQSP--SPPGQSPPPTTPEQSPSPPGQSPP---PPTQSPP---PPVNSPP---PPVYSP 670

Query: 347 PVEKPPVYKPPVEK--PPVYKPP 409
           P   PP   PPV    PPVY PP
Sbjct: 671 PPPSPP---PPVHSPPPPVYSPP 690

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 58/191 (30%), Positives = 65/191 (34%), Gaps = 59/191 (30%)
 Frame = +2

Query: 14   PPVYKPPVE-KPPEYTPPIYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE---- 175
            PP   P +  +P E T P   P P  +P     P   P       E  P   P  E    
Sbjct: 545  PPTTSPSLSPEPSEPTSPTTSPSPSPEPSEPTSPTTSPSPEYNSSEPSPTPSPESEPQSP 604

Query: 176  ---------------------------------------------KPPVYKPP----VEK 208
                                                          PP   PP       
Sbjct: 605  TSTPSPESPLSSPTSPTLEQSPSPPGQSPPPTTPEQSPSPPGQSPPPPTQSPPPPVNSPP 664

Query: 209  PPVYKPPVEK--PPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVEKPPVYKP 376
            PPVY PP     PPV+ PP   PPVY PP     PPV+ PP   PPV+ PP   PPV+ P
Sbjct: 665  PPVYSPPPPSPPPPVHSPP---PPVYSPPPPSPPPPVHSPP---PPVHSPP---PPVHSP 715

Query: 377  PVEKPPVYKPP 409
            P   PPVY PP
Sbjct: 716  P---PPVYSPP 723

[89][TOP]
>UniRef100_C9ZT09 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei
           gambiense DAL972 RepID=C9ZT09_TRYBG
          Length = 507

 Score =  121 bits (303), Expect = 3e-26
 Identities = 77/184 (41%), Positives = 96/184 (52%), Gaps = 55/184 (29%)
 Frame = +2

Query: 23  YKPPVEKPPEYTPPIYKPPVEKPP--VYKPPVEKPP--VYKPPVEKP--PVYKPPVEKPP 184
           YKPPV+KP      +Y+PP EKP    Y+PP +KP    YKPP +KP    Y+PP +KP 
Sbjct: 227 YKPPVDKP---VSGVYRPPTEKPTSGAYRPPTDKPATGAYKPPTDKPFSGAYRPPADKPS 283

Query: 185 --VYKPPV------------------EKPPV--YKPPVEKPP--VYKPPVEKPP--VYKP 286
              Y+P                    EKP V  Y+PP++KP    YKPPV+KP    YKP
Sbjct: 284 SGAYRPTAAKLGEVMAAATARDETSSEKPAVGAYRPPIDKPSSGAYKPPVDKPSSGAYKP 343

Query: 287 PVEKPPV--YKPPVEKPP-----------------VYKPPVEKPP--VYKPPVEKPP--V 397
           P +KP +  YKPP EKP                   Y+PP +KPP  VYKPPV+KP    
Sbjct: 344 PTDKPSLGAYKPPSEKPASVPAVPAESSAVKPSTGAYRPPTDKPPTGVYKPPVDKPSTGA 403

Query: 398 YKPP 409
           Y+PP
Sbjct: 404 YRPP 407

 Score =  114 bits (284), Expect = 4e-24
 Identities = 85/216 (39%), Positives = 102/216 (47%), Gaps = 81/216 (37%)
 Frame = +2

Query: 5   VEKPP--VYKPPVEKPPE--YTPPI-------YKPPVEKP--PVYKPPVEKPP--VYKPP 139
           V+KP   VY+PP EKP    Y PP        YKPP +KP    Y+PP +KP    Y+P 
Sbjct: 231 VDKPVSGVYRPPTEKPTSGAYRPPTDKPATGAYKPPTDKPFSGAYRPPADKPSSGAYRPT 290

Query: 140 V------------------EKPPV--YKPPVEKPP--VYKPPVEKPP--VYKPPVEKPPV 247
                              EKP V  Y+PP++KP    YKPPV+KP    YKPP +KP +
Sbjct: 291 AAKLGEVMAAATARDETSSEKPAVGAYRPPIDKPSSGAYKPPVDKPSSGAYKPPTDKPSL 350

Query: 248 --YKPPVEKPP-----------------VYKPPVEKPP--VYKPPVEKPP--VYKPPVEK 358
             YKPP EKP                   Y+PP +KPP  VYKPPV+KP    Y+PP +K
Sbjct: 351 GAYKPPSEKPASVPAVPAESSAVKPSTGAYRPPTDKPPTGVYKPPVDKPSTGAYRPPTDK 410

Query: 359 PP---VYKPP--------------VEKPP--VYKPP 409
           P     Y PP              VEKP    YKPP
Sbjct: 411 PSSGGAYVPPSERLATAAPGEQLSVEKPSAGTYKPP 446

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 49/125 (39%), Positives = 67/125 (53%), Gaps = 21/125 (16%)
 Frame = +2

Query: 8   EKPP--VYKPPVEKPPEYTPPIYKPPVEKPP---VYKPPVEKPPVYKP----PVEKPP-- 154
           +KPP  VYKPPV+KP   +   Y+PP +KP     Y PP E+     P     VEKP   
Sbjct: 385 DKPPTGVYKPPVDKP---STGAYRPPTDKPSSGGAYVPPSERLATAAPGEQLSVEKPSAG 441

Query: 155 VYKPPVEK--PPVYKPPVEKPP--VYKPPVEK--PPVYKPPVEKPP--VYKPPVEKP--P 304
            YKPP ++     YKPP ++P    YKPP +K     Y+PP ++P    Y+PP E+    
Sbjct: 442 TYKPPTDRVSSGSYKPPTDRPSAGAYKPPTDKLSSGAYRPPTDRPSSGAYRPPAERSFGS 501

Query: 305 VYKPP 319
            ++PP
Sbjct: 502 TFRPP 506

[90][TOP]
>UniRef100_Q9SET1 Cell wall-plasma membrane linker protein homolog n=1
           Tax=Arabidopsis thaliana RepID=Q9SET1_ARATH
          Length = 306

 Score =  120 bits (302), Expect = 4e-26
 Identities = 69/155 (44%), Positives = 73/155 (47%), Gaps = 22/155 (14%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTP---PIYKP-PVEKPPVYKPPVEKPP-VYKPPVE------KPPV 157
           KPP  KPP  KPP   P   P  KP P  KPP+ KPP + PP   KPP +      KP  
Sbjct: 56  KPPAVKPPTPKPPTVKPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPSPSTPKPST 115

Query: 158 YKPP--VEKPPVYKP---------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 304
            KPP    KPP +KP         P   PPV  PP    PV  PP   PPV  P    PP
Sbjct: 116 TKPPPSTPKPPHHKPSPTPCPPPTPTPTPPVVTPPTPTHPVITPPTPTPPVVTPATPTPP 175

Query: 305 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           V  PP   PPV  PP   PPV  PP   PPV  PP
Sbjct: 176 VITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPP 210

 Score =  115 bits (289), Expect = 1e-24
 Identities = 67/159 (42%), Positives = 70/159 (44%), Gaps = 27/159 (16%)
 Frame = +2

Query: 11  KPPVYKPPVEKP---------PEYTPPIYKPPVEKPP-VYKPPVE------KPPVYKPP- 139
           KPP  KPP  KP         P   PPI KPP + PP   KPP +      KP   KPP 
Sbjct: 61  KPPTPKPPTVKPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPSPSTPKPSTTKPPP 120

Query: 140 -VEKPPVYKP---------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 289
              KPP +KP         P   PPV  PP    PV  PP   PPV  P    PPV  PP
Sbjct: 121 STPKPPHHKPSPTPCPPPTPTPTPPVVTPPTPTHPVITPPTPTPPVVTPATPTPPVITPP 180

Query: 290 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
              PPV  PP   PPV  PP   PPV  PP   PP   P
Sbjct: 181 TPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIP 219

 Score =  108 bits (269), Expect = 2e-22
 Identities = 68/169 (40%), Positives = 75/169 (44%), Gaps = 37/169 (21%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP--------- 166
           PP   P   KPP++  P+ KPP  KPP  KPP  KPP  KPP  KPP  KP         
Sbjct: 29  PPKPSPAPHKPPKH--PV-KPP--KPPAVKPP--KPPAVKPPTPKPPTVKPHPKPPTKPH 81

Query: 167 PVEKPPVYKPPVEKPP-VYKPPVE------------------KPPVYKP---------PV 262
           P  KPP+ KPP + PP   KPP +                  KPP +KP         P 
Sbjct: 82  PHPKPPIVKPPTKPPPSTPKPPTKPSPSTPKPSTTKPPPSTPKPPHHKPSPTPCPPPTPT 141

Query: 263 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
             PPV  PP    PV  PP   PPV  P    PPV  PP   PPV  PP
Sbjct: 142 PTPPVVTPPTPTHPVITPPTPTPPVVTPATPTPPVITPPTPTPPVITPP 190

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 34/74 (45%), Positives = 35/74 (47%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP    PV  PP  TPP+  P    PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 146 VVTPPTPTHPVITPPTPTPPVVTPATPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPP 205

Query: 185 VYKPPVEKPPVYKP 226
           V  PP   PP   P
Sbjct: 206 VVTPPTPTPPTPIP 219

[91][TOP]
>UniRef100_P93705 Hypocotil specific n=1 Tax=Daucus carota RepID=P93705_DAUCA
          Length = 347

 Score =  120 bits (302), Expect = 4e-26
 Identities = 65/136 (47%), Positives = 73/136 (53%), Gaps = 2/136 (1%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           EKPP    P  KP  + PP  KPPV KPP+ KPPV KPPV KPPV KPP+ KPP+ KPP 
Sbjct: 17  EKPP----PHHKPAPHKPPTVKPPVVKPPIVKPPVVKPPVVKPPVVKPPIVKPPIVKPPG 72

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
             PP+  P +  P V  P V  P V    PP   PP   PP   PP   PP   PP++ P
Sbjct: 73  LLPPILPPGILPPGVLPPGVLPPGVLPPLPPGVLPPGILPPGVLPPGVLPPGVVPPIKPP 132

Query: 362 PVYKPPVEKPPVYKPP 409
               PP   PP   PP
Sbjct: 133 GGLLPPGVLPPGVLPP 148

 Score =  107 bits (268), Expect = 3e-22
 Identities = 61/135 (45%), Positives = 70/135 (51%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V KPP+ KPPV KPP   PP+ KPP+ KPP+ KPP   PP+  PP   PP   PP   PP
Sbjct: 37  VVKPPIVKPPVVKPPVVKPPVVKPPIVKPPIVKPPGLLPPIL-PPGILPPGVLPPGVLPP 95

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
              PP+  PP   PP   PP   PP   PP   PP++ P    PP   PP   PP   PP
Sbjct: 96  GVLPPL--PPGVLPPGILPPGVLPPGVLPPGVVPPIKPPGGLLPPGVLPPGVLPPGVLPP 153

Query: 365 VYKPPVEKPPVYKPP 409
           +  PP   PP   PP
Sbjct: 154 L--PPGVLPPGVLPP 166

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 62/194 (31%), Positives = 68/194 (35%), Gaps = 59/194 (30%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPV----------------------EK 118
           + KPPV KPPV KPP   PPI KPP+ KPP   PP+                        
Sbjct: 42  IVKPPVVKPPVVKPPVVKPPIVKPPIVKPPGLLPPILPPGILPPGVLPPGVLPPGVLPPL 101

Query: 119 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV------- 277
           PP   PP   PP   PP   PP   PP++ P    PP   PP   PP   PP+       
Sbjct: 102 PPGVLPPGILPPGVLPPGVLPPGVVPPIKPPGGLLPPGVLPPGVLPPGVLPPLPPGVLPP 161

Query: 278 ------------------------------YKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
                                           PP   PP   PP   PP   PP   PP 
Sbjct: 162 GVLPPLPPGVLPPGVLPPGVLPPGIKPPGGLLPPGVLPPGVLPPGILPPGILPPGVLPPG 221

Query: 368 YKPPVEKPPVYKPP 409
             PP   PP  KPP
Sbjct: 222 ILPPGILPPGVKPP 235

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 56/132 (42%), Positives = 58/132 (43%), Gaps = 1/132 (0%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-Y 190
           PP   PP   PP   PP+  PP   PP   PP+  PP   PP   PP   PP  KPP   
Sbjct: 137 PPGVLPPGVLPPGVLPPL--PPGVLPPGVLPPL--PPGVLPPGVLPPGVLPPGIKPPGGL 192

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
            PP   PP   PP   PP   PP   PP   PP   PP  KPPV  PP  KPP    P  
Sbjct: 193 LPPGVLPPGVLPPGILPPGILPPGVLPPGILPPGILPPGVKPPV-LPPTTKPPSPGTPC- 250

Query: 371 KPPVEKPPVYKP 406
            PP  K P   P
Sbjct: 251 -PPGAKTPPSAP 261

[92][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score =  120 bits (302), Expect = 4e-26
 Identities = 67/143 (46%), Positives = 71/143 (49%), Gaps = 8/143 (5%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           V  PPVY PP    P   PP+Y PP   P    PVY PP   PPVY PP   PPVY PP 
Sbjct: 244 VPSPPVYLPPPVYSPPPPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPP-PPPPVYSPP- 301

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVY 340
             PP   PP   PPVY PP   PP   PP   PPVY     PP   PP   PP   PP  
Sbjct: 302 --PPPPSPPPPPPPVYSPP--PPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCV 357

Query: 341 KPPVEKPPVYKPPVEKPPVYKPP 409
           +PP   PP   PP   PP++ PP
Sbjct: 358 RPPPPPPPNSPPP--PPPLFSPP 378

 Score =  115 bits (289), Expect = 1e-24
 Identities = 66/129 (51%), Positives = 70/129 (54%)
 Frame = +2

Query: 23  YKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 202
           + P +  PP  +PP+   PV  PPVY PP    PVY PP   PPVY PP   PP   PP 
Sbjct: 228 FVPTLPAPPPPSPPM---PVPSPPVYLPP----PVYSPP-PPPPVYSPP---PP---PPS 273

Query: 203 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 382
             PPVY PP   PPVY PP   PPVY PP   PP   PP   PPVY PP   PP   PP 
Sbjct: 274 PPPPVYSPPPPPPPVYSPP-PPPPVYSPP---PPPPSPPPPPPPVYSPP--PPPSPPPPS 327

Query: 383 EKPPVYKPP 409
             PPVY PP
Sbjct: 328 PPPPVYSPP 336

 Score =  114 bits (286), Expect = 3e-24
 Identities = 67/140 (47%), Positives = 71/140 (50%), Gaps = 8/140 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYK----PPVEKPPVYKPPVEKP 181
           PP   PP+  P   +PP+Y PP    PVY PP   PPVY     PP   PPVY PP   P
Sbjct: 235 PPPPSPPMPVP---SPPVYLPP----PVYSPP-PPPPVYSPPPPPPSPPPPVYSPPPPPP 286

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----PP 349
           PVY PP   PPVY PP   PP   PP   PPVY PP   PP   PP   PPVY     PP
Sbjct: 287 PVYSPP-PPPPVYSPP---PPPPSPPPPPPPVYSPP--PPPSPPPPSPPPPVYSPPPPPP 340

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
              PP   PP   PP  +PP
Sbjct: 341 SPPPPSPPPPSPLPPCVRPP 360

 Score =  109 bits (272), Expect = 1e-22
 Identities = 62/132 (46%), Positives = 66/132 (50%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PPVY PP   PP Y+PP   PP   PPVY PP   PP   PP   PPVY PP   PP   
Sbjct: 276 PPVYSPPPPPPPVYSPP---PP---PPVYSPP---PPPPSPPPPPPPVYSPP--PPPSPP 324

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP   PPVY PP   PP   PP   PP   PP   PP  +PP   PP   PP   PP++ 
Sbjct: 325 PPSPPPPVYSPP---PPPPSPPPPSPP---PPSPLPPCVRPPPPPPPNSPPP--PPPLFS 376

Query: 374 PPVEKPPVYKPP 409
           PP   P  Y  P
Sbjct: 377 PPPPTPYYYSSP 388

 Score =  103 bits (258), Expect = 5e-21
 Identities = 59/135 (43%), Positives = 64/135 (47%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V  PP   PPV  PP   PP+Y PP   PP   PP   PPVY PP   PP   PP   PP
Sbjct: 278 VYSPPPPPPPVYSPPP-PPPVYSPP---PPPPSPPPPPPPVYSPP--PPPSPPPPSPPPP 331

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           VY PP   PP   PP   PP   PP   PP  +PP   PP   PP   PP++ PP   P 
Sbjct: 332 VYSPP---PPPPSPPPPSPP---PPSPLPPCVRPPPPPPPNSPPP--PPPLFSPPPPTPY 383

Query: 365 VYKPPVEKPPVYKPP 409
            Y  P    P + PP
Sbjct: 384 YYSSPPPPSPPHSPP 398

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 57/135 (42%), Positives = 63/135 (46%), Gaps = 3/135 (2%)
 Frame = +2

Query: 14  PPVYKPPV---EKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           PPVY PP      PP   PP+Y PP   PP   PP   PPVY PP   PP   PP   PP
Sbjct: 295 PPVYSPPPPPPSPPPP-PPPVYSPP--PPPSPPPPSPPPPVYSPP---PPPPSPPPPSPP 348

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
              PP   PP  +PP   PP   PP   PP++ PP   P  Y  P    P + PP   PP
Sbjct: 349 ---PPSPLPPCVRPPPPPPPNSPPP--PPPLFSPPPPTPYYYSSPPPPSPPHSPP---PP 400

Query: 365 VYKPPVEKPPVYKPP 409
            + PP   PP   PP
Sbjct: 401 PHSPPPPSPPHSPPP 415

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 70/194 (36%), Positives = 74/194 (38%), Gaps = 62/194 (31%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKP-------PVYKPPV 172
           PPVY PP   PP   PP+Y PP   PPVY PP   PPVY PP   P       PVY PP 
Sbjct: 262 PPVYSPP-PPPPSPPPPVYSPPPPPPPVYSPP-PPPPVYSPPPPPPSPPPPPPPVYSPP- 318

Query: 173 EKPPVYKPPVEKPPVYKPP--------------------VEKPPVYKP--PVEKPPVYKP 286
             PP   PP   PPVY PP                    V  PP   P  P   PP++ P
Sbjct: 319 -PPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPPPPPLFSP 377

Query: 287 PVEKPPVYK-----------------------------PPVEKP-PVY---KPPVEKPPV 367
           P   P  Y                              PP   P P+Y    PP    PV
Sbjct: 378 PPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPV 437

Query: 368 YKPPVEKPPVYKPP 409
           Y PP   PPVY PP
Sbjct: 438 YSPP--PPPVYSPP 449

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 53/102 (51%), Positives = 53/102 (51%), Gaps = 4/102 (3%)
 Frame = +2

Query: 116 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----PPVEKPPVYK 283
           KP V   P   PP    PV  PPVY PP    PVY PP   PPVY     PP   PPVY 
Sbjct: 226 KPFVPTLPAPPPPSPPMPVPSPPVYLPP----PVYSPP-PPPPVYSPPPPPPSPPPPVYS 280

Query: 284 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PP   PPVY PP   PPVY PP   PP   PP   PPVY PP
Sbjct: 281 PPPPPPPVYSPP-PPPPVYSPP---PPPPSPPPPPPPVYSPP 318

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 61/154 (39%), Positives = 66/154 (42%), Gaps = 22/154 (14%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PPVY PP   PP   PP   PP   PP  +PP   PP   PP   PP++ PP   P  Y 
Sbjct: 330 PPVYSPP-PPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPP--PPPLFSPPPPTPYYYS 386

Query: 194 ------------PPVEKPPVYKPPVEKPPVYKPPVEKP-PVY---KPPVEKPPVYKPPVE 325
                       PP   PP   PP   PP   PP   P P+Y    PP    PVY PP  
Sbjct: 387 SPPPPSPPHSPPPPPHSPPPPSPPHSPPP---PPHSPPPPIYPYLSPPPPPHPVYSPP-- 441

Query: 326 KPPVYKPPVEKPPVYKPPVEKPP------VYKPP 409
            PPVY PP   PP   PP  +PP       Y PP
Sbjct: 442 PPPVYSPP---PPPSPPPCIEPPPPPPCAEYSPP 472

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 56/142 (39%), Positives = 63/142 (44%), Gaps = 10/142 (7%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP---IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           PP  +PP   PP   PP   ++ PP   P  Y  P    P + PP   PP + PP   PP
Sbjct: 354 PPCVRPPPPPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPP---PPPHSPPPPSPP 410

Query: 185 VYKPPV--EKP-PVY---KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
              PP     P P+Y    PP    PVY PP   PPVY PP   PP   PP  +PP   P
Sbjct: 411 HSPPPPPHSPPPPIYPYLSPPPPPHPVYSPP--PPPVYSPP---PPPSPPPCIEPPPPPP 465

Query: 347 PVE-KPPVYKPPVEKPPVYKPP 409
             E  PP   P    P  YKPP
Sbjct: 466 CAEYSPPPPSPSPPPPTQYKPP 487

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 59/147 (40%), Positives = 65/147 (44%), Gaps = 15/147 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT--PPIYKPPVEKPPVYKPPVEKPPVYKPPVEK---PPVY---KPP 169
           PP++ PP   P  Y+  PP   P    PP + PP   PP   PP      PP+Y    PP
Sbjct: 372 PPLFSPPPPTPYYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPP 431

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKP 346
               PVY PP   PPVY PP   PP   PP  +PP   P  E  PP   P    P  YKP
Sbjct: 432 PPPHPVYSPP--PPPVYSPP---PPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKP 486

Query: 347 PVE----KPPV--YKPPVEKPPVYKPP 409
           P       PPV  Y PP   PP   PP
Sbjct: 487 PPSPSPPPPPVHYYSPP---PPSQSPP 510

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 57/140 (40%), Positives = 62/140 (44%), Gaps = 8/140 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           PP   P    PP ++PP   PP   PP  + PP    P   PP    PVY PP   PPVY
Sbjct: 389 PPPSPPHSPPPPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPP--PPPVY 446

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVE----KPPV--YKPP 349
            PP   PP   PP  +PP   P  E  PP   P    P  YKPP       PPV  Y PP
Sbjct: 447 SPP---PPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPP 503

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
              PP   PP    PVY+ P
Sbjct: 504 ---PPSQSPP-PPAPVYEGP 519

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 51/125 (40%), Positives = 57/125 (45%), Gaps = 2/125 (1%)
 Frame = +2

Query: 29  PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 208
           PP   PP   P +  PP    PVY PP   PPVY PP   PP   PP  +PP   P  E 
Sbjct: 416 PPHSPPPPIYPYL-SPPPPPHPVYSPP--PPPVYSPP---PPPSPPPCIEPPPPPPCAEY 469

Query: 209 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPV 382
            P   PP   PP   PP +  P   P    PPV  Y PP   PP   PP    PVY+ P+
Sbjct: 470 SP--PPPSPSPP---PPTQYKPPPSPSPPPPPVHYYSPP---PPSQSPP-PPAPVYEGPL 520

Query: 383 EKPPV 397
             PP+
Sbjct: 521 --PPI 523

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 52/132 (39%), Positives = 58/132 (43%), Gaps = 5/132 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEK---PPVYKPPVEKPPVYKPPVEKPP 184
           PP+Y  P   PP    P+Y PP   PPVY PP      P +  PP      Y PP   PP
Sbjct: 422 PPIY--PYLSPPPPPHPVYSPP--PPPVYSPPPPPSPPPCIEPPPPPPCAEYSPP---PP 474

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPVEK 358
              PP   P  YKPP    P   PP   PPV  Y PP   PP   PP    PVY+ P+  
Sbjct: 475 SPSPP--PPTQYKPPPSPSP---PP---PPVHYYSPP---PPSQSPP-PPAPVYEGPL-- 520

Query: 359 PPVYKPPVEKPP 394
           PP+       PP
Sbjct: 521 PPITGVSYASPP 532

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 49/122 (40%), Positives = 53/122 (43%), Gaps = 3/122 (2%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           PPVY PP   PP   PP  +PP   P   Y PP   PP   PP   P  YKPP    P  
Sbjct: 443 PPVYSPP---PPPSPPPCIEPPPPPPCAEYSPP---PPSPSPP--PPTQYKPPPSPSP-- 492

Query: 191 KPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            PP   PPV  Y PP   PP   PP    PVY+ P+  PP+       PP        PP
Sbjct: 493 -PP---PPVHYYSPP---PPSQSPP-PPAPVYEGPL--PPITGVSYASPP-------PPP 535

Query: 365 VY 370
            Y
Sbjct: 536 YY 537

[93][TOP]
>UniRef100_A8XU99 Putative uncharacterized protein (Fragment) n=1 Tax=Caenorhabditis
           briggsae RepID=A8XU99_CAEBR
          Length = 2024

 Score =  120 bits (302), Expect = 4e-26
 Identities = 67/135 (49%), Positives = 76/135 (56%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE+ P    P+   PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 348 VEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAP 407

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PVEK PV   PVE  PV K PVE  PV   PVE+ PV   PVE+ P
Sbjct: 408 VEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKP 467

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 468 VEAAPVEAAPVEEKP 482

 Score =  120 bits (302), Expect = 4e-26
 Identities = 67/135 (49%), Positives = 76/135 (56%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE  P    P+   PVE+ PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 358 VEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAP 417

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVEK PV   PVE  PV K PVE  PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 418 VEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 477

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV + P
Sbjct: 478 VEEKPVEAAPVEEKP 492

 Score =  120 bits (301), Expect = 5e-26
 Identities = 67/135 (49%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 679  VEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAP 738

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVEK PV   PVE  P
Sbjct: 739  VEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAP 798

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV  PP
Sbjct: 799  VEEKPVEAAPVEAPP 813

 Score =  120 bits (300), Expect = 6e-26
 Identities = 67/135 (49%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+ + PVE  PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 308 VEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAP 367

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV   PVEK P
Sbjct: 368 VEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKP 427

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV K P
Sbjct: 428 VEAAPVEAAPVEKKP 442

 Score =  120 bits (300), Expect = 6e-26
 Identities = 67/135 (49%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P    P+ + PVE  PV   PVE  PV   PVE+ PV   PVE  P
Sbjct: 338 VEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAP 397

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV + PVE  PV   PVEK PV   PVE  PV K PVE  PV   PVE+ P
Sbjct: 398 VKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKP 457

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 458 VEAAPVEEKPVEAAP 472

 Score =  119 bits (299), Expect = 8e-26
 Identities = 67/135 (49%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE  P    P+   PVE+ PV   PVE  PV K PVE  PV   PVEK P
Sbjct: 383 VEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKP 442

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 443 VEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 502

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 503 VKEKPVEAAPVEAAP 517

 Score =  119 bits (299), Expect = 8e-26
 Identities = 67/135 (49%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+   PVE  PV K PVE  PV   PVEK PV   PVE  P
Sbjct: 393 VEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAP 452

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 453 VEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 512

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 513 VEAAPVEEKPVEAAP 527

 Score =  119 bits (298), Expect = 1e-25
 Identities = 66/135 (48%), Positives = 76/135 (56%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+ + PVE  PV + PVE  PV   PVEK PV   PVE  P
Sbjct: 378 VEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAP 437

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V K PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 438 VEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAP 497

Query: 365 VYKPPVEKPPVYKPP 409
           V   PV++ PV   P
Sbjct: 498 VEAAPVKEKPVEAAP 512

 Score =  119 bits (298), Expect = 1e-25
 Identities = 68/136 (50%), Positives = 77/136 (56%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV K PVE  P    P+ K PVE  PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 418 VEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 477

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKP 361
           V + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PPVEK 
Sbjct: 478 VEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKK 537

Query: 362 PVYKPPVEKPPVYKPP 409
           PV   PVE  PV + P
Sbjct: 538 PVEAAPVEAAPVEEKP 553

 Score =  119 bits (298), Expect = 1e-25
 Identities = 65/130 (50%), Positives = 74/130 (56%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+ + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 689  VEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 748

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV + PVE  PV   PVEK PV   PVE  PV + PVE  P
Sbjct: 749  VEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKPVEAAP 808

Query: 365  VYKPPVEKPP 394
            V  PPVE+ P
Sbjct: 809  VEAPPVERKP 818

 Score =  119 bits (297), Expect = 1e-25
 Identities = 67/135 (49%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE  P    P+   PVE  PV + PVE  PV + PVE  PV   PVEK P
Sbjct: 368 VEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKP 427

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV K PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 428 VEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 487

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 488 VEEKPVEAAPVEAAP 502

 Score =  119 bits (297), Expect = 1e-25
 Identities = 66/135 (48%), Positives = 76/135 (56%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P    P+   PV++ PV   PVE+ PV   PVE  PV K PVE  P
Sbjct: 373 VEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAP 432

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVEK PV   PVE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE+ P
Sbjct: 433 VEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKP 492

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 493 VEAAPVEAAPVKEKP 507

 Score =  119 bits (297), Expect = 1e-25
 Identities = 69/141 (48%), Positives = 77/141 (54%), Gaps = 6/141 (4%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+ K PVE  PV   PVEK PV   PVE  PV + PVE  P
Sbjct: 403 VEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAP 462

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 463 VEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 522

Query: 365 VYK------PPVEKPPVYKPP 409
           V        PPVEK PV   P
Sbjct: 523 VEAAPVEAAPPVEKKPVEAAP 543

 Score =  118 bits (296), Expect = 2e-25
 Identities = 66/135 (48%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V++ PV   PVE  P    P+ + PVE  PV + PVE  PV   PVE  PV   PVE+ P
Sbjct: 328 VKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKP 387

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PVE  PV + PVE  PV   PVEK PV   PVE  PV K PVE  P
Sbjct: 388 VEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAP 447

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 448 VEAAPVEEKPVEAAP 462

 Score =  118 bits (296), Expect = 2e-25
 Identities = 66/135 (48%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE  P    P+ + PVE  PV   PV++ PV   PVE+ PV   PVE  P
Sbjct: 363 VEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAP 422

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V K PVE  PV   PVEK PV   PVE  PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 423 VEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 482

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 483 VEAAPVEEKPVEAAP 497

 Score =  118 bits (296), Expect = 2e-25
 Identities = 66/135 (48%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+ + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 659  VEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAP 718

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 719  VEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAP 778

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVEK PV   P
Sbjct: 779  VEAAPVEKKPVEAAP 793

 Score =  118 bits (296), Expect = 2e-25
 Identities = 66/135 (48%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE+ P    P+   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 669  VEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKP 728

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVEK P
Sbjct: 729  VEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKP 788

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 789  VEAAPVEAAPVEEKP 803

 Score =  118 bits (296), Expect = 2e-25
 Identities = 65/135 (48%), Positives = 76/135 (56%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE+ P    P+   PV++ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 684  VEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 743

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PV++ PV   PVE  PV K PVE  PV   PVE+ P
Sbjct: 744  VEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKP 803

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE PPV + P
Sbjct: 804  VEAAPVEAPPVERKP 818

 Score =  118 bits (295), Expect = 2e-25
 Identities = 66/135 (48%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+   PVE+ PV   PVE+ PV   PVE  PV   PVE  P
Sbjct: 323 VEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAP 382

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PV++ PV   PVE+ PV   PVE  PV K PVE  PV   PVEK P
Sbjct: 383 VEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKP 442

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 443 VEDAPVEAAPVEEKP 457

 Score =  118 bits (295), Expect = 2e-25
 Identities = 66/135 (48%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+   PVE  PV + PVE  PV   PV++ PV   PVE+ P
Sbjct: 353 VEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKP 412

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV K PVE  PV   PVEK PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 413 VEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAP 472

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 473 VEAAPVEEKPVEAAP 487

 Score =  118 bits (295), Expect = 2e-25
 Identities = 68/136 (50%), Positives = 76/136 (55%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VEK PV   PVE  P    P+   PVE  PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 423 VEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 482

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKP 361
           V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PPV K PVE  
Sbjct: 483 VEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAA 542

Query: 362 PVYKPPVEKPPVYKPP 409
           PV   PVE+ PV   P
Sbjct: 543 PVEAAPVEEKPVEAAP 558

 Score =  117 bits (294), Expect = 3e-25
 Identities = 66/135 (48%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PV++ P    P+   PVE  PV + PVE  PV + PVE  PV   PVE  P
Sbjct: 318 VEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAP 377

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE  PV + PVE  PV + PVE  PV   PVEK PV   PVE  P
Sbjct: 378 VEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAP 437

Query: 365 VYKPPVEKPPVYKPP 409
           V K PVE  PV   P
Sbjct: 438 VEKKPVEDAPVEAAP 452

 Score =  117 bits (294), Expect = 3e-25
 Identities = 65/135 (48%), Positives = 76/135 (56%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PV++ P    P+ + PVE  PV   PVEK PV   PVE  PV K PVE  P
Sbjct: 388 VEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAP 447

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV   PV++ P
Sbjct: 448 VEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKP 507

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 508 VEAAPVEAAPVEEKP 522

 Score =  117 bits (294), Expect = 3e-25
 Identities = 65/135 (48%), Positives = 76/135 (56%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V++ PV   PVE+ P    P+   PVEK PV   PVE  PV K PVE  PV   PVE+ P
Sbjct: 398 VKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKP 457

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE  PV + PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 458 VEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 517

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 518 VEEKPVEAAPVEAAP 532

 Score =  117 bits (293), Expect = 4e-25
 Identities = 66/135 (48%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE  P    P+   PVE  PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 313 VEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKP 372

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV K PVE  P
Sbjct: 373 VEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAP 432

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVEK PV   P
Sbjct: 433 VEAAPVEKKPVEDAP 447

 Score =  117 bits (293), Expect = 4e-25
 Identities = 66/135 (48%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE  P    P+   PVE+ PV   PVE  PV   PVE  PV + PVE  P
Sbjct: 333 VEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAP 392

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PV++ PV   PVE+ PV   PVE  PV K PVE  PV   PVEK PV   PVE  P
Sbjct: 393 VEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAP 452

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV + P
Sbjct: 453 VEEKPVEAAPVEEKP 467

 Score =  117 bits (293), Expect = 4e-25
 Identities = 66/135 (48%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+   PVE  PV   PVE  PV + PVE  PV   PV++ P
Sbjct: 343 VEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKP 402

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE  PV K PVE  PV   PVEK PV   PVE  PV + PVE  P
Sbjct: 403 VEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAP 462

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 463 VEEKPVEAAPVEAAP 477

 Score =  117 bits (293), Expect = 4e-25
 Identities = 70/139 (50%), Positives = 77/139 (55%), Gaps = 5/139 (3%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTP----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 175
           EKP    P  EKP E  P    P+ K PVE  PV   PVEK PV   PVE  PV + PVE
Sbjct: 400 EKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVE 459

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
             PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE
Sbjct: 460 AAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVE 519

Query: 356 KPPVYKPPVE-KPPVYKPP 409
           + PV   PVE  PPV K P
Sbjct: 520 EKPVEAAPVEAAPPVEKKP 538

 Score =  117 bits (293), Expect = 4e-25
 Identities = 67/132 (50%), Positives = 75/132 (56%), Gaps = 1/132 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV K PVE  P    P+ + PVE  PV + PVE  PV   PVE+ PV   PVE+ P
Sbjct: 433 VEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKP 492

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKP 361
           V   PVE  PV + PVE  PV   PVE+ PV   PVE  PPV K PVE  PV   PVE+ 
Sbjct: 493 VEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEK 552

Query: 362 PVYKPPVEKPPV 397
           PV   PVE  PV
Sbjct: 553 PVEAAPVEAAPV 564

 Score =  116 bits (291), Expect = 7e-25
 Identities = 67/136 (49%), Positives = 76/136 (55%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVEK P    P+   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 428 VEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 487

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKPPVYKPPVEKP 361
           V + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PPVEK PV   PVE  
Sbjct: 488 VEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAA 547

Query: 362 PVYKPPVEKPPVYKPP 409
           PV + PVE  PV   P
Sbjct: 548 PVEEKPVEAAPVEAAP 563

 Score =  116 bits (291), Expect = 7e-25
 Identities = 65/135 (48%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+ + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 599  VEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAP 658

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 659  VEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAP 718

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 719  VEAAPVEEKPVEAAP 733

 Score =  116 bits (291), Expect = 7e-25
 Identities = 65/135 (48%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE+ P    P+   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 609  VEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKP 668

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 669  VEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKP 728

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 729  VEAAPVEAAPVEEKP 743

 Score =  115 bits (289), Expect = 1e-24
 Identities = 64/135 (47%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PV+  P    P+ + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 629  VEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 688

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 689  VEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 748

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 749  VEAAPVEEKPVEDAP 763

 Score =  115 bits (288), Expect = 2e-24
 Identities = 65/135 (48%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 589 VEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAP 648

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 649 VKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAP 708

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 709 VKEKPVEAAPVEAAP 723

 Score =  115 bits (288), Expect = 2e-24
 Identities = 65/135 (48%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 619  VEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAP 678

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 679  VEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAP 738

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV   P
Sbjct: 739  VEEKPVEAAPVEAAP 753

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/135 (47%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE+ P    P+   PVE+ PV   PVE  PV + PVE  PV   PV++ P
Sbjct: 654  VEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKP 713

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ P
Sbjct: 714  VEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKP 773

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV K P
Sbjct: 774  VEAAPVEAAPVEKKP 788

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/135 (47%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+ + PVE  PV   PV++ PV   PVE  PV + PVE  P
Sbjct: 674  VEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAP 733

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  PV K PVE  P
Sbjct: 734  VEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAP 793

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 794  VEAAPVEEKPVEAAP 808

 Score =  115 bits (287), Expect = 2e-24
 Identities = 64/135 (47%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PV++ P    P+   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 569 VEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 628

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 629 VEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 688

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 689 VEAAPVEEKPVEDAP 703

 Score =  114 bits (286), Expect = 3e-24
 Identities = 64/135 (47%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V++ PV   PVE  P    P+   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 579 VKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 638

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 639 VDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 698

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 699 VEDAPVEAAPVKEKP 713

 Score =  114 bits (285), Expect = 3e-24
 Identities = 64/132 (48%), Positives = 73/132 (55%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PPV K PVE  P    P+ + PVE  PV   PVE+  V   PVE  PV + PVE  PV  
Sbjct: 532 PPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEA 591

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
            PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV +
Sbjct: 592 APVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKE 651

Query: 374 PPVEKPPVYKPP 409
            PVE  PV   P
Sbjct: 652 KPVEAAPVEAAP 663

 Score =  114 bits (285), Expect = 3e-24
 Identities = 63/135 (46%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+ + PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 574 VEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 633

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PV+  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 634 VEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 693

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 694 VEEKPVEDAPVEAAP 708

 Score =  114 bits (285), Expect = 3e-24
 Identities = 63/135 (46%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V+  PV   PV++ P    P+   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 639  VDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 698

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 699  VEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 758

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 759  VEDAPVEAAPVKEKP 773

 Score =  114 bits (285), Expect = 3e-24
 Identities = 64/135 (47%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V++ PV   PVE  P    P+   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 649  VKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAP 708

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 709  VKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAP 768

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV   P
Sbjct: 769  VKEKPVEAAPVEAAP 783

 Score =  114 bits (285), Expect = 3e-24
 Identities = 64/135 (47%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+   PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 664  VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAP 723

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 724  VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAP 783

Query: 365  VYKPPVEKPPVYKPP 409
            V K PVE  PV   P
Sbjct: 784  VEKKPVEAAPVEAAP 798

 Score =  114 bits (284), Expect = 4e-24
 Identities = 64/135 (47%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+ + PVE  PV   PVE+ PV   PVE+ PV   PVE+ P
Sbjct: 228 VEAAPVEEEPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKP 287

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PVE   V   PVE+ PV   PVE  PV + PVE  PV   PVE  P
Sbjct: 288 VEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAP 347

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV + P
Sbjct: 348 VEEEPVEAAPVEEEP 362

 Score =  114 bits (284), Expect = 4e-24
 Identities = 68/136 (50%), Positives = 75/136 (55%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVE-KPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           VE  PV   PVE KP E  P    PPVEK PV   PVE  PV + PVE  PV   PVE+ 
Sbjct: 508 VEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEK 567

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
            V   PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  
Sbjct: 568 LVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAA 627

Query: 362 PVYKPPVEKPPVYKPP 409
           PV   PVE+ PV   P
Sbjct: 628 PVEAAPVEEKPVDDAP 643

 Score =  114 bits (284), Expect = 4e-24
 Identities = 68/141 (48%), Positives = 78/141 (55%), Gaps = 6/141 (4%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPP-EYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----P 166
           VE  PV + PVE  P E  PP+ K PVE  PV   PVE+ PV   PVE  PV +      
Sbjct: 513 VEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDA 572

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
           PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 573 PVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAA 632

Query: 347 PVEKPPVYKPPVEKPPVYKPP 409
           PVE+ PV   PVE  PV + P
Sbjct: 633 PVEEKPVDDAPVEAAPVKEKP 653

 Score =  114 bits (284), Expect = 4e-24
 Identities = 64/135 (47%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 634  VEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 693

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 694  VEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 753

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV   P
Sbjct: 754  VEEKPVEDAPVEAAP 768

 Score =  114 bits (284), Expect = 4e-24
 Identities = 63/135 (46%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+ + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 644  VEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAP 703

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 704  VEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAP 763

Query: 365  VYKPPVEKPPVYKPP 409
            V   PV++ PV   P
Sbjct: 764  VEAAPVKEKPVEAAP 778

 Score =  113 bits (283), Expect = 6e-24
 Identities = 65/135 (48%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV    VE  P    P+   PVE  PV + PVE  PV   PVE  PV + PVE  P
Sbjct: 298 VEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAP 357

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 358 VEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAP 417

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVEK PV   P
Sbjct: 418 VEAAPVEKKPVEAAP 432

 Score =  113 bits (282), Expect = 8e-24
 Identities = 64/135 (47%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+ + PVE   V   PVE+ PV   PVE  PV + PVE  P
Sbjct: 278 VEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAP 337

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PVE  PV + PVE  PV   PVE  PV   PVE+ PV   PVE  P
Sbjct: 338 VEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAP 397

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV + P
Sbjct: 398 VKEKPVEAAPVEEKP 412

 Score =  113 bits (282), Expect = 8e-24
 Identities = 66/136 (48%), Positives = 75/136 (55%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P    P+ + PVE  PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 443 VEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 502

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           V + PVE  PV   PVE+ PV   PVE  PPV K PVE  PV   PVE+ PV   PVE  
Sbjct: 503 VKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAA 562

Query: 362 PVYKPPVEKPPVYKPP 409
           PV +  VE  PV   P
Sbjct: 563 PVEEKLVEDAPVEAAP 578

 Score =  113 bits (282), Expect = 8e-24
 Identities = 63/135 (46%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE+ P    P+   PV++ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 624  VEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 683

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 684  VEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 743

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 744  VEAAPVEAAPVEEKP 758

 Score =  112 bits (281), Expect = 1e-23
 Identities = 66/136 (48%), Positives = 75/136 (55%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYK-PPVEKPPVYKPPVEKP 181
           VE+ PV   PVE  P    P+   PVE  PV + PVE  PV   PPVEK PV   PVE  
Sbjct: 488 VEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAA 547

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV + PVE  PV   PVE+  V   PVE  PV + PVE  PV   PVE+ PV   PVE+ 
Sbjct: 548 PVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEK 607

Query: 362 PVYKPPVEKPPVYKPP 409
           PV   PVE  PV + P
Sbjct: 608 PVEAAPVEAAPVEEKP 623

 Score =  112 bits (281), Expect = 1e-23
 Identities = 64/135 (47%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P    P+   PVE+  V   PVE  PV + PVE  PV   PVE+ P
Sbjct: 539 VEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKP 598

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 599 VEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAP 658

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 659 VEAAPVEEKPVEAAP 673

 Score =  112 bits (281), Expect = 1e-23
 Identities = 64/135 (47%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV +  VE  P    P+ + PVE  PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 559 VEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 618

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 619 VEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAP 678

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 679 VEEKPVEAAPVEAAP 693

 Score =  112 bits (281), Expect = 1e-23
 Identities = 62/135 (45%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P    P+ + PVE  PV   PVE+ PV   PVE  PV + PV+  P
Sbjct: 584 VEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAP 643

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 644 VEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAP 703

Query: 365 VYKPPVEKPPVYKPP 409
           V   PV++ PV   P
Sbjct: 704 VEAAPVKEKPVEAAP 718

 Score =  112 bits (281), Expect = 1e-23
 Identities = 62/135 (45%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+ + PV+  PV   PV++ PV   PVE  PV + PVE  P
Sbjct: 614  VEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAP 673

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  PV + PVE  P
Sbjct: 674  VEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAP 733

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 734  VEAAPVEEKPVEAAP 748

 Score =  112 bits (281), Expect = 1e-23
 Identities = 62/128 (48%), Positives = 72/128 (56%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 694  VEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 753

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PV++ PV   PVE  PV K PVE  PV   PVE+ PV   PVE PP
Sbjct: 754  VEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKPVEAAPVEAPP 813

Query: 365  VYKPPVEK 388
            V + P E+
Sbjct: 814  VERKPDER 821

 Score =  112 bits (280), Expect = 1e-23
 Identities = 64/135 (47%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P     +   PVE+ PV   PVE  PV + PVE  PV   PVE  P
Sbjct: 288 VEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAP 347

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV + PVE  PV   PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 348 VEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAP 407

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 408 VEEKPVEAAPVEAAP 422

 Score =  112 bits (280), Expect = 1e-23
 Identities = 65/136 (47%), Positives = 76/136 (55%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE+ P    P+   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 453 VEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 512

Query: 185 VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           V   PVE+ PV   PVE  PPV K PVE  PV   PVE+ PV   PVE  PV +  VE  
Sbjct: 513 VEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDA 572

Query: 362 PVYKPPVEKPPVYKPP 409
           PV   PV++ PV   P
Sbjct: 573 PVEAAPVKEKPVEAAP 588

 Score =  112 bits (280), Expect = 1e-23
 Identities = 65/136 (47%), Positives = 76/136 (55%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKP 181
           VE+ PV   PVE+ P    P+   PV++ PV   PVE  PV + PVE  PV   PPVEK 
Sbjct: 478 VEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKK 537

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV   PVE  PV + PVE  PV   PVE+  V   PVE  PV + PVE  PV   PVE+ 
Sbjct: 538 PVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEK 597

Query: 362 PVYKPPVEKPPVYKPP 409
           PV   PVE+ PV   P
Sbjct: 598 PVEAAPVEEKPVEAAP 613

 Score =  112 bits (280), Expect = 1e-23
 Identities = 64/135 (47%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE  P     +   PVE  PV + PVE  PV   PVE+ PV   PVE+ P
Sbjct: 549 VEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKP 608

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 609 VEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKP 668

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 669 VEAAPVEAAPVEEKP 683

 Score =  112 bits (279), Expect = 2e-23
 Identities = 64/135 (47%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+   PVE+ PV   PVE  PV + PVE   V   PVE+ P
Sbjct: 258 VEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKP 317

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PVE  PV   PVE  PV + PVE  PV + PVE  PV   PVE  P
Sbjct: 318 VEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAP 377

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 378 VEAAPVEEKPVEDAP 392

 Score =  112 bits (279), Expect = 2e-23
 Identities = 64/135 (47%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+   PVE  PV + PVE   V   PVE+ PV   PVE  P
Sbjct: 268 VEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAP 327

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PVE  PV + PVE  PV + PVE  PV   PVE  PV   PVE+ P
Sbjct: 328 VKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKP 387

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 388 VEDAPVEAAPVKEKP 402

 Score =  111 bits (278), Expect = 2e-23
 Identities = 63/135 (46%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PV++ P    P+   PVE+ PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 238 VEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 297

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE   V   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  P
Sbjct: 298 VEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAP 357

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 358 VEEEPVEAAPVEDKP 372

 Score =  111 bits (278), Expect = 2e-23
 Identities = 63/135 (46%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+ + PVE  PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 243 VEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 302

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V    VE  PV + PVE  PV   PV++ PV   PVE  PV   PVE+ PV   PVE+ P
Sbjct: 303 VEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEP 362

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV   P
Sbjct: 363 VEAAPVEDKPVEAAP 377

 Score =  111 bits (278), Expect = 2e-23
 Identities = 63/135 (46%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P    P+ + PVE  PV + PVE  PV   PVE+ PV    VE  P
Sbjct: 253 VEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAP 312

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PV++ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 313 VEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKP 372

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 373 VEAAPVEAAPVEEKP 387

 Score =  111 bits (278), Expect = 2e-23
 Identities = 63/135 (46%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE+ P    P+ + PVE  PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 263 VEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAP 322

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PV++ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE  PV   PVE  P
Sbjct: 323 VEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAP 382

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 383 VEEKPVEDAPVEAAP 397

 Score =  111 bits (278), Expect = 2e-23
 Identities = 63/135 (46%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE       P+ + PVE  PV   PV++ PV   PVE  PV   PVE+ P
Sbjct: 293 VEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEP 352

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE  PV   PVE  PV + PVE  PV   PV++ PV   PVE+ P
Sbjct: 353 VEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKP 412

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV K P
Sbjct: 413 VEAAPVEAAPVEKKP 427

 Score =  111 bits (278), Expect = 2e-23
 Identities = 65/136 (47%), Positives = 75/136 (55%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P    P+ + PVE  PV   PV++ PV   PVE  PV + PVE  P
Sbjct: 468 VEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAP 527

Query: 185 VYK-PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           V   PPVEK PV   PVE  PV + PVE  PV   PVE+  V   PVE  PV + PVE  
Sbjct: 528 VEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAA 587

Query: 362 PVYKPPVEKPPVYKPP 409
           PV   PVE+ PV   P
Sbjct: 588 PVEAAPVEEKPVEAAP 603

 Score =  111 bits (278), Expect = 2e-23
 Identities = 65/136 (47%), Positives = 75/136 (55%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKP 181
           VE  PV + PVE  P    P+ + PVE  PV   PVE+ PV   PVE  PPV K PVE  
Sbjct: 483 VEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAA 542

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV   PVE+ PV   PVE  PV +  VE  PV   PV++ PV   PVE  PV + PVE  
Sbjct: 543 PVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAA 602

Query: 362 PVYKPPVEKPPVYKPP 409
           PV + PVE  PV   P
Sbjct: 603 PVEEKPVEAAPVEAAP 618

 Score =  111 bits (278), Expect = 2e-23
 Identities = 62/135 (45%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+   PVE  PV + PV+  PV   PV++ PV   PVE  P
Sbjct: 604  VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAP 663

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 664  VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAP 723

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV   P
Sbjct: 724  VEEKPVEAAPVEAAP 738

 Score =  111 bits (277), Expect = 3e-23
 Identities = 63/135 (46%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE  P    P+   PVE  PV + PVE  PV + PVE  PV + PVE  P
Sbjct: 233 VEEEPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAP 292

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV    VE  PV + PVE  PV   PV++ PV   PVE  PV   PVE+ P
Sbjct: 293 VEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEP 352

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 353 VEAAPVEEEPVEAAP 367

 Score =  111 bits (277), Expect = 3e-23
 Identities = 65/136 (47%), Positives = 75/136 (55%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE  P    P+   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 463 VEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 522

Query: 185 VYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           V   PVE  PPV K PVE  PV   PVE+ PV   PVE  PV +  VE  PV   PV++ 
Sbjct: 523 VEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEK 582

Query: 362 PVYKPPVEKPPVYKPP 409
           PV   PVE  PV + P
Sbjct: 583 PVEAAPVEAAPVEEKP 598

 Score =  111 bits (277), Expect = 3e-23
 Identities = 65/136 (47%), Positives = 75/136 (55%), Gaps = 1/136 (0%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-P 181
           VE  PV + PVE  P    P+   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 473 VEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAP 532

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV K PVE  PV   PVE+ PV   PVE  PV +  VE  PV   PV++ PV   PVE  
Sbjct: 533 PVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAA 592

Query: 362 PVYKPPVEKPPVYKPP 409
           PV + PVE  PV + P
Sbjct: 593 PVEEKPVEAAPVEEKP 608

 Score =  110 bits (275), Expect = 5e-23
 Identities = 63/135 (46%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V++ PV   PVE  P    P+   PVE+ PV   PVE+ PV   PVE  PV + PVE   
Sbjct: 248 VKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAL 307

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 308 VEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAP 367

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV   P
Sbjct: 368 VEDKPVEAAPVEAAP 382

 Score =  110 bits (275), Expect = 5e-23
 Identities = 63/135 (46%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE   V   PVE+ P    P+   PV++ PV   PVE  PV   PVE+ PV   PVE+ P
Sbjct: 303 VEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEP 362

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV   PVE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  P
Sbjct: 363 VEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAP 422

Query: 365 VYKPPVEKPPVYKPP 409
           V K PVE  PV   P
Sbjct: 423 VEKKPVEAAPVEAAP 437

 Score =  110 bits (275), Expect = 5e-23
 Identities = 65/141 (46%), Positives = 76/141 (53%), Gaps = 6/141 (4%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEK------PPVYKPPVEKPPVYKPPVEKPPVYKP 166
           VE  PV + PVE  P    P+ + PVE       PPV K PVE  PV   PVE+ PV   
Sbjct: 498 VEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAA 557

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
           PVE  PV +  VE  PV   PV++ PV   PVE  PV + PVE  PV + PVE  PV   
Sbjct: 558 PVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAA 617

Query: 347 PVEKPPVYKPPVEKPPVYKPP 409
           PVE+ PV   PVE  PV + P
Sbjct: 618 PVEEKPVEAAPVEAAPVEEKP 638

 Score =  110 bits (274), Expect = 6e-23
 Identities = 62/135 (45%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+  V   PVE  P    P+   PVE  PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 564 VEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 623

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 624 VEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 683

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 684 VEAAPVEAAPVEEKP 698

 Score =  109 bits (273), Expect = 8e-23
 Identities = 64/156 (41%), Positives = 80/156 (51%), Gaps = 21/156 (13%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEY---------------------TPPIYKPPVEKPPVYKPPVEKP 121
            VE  PV  PPVE+ P+                        P+ + PVE  PV + PVE  
Sbjct: 804  VEAAPVEAPPVERKPDERKEADSEIKKIISVTEEKPVEAAPVEEKPVEAAPVEEKPVEAA 863

Query: 122  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 301
            PV + PVE  PV + PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PV+  
Sbjct: 864  PVEEKPVEDAPVEEKPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVDAA 923

Query: 302  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PV + PV+  PV   PVE  PV + PVE  PV + P
Sbjct: 924  PVEEKPVDADPVEGKPVEAAPVEEKPVEAAPVERKP 959

 Score =  109 bits (272), Expect = 1e-22
 Identities = 58/127 (45%), Positives = 74/127 (58%)
 Frame = +2

Query: 8    EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
            E+ PV   PVE+ P    P+ + PVE  PV + PVE  PV + PVE+ PV   PVE+ PV
Sbjct: 836  EEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEDAPVEEKPVEEKPVEAAPVEEKPV 895

Query: 188  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
               PVE+ PV   PVE  PV + PV+  PV + PV+  PV   PVE  PV + PVE  PV
Sbjct: 896  EAAPVEEKPVEAAPVEAAPVEEKPVDAAPVEEKPVDADPVEGKPVEAAPVEEKPVEAAPV 955

Query: 368  YKPPVEK 388
             + P E+
Sbjct: 956  ERKPEER 962

 Score =  108 bits (271), Expect = 1e-22
 Identities = 63/136 (46%), Positives = 75/136 (55%), Gaps = 2/136 (1%)
 Frame = +2

Query: 8   EKP--PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           EKP  PV   PVE+ P    P+   PV++ PV   PVE  PV + PVE  PV + PVE  
Sbjct: 222 EKPAAPVEAAPVEEEPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAA 281

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV + PVE  PV   PVE+ PV    VE  PV + PVE  PV   PV++ PV   PVE  
Sbjct: 282 PVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDK 341

Query: 362 PVYKPPVEKPPVYKPP 409
           PV   PVE+ PV   P
Sbjct: 342 PVEAAPVEEEPVEAAP 357

 Score =  108 bits (271), Expect = 1e-22
 Identities = 62/135 (45%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE  P    P+    VE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 283 VEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKP 342

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE+ PV   PVE  PV   PVE  PV + PVE  PV   PV++ P
Sbjct: 343 VEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKP 402

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 403 VEAAPVEEKPVEAAP 417

 Score =  108 bits (271), Expect = 1e-22
 Identities = 61/135 (45%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE+ P     +   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 1820 VEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAP 1879

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 1880 VEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 1939

Query: 365  VYKPPVEKPPVYKPP 409
            V   PV++ PV   P
Sbjct: 1940 VEAAPVKEKPVEAAP 1954

 Score =  108 bits (270), Expect = 2e-22
 Identities = 61/135 (45%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+      P+   PV++ PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 554 VEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAP 613

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE  P
Sbjct: 614 VEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAP 673

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 674 VEAAPVEEKPVEAAP 688

 Score =  108 bits (270), Expect = 2e-22
 Identities = 61/136 (44%), Positives = 75/136 (55%)
 Frame = +2

Query: 2    RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
            +VE  PV + PVE  P    P+   PVE  PV + PVE  PV   PVE+ PV   PVE  
Sbjct: 1839 QVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAA 1898

Query: 182  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
            PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  
Sbjct: 1899 PVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAA 1958

Query: 362  PVYKPPVEKPPVYKPP 409
            PV + PVE   V + P
Sbjct: 1959 PVEEKPVEVASVEEKP 1974

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/135 (45%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV    VE  P    P+   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 1830 VEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKP 1889

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PV++ P
Sbjct: 1890 VDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKP 1949

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 1950 VEAAPVEAAPVEEKP 1964

 Score =  108 bits (269), Expect = 2e-22
 Identities = 60/131 (45%), Positives = 74/131 (56%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE+ P    P+   PV++ PV   PVE  PV + PV+  PV   PV++ P
Sbjct: 1845 VEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKP 1904

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 1905 VEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKP 1964

Query: 365  VYKPPVEKPPV 397
            V    VE+ PV
Sbjct: 1965 VEVASVEEKPV 1975

 Score =  107 bits (268), Expect = 3e-22
 Identities = 61/134 (45%), Positives = 73/134 (54%)
 Frame = +2

Query: 8    EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
            E+ PV   PVE+ P    P+   PVE+ PV    VE  PV + PVE  PV + PV+   V
Sbjct: 1781 EEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQV 1840

Query: 188  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
               PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV
Sbjct: 1841 EAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPV 1900

Query: 368  YKPPVEKPPVYKPP 409
             + PVE  PV   P
Sbjct: 1901 KEKPVEAAPVEAAP 1914

 Score =  107 bits (268), Expect = 3e-22
 Identities = 61/135 (45%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE       P+ + PVE  PV + PV+   V   PVE+ PV   PVE+ P
Sbjct: 1800 VEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKP 1859

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ P
Sbjct: 1860 VDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKP 1919

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 1920 VEAAPVEAAPVEEKP 1934

 Score =  107 bits (268), Expect = 3e-22
 Identities = 61/135 (45%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+ + PV+  PV   PV++ PV   PVE  PV + PVE  P
Sbjct: 1865 VEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAP 1924

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV    VE+ PV    VE  P
Sbjct: 1925 VEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAP 1984

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV + P
Sbjct: 1985 VEEKPVEAAPVEEKP 1999

 Score =  107 bits (268), Expect = 3e-22
 Identities = 62/135 (45%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE+ P    P+   PV++ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 1875 VEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 1934

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PVE+ PV    VE+ PV    VE  PV + PVE  P
Sbjct: 1935 VDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAP 1994

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV   P
Sbjct: 1995 VEEKPVEAAPVEAAP 2009

 Score =  107 bits (267), Expect = 4e-22
 Identities = 60/136 (44%), Positives = 75/136 (55%)
 Frame = +2

Query: 2    RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
            +VE  PV + PVE  P    P+    VE  PV + PVE  PV + PV+  PV   PV++ 
Sbjct: 1814 QVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEK 1873

Query: 182  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
            PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ 
Sbjct: 1874 PVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEK 1933

Query: 362  PVYKPPVEKPPVYKPP 409
            PV   PVE  PV + P
Sbjct: 1934 PVDAAPVEAAPVKEKP 1949

 Score =  107 bits (267), Expect = 4e-22
 Identities = 62/135 (45%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 1885 VEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 1944

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE+ PV    VE+ PV    VE  PV + PVE  PV + PVE  P
Sbjct: 1945 VKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAP 2004

Query: 365  VYKPPVEKPPVYKPP 409
            V   PV++ PV   P
Sbjct: 2005 VEAAPVKEKPVEAAP 2019

 Score =  106 bits (265), Expect = 7e-22
 Identities = 61/135 (45%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+    VE  PV + PVE  PV + PV+   V   PVE+ P
Sbjct: 1790 VEEKPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKP 1849

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 1850 VEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAP 1909

Query: 365  VYKPPVEKPPVYKPP 409
            V   PV++ PV   P
Sbjct: 1910 VEAAPVKEKPVEAAP 1924

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/135 (43%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PV+       P+ + PVE  PV + PV+  PV   PV++ PV   PVE  P
Sbjct: 1825 VEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAP 1884

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PV+  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 1885 VEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 1944

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV   P
Sbjct: 1945 VKEKPVEAAPVEAAP 1959

 Score =  106 bits (264), Expect = 9e-22
 Identities = 68/156 (43%), Positives = 78/156 (50%), Gaps = 21/156 (13%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPP-EYTP----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 169
            VE  PV + PVE  P E  P    P+   PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 704  VEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAP 763

Query: 170  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP----- 334
            VE  PV + PVE  PV   PVEK PV   PVE  PV + PVE  PV  PPVE+ P     
Sbjct: 764  VEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKPVEAAPVEAPPVERKPDERKE 823

Query: 335  -----------VYKPPVEKPPVYKPPVEKPPVYKPP 409
                         + PVE  PV + PVE  PV + P
Sbjct: 824  ADSEIKKIISVTEEKPVEAAPVEEKPVEAAPVEEKP 859

 Score =  106 bits (264), Expect = 9e-22
 Identities = 60/135 (44%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE   V   PVE+ P    P+ + PV+   V   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 1810 VEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAP 1869

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 1870 VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAP 1929

Query: 365  VYKPPVEKPPVYKPP 409
            V + PV+  PV   P
Sbjct: 1930 VEEKPVDAAPVEAAP 1944

 Score =  106 bits (264), Expect = 9e-22
 Identities = 61/135 (45%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+   PVE  PV + PV+  PV   PV++ PV   PVE  P
Sbjct: 1855 VEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAP 1914

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV    VE+ P
Sbjct: 1915 VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKP 1974

Query: 365  VYKPPVEKPPVYKPP 409
            V    VE  PV + P
Sbjct: 1975 VDAAQVEAAPVEEKP 1989

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/131 (44%), Positives = 73/131 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V+   V   PVE+ P    P+ + PV+  PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 1835 VDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 1894

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 1895 VEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAP 1954

Query: 365  VYKPPVEKPPV 397
            V   PVE+ PV
Sbjct: 1955 VEAAPVEEKPV 1965

 Score =  105 bits (262), Expect = 2e-21
 Identities = 60/134 (44%), Positives = 74/134 (55%)
 Frame = +2

Query: 8    EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
            E+ PV   PVE+ P    P+ + PVE  PV +  VE  PV    VE+ PV   PVE+ PV
Sbjct: 1321 EEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPV 1380

Query: 188  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
               PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  PV + PVE  PV
Sbjct: 1381 EAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPV 1440

Query: 368  YKPPVEKPPVYKPP 409
             +  V+  PV + P
Sbjct: 1441 EEKQVDAAPVEEKP 1454

 Score =  105 bits (262), Expect = 2e-21
 Identities = 60/135 (44%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE+      P+    VE+ PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 1340 VEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAP 1399

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE  PV + PVE  PV + PVE  PV +  V+  PV + P E  P
Sbjct: 1400 VEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAP 1459

Query: 365  VYKPPVEKPPVYKPP 409
            V + PV+  PV  PP
Sbjct: 1460 VEEKPVDAAPVETPP 1474

 Score =  105 bits (262), Expect = 2e-21
 Identities = 60/130 (46%), Positives = 71/130 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+ + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 1895 VEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAP 1954

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV    VE+ PV    VE  PV + PVE  PV + PVE  PV   PV++ P
Sbjct: 1955 VEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKP 2014

Query: 365  VYKPPVEKPP 394
            V   PVE  P
Sbjct: 2015 VEAAPVEAAP 2024

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/135 (42%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PV+  P    P+ + PVE  PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 1880 VEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 1939

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PV++ PV   PVE  PV + PVE   V + PV+   V   PVE+ PV   PVE+ P
Sbjct: 1940 VEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAPVEEKP 1999

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 2000 VEAAPVEAAPVKEKP 2014

 Score =  104 bits (259), Expect = 4e-21
 Identities = 60/135 (44%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE+ P    P+ +  VE  PV    VE+ PV   PVE+ PV   PVE+ P
Sbjct: 1330 VEEEPVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKP 1389

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PVE  PV + PVE  PV + PVE  PV +  V+  P
Sbjct: 1390 VEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAP 1449

Query: 365  VYKPPVEKPPVYKPP 409
            V + P E  PV + P
Sbjct: 1450 VEEKPGEAAPVEEKP 1464

 Score =  104 bits (259), Expect = 4e-21
 Identities = 60/135 (44%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV +  VE  P     + + PV+  PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 1345 VEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKP 1404

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV   PVE+ PV   PVE+ PV   PVE+  V   PVE+ P    PVE+ P
Sbjct: 1405 VEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKP 1464

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE PP  + P
Sbjct: 1465 VDAAPVETPPSERKP 1479

 Score =  103 bits (258), Expect = 5e-21
 Identities = 59/135 (43%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV    VE  P    P+   PVE+ PV    VE  PV + PVE  PV + PV+  P
Sbjct: 1805 VEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAP 1864

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PV++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE  P
Sbjct: 1865 VEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAP 1924

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 1925 VEAAPVEEKPVDAAP 1939

 Score =  103 bits (257), Expect = 6e-21
 Identities = 58/135 (42%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PV+  P    P+ + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 1850 VEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAP 1909

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PV++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE   
Sbjct: 1910 VEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVAS 1969

Query: 365  VYKPPVEKPPVYKPP 409
            V + PV+   V   P
Sbjct: 1970 VEEKPVDAAQVEAAP 1984

 Score =  102 bits (255), Expect = 1e-20
 Identities = 57/131 (43%), Positives = 73/131 (55%), Gaps = 2/131 (1%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE+ P    P+ + PVE  PV + PVE+ PV   PVE+ PV   PVE+ P
Sbjct: 845  VEEKPVEAAPVEEKPVEAAPVEEKPVEDAPVEEKPVEEKPVEAAPVEEKPVEAAPVEEKP 904

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-- 358
            V   PVE  PV + PV+  PV + PV+  PV   PVE  PV + PVE  PV + P E+  
Sbjct: 905  VEAAPVEAAPVEEKPVDAAPVEEKPVDADPVEGKPVEAAPVEEKPVEAAPVERKPEERKE 964

Query: 359  PPVYKPPVEKP 391
                   +EKP
Sbjct: 965  ADTVNKKIEKP 975

 Score =  102 bits (255), Expect = 1e-20
 Identities = 58/135 (42%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V++ PV   PVE  P    P+   PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 1870 VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAP 1929

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PV+  PV   PV++ PV   PVE  PV + PVE   V + PV+   V   PVE+ P
Sbjct: 1930 VEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKP 1989

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 1990 VEAAPVEEKPVEAAP 2004

 Score =  102 bits (254), Expect = 1e-20
 Identities = 59/130 (45%), Positives = 71/130 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+   PVE+  V   PVE   V + PV+  PV + PVE  P
Sbjct: 1325 VEAAPVEEEPVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAP 1384

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE+  
Sbjct: 1385 VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQ 1444

Query: 365  VYKPPVEKPP 394
            V   PVE+ P
Sbjct: 1445 VDAAPVEEKP 1454

 Score =  102 bits (254), Expect = 1e-20
 Identities = 57/135 (42%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V+  PV   PV++ P    P+   PV++ PV   PVE  PV + PV+  PV   PV++ P
Sbjct: 1890 VDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKP 1949

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE   V + PV+   V   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 1950 VEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 2009

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV   P
Sbjct: 2010 VKEKPVEAAPVEAAP 2024

 Score =  102 bits (253), Expect = 2e-20
 Identities = 60/135 (44%), Positives = 72/135 (53%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P     +   PVE   V + PV+  PV + PVE  PV + PVE  P
Sbjct: 1335 VEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAP 1394

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE+  V   PVE+ P
Sbjct: 1395 VEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKP 1454

Query: 365  VYKPPVEKPPVYKPP 409
                PVE+ PV   P
Sbjct: 1455 GEAAPVEEKPVDAAP 1469

 Score =  102 bits (253), Expect = 2e-20
 Identities = 57/135 (42%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V+  PV   PV++ P    P+   PVE+ PV   PVE  PV + PVE  PV   PV++ P
Sbjct: 1860 VDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKP 1919

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE   V + PV+   
Sbjct: 1920 VEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQ 1979

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 1980 VEAAPVEEKPVEAAP 1994

 Score =  101 bits (251), Expect = 3e-20
 Identities = 59/141 (41%), Positives = 70/141 (49%), Gaps = 10/141 (7%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           PV   P E+ P   PP+ + PVE  PV   PVE+ PV   P+EK P    PVE  PV  P
Sbjct: 9   PVEAAPAEEKPVEVPPVEEKPVEAAPVEVAPVEQKPVETAPLEKKPAEAAPVEAAPVEAP 68

Query: 197 PVEK----------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
           PVE+           PV + PVE   V   PV++ PV   P E  PV + P E  PV + 
Sbjct: 69  PVEEKQDEATLAEAAPVEEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEKPFEATPVEQK 128

Query: 347 PVEKPPVYKPPVEKPPVYKPP 409
           PVE  P    PVEK PV   P
Sbjct: 129 PVEDSPAEVAPVEKKPVEAAP 149

 Score =  101 bits (251), Expect = 3e-20
 Identities = 60/140 (42%), Positives = 69/140 (49%), Gaps = 10/140 (7%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  P  + PVE PP    P+   PVE  PV + PVE  P+ K P E  PV   PVE PP
Sbjct: 10  VEAAPAEEKPVEVPPVEEKPVEAAPVEVAPVEQKPVETAPLEKKPAEAAPVEAAPVEAPP 69

Query: 185 VYK----------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
           V +           PVE+ PV    VE  PV + PVE  P    PVE+ P    PVE+ P
Sbjct: 70  VEEKQDEATLAEAAPVEEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEKPFEATPVEQKP 129

Query: 335 VYKPPVEKPPVYKPPVEKPP 394
           V   P E  PV K PVE  P
Sbjct: 130 VEDSPAEVAPVEKKPVEAAP 149

 Score =  101 bits (251), Expect = 3e-20
 Identities = 58/128 (45%), Positives = 70/128 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV    VE+ P    P+ + PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 1355 VEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 1414

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE+ PV   PVE+  V   PVE+ P    PVE+ PV   PVE PP
Sbjct: 1415 VEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPP 1474

Query: 365  VYKPPVEK 388
              + P E+
Sbjct: 1475 SERKPEER 1482

 Score =  100 bits (248), Expect = 7e-20
 Identities = 59/135 (43%), Positives = 72/135 (53%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            + + P      EKP E   P+ + PVE  PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 1771 ISRIPQISVTEEKPVE-AAPVEEKPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAP 1829

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PV+   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 1830 VEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKP 1889

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 1890 VDAAPVEAAPVKEKP 1904

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 55/133 (41%), Positives = 66/133 (49%), Gaps = 10/133 (7%)
 Frame = +2

Query: 41  KPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 220
           K  +   P+   P E+ PV  PPVE+ PV   PVE  PV + PVE  P+ K P E  PV 
Sbjct: 2   KTEQKAAPVEAAPAEEKPVEVPPVEEKPVEAAPVEVAPVEQKPVETAPLEKKPAEAAPVE 61

Query: 221 KPPVEKPPVYK----------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
             PVE PPV +           PVE+ PV    VE  PV + PVE  P    PVE+ P  
Sbjct: 62  AAPVEAPPVEEKQDEATLAEAAPVEEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEKPFE 121

Query: 371 KPPVEKPPVYKPP 409
             PVE+ PV   P
Sbjct: 122 ATPVEQKPVEDSP 134

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/131 (41%), Positives = 63/131 (48%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE  P    P+   P+EK P    PVE  PV  PPVE+        E  P
Sbjct: 25  VEEKPVEAAPVEVAPVEQKPVETAPLEKKPAEAAPVEAAPVEAPPVEEKQDEATLAEAAP 84

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE   V   PV++ PV   P E  PV + P E  PV + PVE  P    PVEK P
Sbjct: 85  VEEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEKPFEATPVEQKPVEDSPAEVAPVEKKP 144

Query: 365 VYKPPVEKPPV 397
           V   P E   V
Sbjct: 145 VEAAPAEAATV 155

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/128 (42%), Positives = 63/128 (49%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P  T P+ K P E  PV   PVE PPV +   E       PVE+ P
Sbjct: 30  VEAAPVEVAPVEQKPVETAPLEKKPAEAAPVEAAPVEAPPVEEKQDEATLAEAAPVEEKP 89

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V    VE  PV + PVE  P    PVE+ P    PVE+ PV   P E  PV K PVE  P
Sbjct: 90  VEAASVEAAPVKEKPVEDTPAEVAPVEEKPFEATPVEQKPVEDSPAEVAPVEKKPVEAAP 149

Query: 365 VYKPPVEK 388
                V++
Sbjct: 150 AEAATVKE 157

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 62/185 (33%), Positives = 77/185 (41%), Gaps = 50/185 (27%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE+ P    P+ + PVE  PV + PVE  PV   PVE+ PV   PVE+ P
Sbjct: 870  VEDAPVEEKPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVDAAPVEEKP 929

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-------VYKPPVEKPPVY----------- 310
            V   PVE  PV   PVE+ PV   PVE+ P            +EKP +            
Sbjct: 930  VDADPVEGKPVEAAPVEEKPVEAAPVERKPEERKEADTVNKKIEKPVLTDVEVELVFSKA 989

Query: 311  --------------------------------KPPVEKPPVYKPPVEKPPVYKPPVEKPP 394
                                            + PVE  PV + PVE  PV + PVE  P
Sbjct: 990  ETFCGLELDLLMESSEFVEGNISRIPQISVTEEKPVEAAPVEEKPVEAAPVEEKPVEAAP 1049

Query: 395  VYKPP 409
            V + P
Sbjct: 1050 VERKP 1054

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 56/130 (43%), Positives = 68/130 (52%), Gaps = 3/130 (2%)
 Frame = +2

Query: 5    VEKPPVYKPPVE-KPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
            VE+ PV   PVE KP E   P+   PVE+ PV   PVE  PV   PVE+ PV   PVE+ 
Sbjct: 1375 VEENPVEAAPVEEKPVE-AAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEK 1433

Query: 182  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVE 355
            PV   PVE+  V   PVE+ P    PVE+ PV   PVE PP  + P E+         +E
Sbjct: 1434 PVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKPEERKEADSEIKKIE 1493

Query: 356  KPPVYKPPVE 385
            KP +    VE
Sbjct: 1494 KPLLTDVEVE 1503

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 51/128 (39%), Positives = 60/128 (46%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P    PVE  PV  PPVE+        E  PV + PVE   
Sbjct: 35  VEVAPVEQKPVETAPLEKKPAEAAPVEAAPVEAPPVEEKQDEATLAEAAPVEEKPVEAAS 94

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PV++ PV   P E  PV + P E  PV + PVE  P    PVEK PV   P E   
Sbjct: 95  VEAAPVKEKPVEDTPAEVAPVEEKPFEATPVEQKPVEDSPAEVAPVEKKPVEAAPAEAAT 154

Query: 365 VYKPPVEK 388
           V +   E+
Sbjct: 155 VKEKSEER 162

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 59/186 (31%), Positives = 73/186 (39%), Gaps = 50/186 (26%)
 Frame = +2

Query: 2    RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPP------------------------ 109
            +V+  PV + P E  P    P+   PVE PP  + P                        
Sbjct: 1234 QVDAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKPEERKEADSEIKKIETPLLTDVEVX 1293

Query: 110  --------------------------VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 211
                                       E+ PV   PVE+ PV   PVE+ PV   PVE+ 
Sbjct: 1294 XXXLDLLMESSEFIEGNISRIPQISVTEEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEK 1353

Query: 212  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 391
             V   PVE   V + PV+  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  
Sbjct: 1354 SVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAA 1413

Query: 392  PVYKPP 409
            PV   P
Sbjct: 1414 PVEAAP 1419

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 59/185 (31%), Positives = 72/185 (38%), Gaps = 50/185 (27%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP----- 169
            VE  PV + PVE  P     +   PVE+ P    PVE+ PV   PVE PP  + P     
Sbjct: 1215 VEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKPEERKE 1274

Query: 170  ---------------------------------------------VEKPPVYKPPVEKPP 214
                                                          E+ PV   PVE+ P
Sbjct: 1275 ADSEIKKIETPLLTDVEVXXXXLDLLMESSEFIEGNISRIPQISVTEEKPVEAAPVEEEP 1334

Query: 215  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 394
            V   PVE+ PV   PVE+  V   PVE   V + PV+  PV + PVE  PV + PVE  P
Sbjct: 1335 VEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAP 1394

Query: 395  VYKPP 409
            V   P
Sbjct: 1395 VEAAP 1399

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 60/190 (31%), Positives = 73/190 (38%), Gaps = 55/190 (28%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK------- 163
            VE  PV + PVE       P+ + PVE  PV + PVE   V   PVE+ P  +       
Sbjct: 1670 VEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEGAQVEAAPVEEKPEERREADSEI 1729

Query: 164  PPVEKP------------------------------------------------PVYKPP 199
              +EKP                                                PV   P
Sbjct: 1730 KKIEKPLLTDVEVELVFSKAETFSGLELDLLMESSEFIEGNISRIPQISVTEEKPVEAAP 1789

Query: 200  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 379
            VE+ PV   PVE  PV + PVE   V   PVE+ PV   PVE+ PV    VE  PV + P
Sbjct: 1790 VEEKPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKP 1849

Query: 380  VEKPPVYKPP 409
            VE  PV + P
Sbjct: 1850 VEAAPVEEKP 1859

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 55/176 (31%), Positives = 68/176 (38%), Gaps = 50/176 (28%)
 Frame = +2

Query: 32   PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP---- 199
            PVE  P    P+   PVE+  V   PVE+ P    PVE+ PV   PVE PP  + P    
Sbjct: 1214 PVEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKPEERK 1273

Query: 200  ----------------------------------------------VEKPPVYKPPVEKP 241
                                                           E+ PV   PVE+ 
Sbjct: 1274 EADSEIKKIETPLLTDVEVXXXXLDLLMESSEFIEGNISRIPQISVTEEKPVEAAPVEEE 1333

Query: 242  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PV   PVE+ PV   PVE+  V   PVE   V + PV+  PV + PVE  PV + P
Sbjct: 1334 PVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKP 1389

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 58/184 (31%), Positives = 72/184 (39%), Gaps = 50/184 (27%)
 Frame = +2

Query: 8    EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP------ 169
            E+ PV   PVE+ P     +   PVE+ PV   PVE+ PV    VE  PV + P      
Sbjct: 1666 EEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEGAQVEAAPVEEKPEERREA 1725

Query: 170  ------VEKPPVYKPPV--------------------------------------EKPPV 217
                  +EKP +    V                                      E+ PV
Sbjct: 1726 DSEIKKIEKPLLTDVEVELVFSKAETFSGLELDLLMESSEFIEGNISRIPQISVTEEKPV 1785

Query: 218  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 397
               PVE+ PV   PVE  PV + PVE   V   PVE+ PV   PVE+ PV    VE  PV
Sbjct: 1786 EAAPVEEKPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPV 1845

Query: 398  YKPP 409
             + P
Sbjct: 1846 EEKP 1849

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 50/157 (31%), Positives = 68/157 (43%), Gaps = 30/157 (19%)
 Frame = +2

Query: 8    EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVE-- 175
            E+ PV   PVE+ P    P+ + PVE  PV + P E+         +EKP +    VE  
Sbjct: 1116 EEKPVEAAPVEEKPVEAAPVEEKPVEAAPVERKPEERKEADTVIKKIEKPLLTDLEVELV 1175

Query: 176  --KPPVYK---------------------PPV---EKPPVYKPPVEKPPVYKPPVEKPPV 277
              K  ++                      P +   E+ PV   PVE+ PV   PVE+  V
Sbjct: 1176 FSKAEIFYGLELDLLMESSEFIEGNISRIPQISLTEEKPVEAAPVEEKPVEAAPVEEKQV 1235

Query: 278  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 388
               PVE+ P    PVE+ PV   PVE PP  + P E+
Sbjct: 1236 DAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKPEER 1272

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 49/151 (32%), Positives = 65/151 (43%), Gaps = 35/151 (23%)
 Frame = +2

Query: 62   PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-------PPVEKPPVYKPPVE----K 208
            P+   PVE+ PV   PVE+ PV   PVE+ P  +         +EKP +    VE    K
Sbjct: 1119 PVEAAPVEEKPVEAAPVEEKPVEAAPVERKPEERKEADTVIKKIEKPLLTDLEVELVFSK 1178

Query: 209  PPVYK---------------------PPV---EKPPVYKPPVEKPPVYKPPVEKPPVYKP 316
              ++                      P +   E+ PV   PVE+ PV   PVE+  V   
Sbjct: 1179 AEIFYGLELDLLMESSEFIEGNISRIPQISLTEEKPVEAAPVEEKPVEAAPVEEKQVDAA 1238

Query: 317  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PVE+ P    PVE+ PV   PVE PP  + P
Sbjct: 1239 PVEEKPGEAAPVEEKPVDAAPVETPPSERKP 1269

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 51/161 (31%), Positives = 62/161 (38%), Gaps = 50/161 (31%)
 Frame = +2

Query: 77   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 256
            PVE  PV + PVE   V + PVE  PV + PVE  PV   PVE+ PV    VE  PV + 
Sbjct: 1544 PVEAAPVERKPVEAALVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVDAAQVEAAPVAEK 1603

Query: 257  P------------VEKPPVYKPPV------------------------------------ 292
            P            +EKP +    V                                    
Sbjct: 1604 PEERREADSEIKKIEKPLLTDVEVELVFSKAETFSGLELDLLMESSEFIEGNFSRIPQIS 1663

Query: 293  --EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
              E+ PV   PVE+ PV    VE  PV + PVE  PV + P
Sbjct: 1664 VTEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKP 1704

[94][TOP]
>UniRef100_A9WG95 Helicase n=2 Tax=Chloroflexus RepID=A9WG95_CHLAA
          Length = 1007

 Score =  120 bits (301), Expect = 5e-26
 Identities = 63/145 (43%), Positives = 91/145 (62%), Gaps = 10/145 (6%)
 Frame = +2

Query: 2    RVEKPPVYKPPVE-KPPEYTPPIYKPPVEKPPV-YKPPVEKPPVYKPPVE--KPPVYKPP 169
            R  +PP  +PP   +PP   PP+ +PPV +PPV  +PPV +PP  +PP    +PPV +PP
Sbjct: 703  REPEPPAREPPARSEPPAREPPVREPPVREPPVRSEPPVREPPAREPPARSAEPPVREPP 762

Query: 170  VEKPPV-YKPPVEKPPVYKPPV-EKPPVYKPPV-EKPPVYKPPVEKPPVYKPPV-EKPPV 337
              +P V  +PPV +PPV +PP   +PP  +P +  +PP  +PPV +PPV +PPV  +P V
Sbjct: 763  AREPSVRSEPPVREPPVREPPARSEPPAREPSIRSEPPAREPPVREPPVREPPVRSEPSV 822

Query: 338  YKPPVEKPPV--YKPPVEKPPVYKP 406
             +PP  +PP    +PPV +PP  +P
Sbjct: 823  REPPAREPPARSAEPPVREPPAREP 847

 Score =  115 bits (288), Expect = 2e-24
 Identities = 61/136 (44%), Positives = 87/136 (63%), Gaps = 8/136 (5%)
 Frame = +2

Query: 26   KPPVEKPPEYTPPIYKPPVE-KPPVYKPPVEKPPVYKPPV-EKPPVYKPPVEKPPV--YK 193
            +PPV +P    PP  +PP   +PP  +PPV +PPV +PPV  +PPV +PP  +PP    +
Sbjct: 699  EPPVREPE---PPAREPPARSEPPAREPPVREPPVREPPVRSEPPVREPPAREPPARSAE 755

Query: 194  PPVEKPPVYKPPV-EKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPP 364
            PPV +PP  +P V  +PPV +PPV +PP   +PP  +P +  +PP  +PPV +PPV +PP
Sbjct: 756  PPVREPPAREPSVRSEPPVREPPVREPPARSEPPAREPSIRSEPPAREPPVREPPVREPP 815

Query: 365  V-YKPPVEKPPVYKPP 409
            V  +P V +PP  +PP
Sbjct: 816  VRSEPSVREPPAREPP 831

 Score =  109 bits (273), Expect = 8e-23
 Identities = 60/137 (43%), Positives = 84/137 (61%), Gaps = 9/137 (6%)
 Frame = +2

Query: 26   KPPVEKPPEYTPPIYKPPVEKP--PVYKPPVE-KPPVYKPPVEKPPVYKPPV-EKPPVYK 193
            + P E  P  TP   +PPV +P  P  +PP   +PP  +PPV +PPV +PPV  +PPV +
Sbjct: 687  RTPGENRPARTP---EPPVREPEPPAREPPARSEPPAREPPVREPPVREPPVRSEPPVRE 743

Query: 194  PPVEKPPV--YKPPVEKPPVYKPPV-EKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEK 358
            PP  +PP    +PPV +PP  +P V  +PPV +PPV +PP   +PP  +P +  +PP  +
Sbjct: 744  PPAREPPARSAEPPVREPPAREPSVRSEPPVREPPVREPPARSEPPAREPSIRSEPPARE 803

Query: 359  PPVYKPPVEKPPVYKPP 409
            PPV +PPV +PPV   P
Sbjct: 804  PPVREPPVREPPVRSEP 820

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 59/174 (33%), Positives = 84/174 (48%), Gaps = 41/174 (23%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYT--PPIYKPPVEKPPVY-KPPVEKPPVYKPPVE------------ 145
            +PPV +PP  +PP  +  PP+ +PP  +P V  +PPV +PPV +PP              
Sbjct: 738  EPPVREPPAREPPARSAEPPVREPPAREPSVRSEPPVREPPVREPPARSEPPAREPSIRS 797

Query: 146  KPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVY--KPPVEKPPVYKPPV-EKPPVYK 313
            +PP  +PPV +PPV +PPV  +P V +PP  +PP    +PPV +PP  +P V  +PP  +
Sbjct: 798  EPPAREPPVREPPVREPPVRSEPSVREPPAREPPARSAEPPVREPPAREPSVRSEPPARE 857

Query: 314  PPV----------------------EKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PPV                       + P    P E P V +PP +  P    P
Sbjct: 858  PPVRSERSADAQRGRYNRPGGRHSGRRVPDQPEPPEAPAVPEPPTDDSPAASVP 911

[95][TOP]
>UniRef100_Q9M4I1 Putative proline-rich cell wall protein n=1 Tax=Vitis vinifera
           RepID=Q9M4I1_VITVI
          Length = 217

 Score =  120 bits (301), Expect = 5e-26
 Identities = 84/145 (57%), Positives = 91/145 (62%), Gaps = 14/145 (9%)
 Frame = +2

Query: 17  PVYK-PPVEKPP-EYTPP--IYKP-PVEKP--PVYK-PPVEK-PPVYKPPVEKPPVYK-P 166
           PVYK PP+ KPP EY PP  +YKP PVEKP  PVY+ PPVEK PP YKPP    PVYK P
Sbjct: 37  PVYKSPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEKPPPEYKPPT---PVYKSP 93

Query: 167 PVEK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPP 334
           PVEK PP YKPP    PVY+ PPVEK PP YKPP   KPP   PP  K P   P V +P 
Sbjct: 94  PVEKPPPEYKPPT---PVYRPPPVEKPPPEYKPPTPVKPP--PPPKHKTPTLPPRVVRP- 147

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKPP 409
              PP  KPP   P + +PP  K P
Sbjct: 148 ---PPTPKPPTLPPIIVRPPPTKEP 169

 Score =  112 bits (281), Expect = 1e-23
 Identities = 81/138 (58%), Positives = 88/138 (63%), Gaps = 15/138 (10%)
 Frame = +2

Query: 41  KPPEYTPPIYKPPVEKPPVYK-PPVEK-PPVYKPPVEKPPVYK-PPVEKP--PVYK-PPV 202
           KPP Y    +KPP+   PVYK PP+ K PP YKPP    PVYK PPVEKP  PVY+ PPV
Sbjct: 26  KPPPYE---HKPPL---PVYKSPPLGKPPPEYKPPT---PVYKPPPVEKPPTPVYRPPPV 76

Query: 203 EK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPV----E 355
           EK PP YKPP    PVYK PPVEK PP YKPP    PVY+ PPVEK PP YKPP      
Sbjct: 77  EKPPPEYKPPT---PVYKSPPVEKPPPEYKPPT---PVYRPPPVEKPPPEYKPPTPVKPP 130

Query: 356 KPPVYKPPVEKPPVYKPP 409
            PP +K P   P V +PP
Sbjct: 131 PPPKHKTPTLPPRVVRPP 148

 Score =  106 bits (265), Expect = 7e-22
 Identities = 76/143 (53%), Positives = 83/143 (58%), Gaps = 13/143 (9%)
 Frame = +2

Query: 5   VEKPP--VYKPP-VEKPP-EYTPP--IYK-PPVEK-PPVYKPPVEKPPVYK-PPVEK-PP 154
           VEKPP  VY+PP VEKPP EY PP  +YK PPVEK PP YKPP    PVY+ PPVEK PP
Sbjct: 63  VEKPPTPVYRPPPVEKPPPEYKPPTPVYKSPPVEKPPPEYKPPT---PVYRPPPVEKPPP 119

Query: 155 VYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
            YKPP   KPP   PP  K P   P V +P    PP  KPP   P + +PP  K P    
Sbjct: 120 EYKPPTPVKPP--PPPKHKTPTLPPRVVRP----PPTPKPPTLPPIIVRPPPTKEPSPPH 173

Query: 332 PVY--KPPVEKPPVYKPPVEKPP 394
             Y   PPVE PP    P +KPP
Sbjct: 174 GHYPGHPPVETPP--STPYKKPP 194

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 69/151 (45%), Positives = 79/151 (52%), Gaps = 19/151 (12%)
 Frame = +2

Query: 5   VEKPP--------VYK-PPVEKPP-EYTPP--IYKP-PVEK-PPVYKPPVE-KPPVYKPP 139
           VEKPP        VYK PPVEKPP EY PP  +Y+P PVEK PP YKPP   KPP   PP
Sbjct: 76  VEKPPPEYKPPTPVYKSPPVEKPPPEYKPPTPVYRPPPVEKPPPEYKPPTPVKPP--PPP 133

Query: 140 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYK 313
             K P   P V +P    PP  KPP   P + +PP  K P      Y   PPVE PP   
Sbjct: 134 KHKTPTLPPRVVRP----PPTPKPPTLPPIIVRPPPTKEPSPPHGHYPGHPPVETPP--S 187

Query: 314 PPVEKPPVYKPPVEKP--PVYKPPVEKPPVY 400
            P +KPP    P +KP  P +K     PP++
Sbjct: 188 TPYKKPPT---PEKKPWAPHHKHFKAPPPIH 215

[96][TOP]
>UniRef100_Q39600 Extensin n=1 Tax=Catharanthus roseus RepID=Q39600_CATRO
          Length = 217

 Score =  120 bits (301), Expect = 5e-26
 Identities = 75/156 (48%), Positives = 85/156 (54%), Gaps = 24/156 (15%)
 Frame = +2

Query: 14  PPVYK-------PPVEKPPEYTPPIYKPPVEKPPVYK-------PPVEKPP--VYKPPVE 145
           PPVYK       PP+ K P   P +YK P   PPVYK       PPV K P  +YK P  
Sbjct: 49  PPVYKYKSPPPPPPIHKSPPPPPYVYKSPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPP 108

Query: 146 KPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPPV 307
            PP+YK P   PPVYK  PP + P VYK P   PPVYK       +KP VYK P   P V
Sbjct: 109 PPPIYKSP--PPPVYKSPPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFV 166

Query: 308 YKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPP 409
           +K P   PPVYK  PP +KP VYK P   PP++K P
Sbjct: 167 HKSP--PPPVYKSPPPPKKPYVYKSPPPPPPIHKSP 200

 Score =  105 bits (262), Expect = 2e-21
 Identities = 66/140 (47%), Positives = 75/140 (53%), Gaps = 8/140 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP Y      PP ++PP   PPV K   YK P   PP++K P   P VYK P   PPVYK
Sbjct: 31  PPPYHYSSPPPPVHSPP--PPPVYK---YKSPPPPPPIHKSPPPPPYVYKSPPPPPPVYK 85

Query: 194 --PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKP 361
              P   PPV+K P   P +YK P   PP+YK P   PPVYK  PP + P VYK P   P
Sbjct: 86  YKSPPPPPPVHKYP---PYIYKSPPPPPPIYKSP--PPPVYKSPPPPKNPYVYKSPPPPP 140

Query: 362 PVYK----PPVEKPPVYKPP 409
           PVYK       +KP VYK P
Sbjct: 141 PVYKYLHHLHQKKPYVYKSP 160

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 65/137 (47%), Positives = 72/137 (52%), Gaps = 20/137 (14%)
 Frame = +2

Query: 14  PPVYKPPVEKPP----EYTPPIYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVE 175
           PPVYK     PP    +Y P IYK P   PP+YK P   PPVYK  PP + P VYK P  
Sbjct: 81  PPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSP--PPPVYKSPPPPKNPYVYKSPPP 138

Query: 176 KPPVYKP----PVEKPPVYKPP-----VEK---PPVYK--PPVEKPPVYKPPVEKPPVYK 313
            PPVYK       +KP VYK P     V K   PPVYK  PP +KP VYK P   PP++K
Sbjct: 139 PPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPIHK 198

Query: 314 PPVEKPPVYKPPVEKPP 364
            P   PP Y      PP
Sbjct: 199 SP---PPPYHYYYSSPP 212

[97][TOP]
>UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis
           thaliana RepID=Q9XIL9_ARATH
          Length = 727

 Score =  120 bits (300), Expect = 6e-26
 Identities = 72/134 (53%), Positives = 80/134 (59%), Gaps = 2/134 (1%)
 Frame = +2

Query: 14  PPVYKPP--VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PPV+ PP  V  PP   PP+Y PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV
Sbjct: 568 PPVHSPPPPVHSPP---PPVYSPP--PPPVHSPP---PPVHSPP---PPVHSPP---PPV 613

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           Y PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPVY PP   PPV
Sbjct: 614 YSPP-PPPPVHSPP---PPVFSPP---PPVHSPP---PPVYSPP---PPVYSPP--PPPV 658

Query: 368 YKPPVEKPPVYKPP 409
             PP   PPVY PP
Sbjct: 659 KSPP--PPPVYSPP 670

 Score =  119 bits (299), Expect = 8e-26
 Identities = 71/134 (52%), Positives = 81/134 (60%), Gaps = 2/134 (1%)
 Frame = +2

Query: 14  PPVYKPP--VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PPV+ PP  V  PP   PP++ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV
Sbjct: 554 PPVHSPPPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP--PPPVHSPP---PPV 599

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           + PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV
Sbjct: 600 HSPP---PPVHSPP---PPVYSPP-PPPPVHSPP---PPVFSPP---PPVHSPP---PPV 643

Query: 368 YKPPVEKPPVYKPP 409
           Y PP   PPVY PP
Sbjct: 644 YSPP---PPVYSPP 654

 Score =  119 bits (298), Expect = 1e-25
 Identities = 71/136 (52%), Positives = 82/136 (60%), Gaps = 4/136 (2%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           PPVY PP   PP Y+    PP+Y PP   PPV+ PP   PPV+ PP   PPV+ PP   P
Sbjct: 513 PPVYSPP-PPPPVYSPPPPPPVYSPP-PPPPVHSPP---PPVHSPP---PPVHSPP---P 561

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   P
Sbjct: 562 PVHSPP---PPVHSPP---PPVHSPP---PPVYSPP--PPPVHSPP---PPVHSPP---P 604

Query: 362 PVYKPPVEKPPVYKPP 409
           PV+ PP   PPVY PP
Sbjct: 605 PVHSPP---PPVYSPP 617

 Score =  118 bits (295), Expect = 2e-25
 Identities = 70/136 (51%), Positives = 81/136 (59%), Gaps = 4/136 (2%)
 Frame = +2

Query: 14  PPVYKPP----VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           PPV+ PP    +  PP   PP+Y PP   PPVY PP   PPVY PP   PPV+ PP   P
Sbjct: 496 PPVHSPPPPSPIHSPPP--PPVYSPP-PPPPVYSPP-PPPPVYSPP-PPPPVHSPP---P 547

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   P
Sbjct: 548 PVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP--PP 590

Query: 362 PVYKPPVEKPPVYKPP 409
           PV+ PP   PPV+ PP
Sbjct: 591 PVHSPP---PPVHSPP 603

 Score =  117 bits (294), Expect = 3e-25
 Identities = 70/134 (52%), Positives = 81/134 (60%), Gaps = 2/134 (1%)
 Frame = +2

Query: 14  PPVYKPP--VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PPV+ PP  V  PP   PP++ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV
Sbjct: 547 PPVHSPPPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP--PPPV 592

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           + PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV
Sbjct: 593 HSPP---PPVHSPP---PPVHSPP---PPVYSPP-PPPPVHSPP---PPVFSPP---PPV 636

Query: 368 YKPPVEKPPVYKPP 409
           + PP   PPVY PP
Sbjct: 637 HSPP---PPVYSPP 647

 Score =  117 bits (292), Expect = 5e-25
 Identities = 70/136 (51%), Positives = 81/136 (59%), Gaps = 4/136 (2%)
 Frame = +2

Query: 14  PPVYKP----PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           PPVY P    PV  PP   PP++ PP   PPV+ PP   PPV+ PP   PPV+ PP   P
Sbjct: 531 PPVYSPPPPPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---P 575

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   P
Sbjct: 576 PVHSPP---PPVYSPP--PPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP-PPP 620

Query: 362 PVYKPPVEKPPVYKPP 409
           PV+ PP   PPV+ PP
Sbjct: 621 PVHSPP---PPVFSPP 633

 Score =  117 bits (292), Expect = 5e-25
 Identities = 70/134 (52%), Positives = 79/134 (58%), Gaps = 2/134 (1%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PPV+ PP   PP Y+PP   PPV  PP  V+ PP   PPV+ PP   PPVY PP   PPV
Sbjct: 575 PPVHSPP---PPVYSPP--PPPVHSPPPPVHSPP---PPVHSPP---PPVYSPP-PPPPV 622

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           + PP   PPV+ PP   PPV+ PP   PPVY PP   PPVY PP   PPV  PP   PPV
Sbjct: 623 HSPP---PPVFSPP---PPVHSPP---PPVYSPP---PPVYSPP--PPPVKSPP--PPPV 666

Query: 368 YKPPVEKPPVYKPP 409
           Y PP+  P +  PP
Sbjct: 667 YSPPLLPPKMSSPP 680

 Score =  115 bits (289), Expect = 1e-24
 Identities = 69/134 (51%), Positives = 81/134 (60%), Gaps = 2/134 (1%)
 Frame = +2

Query: 14  PPVYKPP--VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PPV+ PP  V  PP   PP++ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV
Sbjct: 540 PPVHSPPPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPV 584

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           Y PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV
Sbjct: 585 YSPP--PPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP-PPPPVHSPP---PPV 629

Query: 368 YKPPVEKPPVYKPP 409
           + PP   PPV+ PP
Sbjct: 630 FSPP---PPVHSPP 640

 Score =  115 bits (289), Expect = 1e-24
 Identities = 68/135 (50%), Positives = 77/135 (57%), Gaps = 3/135 (2%)
 Frame = +2

Query: 14  PPVYKPP---VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           PPVY PP   V  PP   PP++ PP   PPV+ PP   PPVY PP   PPV+ PP   PP
Sbjct: 582 PPVYSPPPPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP-PPPPVHSPP---PP 628

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V+ PP   PPV+ PP   PPVY PP   PPVY PP   PPV  PP   PPVY PP+  P 
Sbjct: 629 VFSPP---PPVHSPP---PPVYSPP---PPVYSPP--PPPVKSPP--PPPVYSPPLLPPK 675

Query: 365 VYKPPVEKPPVYKPP 409
           +  PP + P    PP
Sbjct: 676 MSSPPTQTPVNSPPP 690

 Score =  115 bits (287), Expect = 2e-24
 Identities = 69/135 (51%), Positives = 80/135 (59%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           +  PP   PPV  PP   PP+Y PP   PPVY PP   PPV+ PP   PPV+ PP   PP
Sbjct: 507 IHSPP--PPPVYSPPP-PPPVYSPP-PPPPVYSPP-PPPPVHSPP---PPVHSPP---PP 555

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PP
Sbjct: 556 VHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP--PPPVHSPP---PP 598

Query: 365 VYKPPVEKPPVYKPP 409
           V+ PP   PPV+ PP
Sbjct: 599 VHSPP---PPVHSPP 610

 Score =  114 bits (285), Expect = 3e-24
 Identities = 71/136 (52%), Positives = 79/136 (58%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           R   PP   PPV  PP    PI+ PP   PPVY PP   PPVY PP   PPVY PP   P
Sbjct: 490 RRSPPP---PPVHSPPP-PSPIHSPP--PPPVYSPP-PPPPVYSPP-PPPPVYSPP-PPP 540

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   P
Sbjct: 541 PVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---P 582

Query: 362 PVYKPPVEKPPVYKPP 409
           PVY PP   PPV+ PP
Sbjct: 583 PVYSPP--PPPVHSPP 596

 Score =  107 bits (268), Expect = 3e-22
 Identities = 68/145 (46%), Positives = 81/145 (55%), Gaps = 14/145 (9%)
 Frame = +2

Query: 17  PVYKP-PVEKPPEYTPPIYKPPVE------KPPVYKPPVEK-------PPVYKPPVEKPP 154
           PV+KP P ++ P+   P  + PV+       PPV+ PP          PPVY PP   PP
Sbjct: 465 PVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPP-PPPP 523

Query: 155 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
           VY PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PP
Sbjct: 524 VYSPP-PPPPVYSPP-PPPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PP 569

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKPP 409
           V+ PP   PPV+ PP   PPVY PP
Sbjct: 570 VHSPP---PPVHSPP---PPVYSPP 588

 Score =  102 bits (253), Expect = 2e-20
 Identities = 63/129 (48%), Positives = 71/129 (55%), Gaps = 2/129 (1%)
 Frame = +2

Query: 14  PPVYKPP--VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PPV+ PP  V  PP   PP+Y PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV
Sbjct: 597 PPVHSPPPPVHSPP---PPVYSPP-PPPPVHSPP---PPVFSPP---PPVHSPP---PPV 643

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           Y PP   PPVY PP   PPV  PP   PPVY PP+  P +  PP +  PV  PP   P  
Sbjct: 644 YSPP---PPVYSPP--PPPVKSPP--PPPVYSPPLLPPKMSSPPTQ-TPVNSPPPRTP-- 693

Query: 368 YKPPVEKPP 394
               VE PP
Sbjct: 694 -SQTVEAPP 701

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 65/175 (37%), Positives = 80/175 (45%), Gaps = 44/175 (25%)
 Frame = +2

Query: 17  PVYKP-PVEKPPEYTPPIYKPPVE-----------------KPPVYKPPVEKPPVY---- 130
           PV+KP P ++ P+   P  + PV+                  PP    P   PPV+    
Sbjct: 405 PVHKPQPPKESPQPNDPYNQSPVKFRRSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPS 464

Query: 131 -----KPPVEKP----PVYKPPVE------KPPVYKPPVEK-------PPVYKPPVEKPP 244
                +PP E P    P  + PV+       PPV+ PP          PPVY PP   PP
Sbjct: 465 PVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPP-PPPP 523

Query: 245 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           VY PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP
Sbjct: 524 VYSPP-PPPPVYSPP-PPPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP 567

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 48/116 (41%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
 Frame = +2

Query: 14  PPVYKPP--VEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PPV+ PP  V  PP   PP+Y PP   PPVY PP   PPV  PP   PPVY PP+  P +
Sbjct: 627 PPVFSPPPPVHSPP---PPVYSPP---PPVYSPP--PPPVKSPP--PPPVYSPPLLPPKM 676

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYK 343
             PP +  PV  PP   P      VE PP  +    PP        PP   PP+++
Sbjct: 677 SSPPTQ-TPVNSPPPRTP---SQTVEAPPPSEEFIIPPFIGHQYASPP---PPMFQ 725

[98][TOP]
>UniRef100_Q09083 Hydroxyproline-rich glycoprotein n=1 Tax=Phaseolus vulgaris
           RepID=Q09083_PHAVU
          Length = 580

 Score =  120 bits (300), Expect = 6e-26
 Identities = 75/153 (49%), Positives = 76/153 (49%), Gaps = 23/153 (15%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 163
           PP YK P   PP Y      PP+YK     PPVYK     PPVYK     PPVYK     
Sbjct: 294 PPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPP 353

Query: 164 PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPP 304
           PPV K    PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP
Sbjct: 354 PPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 413

Query: 305 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
            YK P   PPVYK     PPVYK     PPVYK
Sbjct: 414 PYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYK 446

 Score =  117 bits (294), Expect = 3e-25
 Identities = 79/162 (48%), Positives = 80/162 (49%), Gaps = 32/162 (19%)
 Frame = +2

Query: 14  PPVYK-----PPVEKPPEYTPPIYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKP 151
           PPVYK     PPV K     PP+YK     PPVYK     PPV K    PP YK P   P
Sbjct: 314 PPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPP 373

Query: 152 PVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 304
           P YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PP
Sbjct: 374 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPP 433

Query: 305 VYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK 403
           VYK     PPV K    PP YK P   PP YK     PPVYK
Sbjct: 434 VYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYK 475

 Score =  117 bits (292), Expect = 5e-25
 Identities = 79/161 (49%), Positives = 79/161 (49%), Gaps = 31/161 (19%)
 Frame = +2

Query: 14  PPVYK----PPVEKPPEYTPPIYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPP 154
           PPVYK    PP  K P   PP YK P   PPVYK     PPV K    PP YK P   PP
Sbjct: 354 PPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 413

Query: 155 VYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPV 307
            YK P   PPVYK     PPVYK     PPV K    PP YK P   PP YK     PPV
Sbjct: 414 PYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPV 473

Query: 308 YK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK 403
           YK     PPV K    PP YK P   PP YK     PPVYK
Sbjct: 474 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYK 514

 Score =  116 bits (290), Expect = 9e-25
 Identities = 72/143 (50%), Positives = 72/143 (50%), Gaps = 13/143 (9%)
 Frame = +2

Query: 14  PPVYK----PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           PPVYK    PP  K P   PP YK     PPVYK     PPVYK     PPVYK     P
Sbjct: 285 PPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPP 344

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PP 334
           PVYK     PPVYK     PP YK P   PP YK P   PPVYK     PPV K    PP
Sbjct: 345 PVYKYKSPPPPVYKYN-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 403

Query: 335 VYKPPVEKPPVYKPPVEKPPVYK 403
            YK P   PP YK P   PPVYK
Sbjct: 404 PYKYPSPPPPPYKYPSPPPPVYK 426

 Score =  115 bits (289), Expect = 1e-24
 Identities = 78/161 (48%), Positives = 78/161 (48%), Gaps = 31/161 (19%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT----PPIYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PP 154
           PPVYK     PP Y     PP YK P   PP YK P   PPVYK     PPV K    PP
Sbjct: 344 PPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 403

Query: 155 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPV 307
            YK P   PP YK P   PPVYK     PPVYK     PPV K    PP YK P   PP 
Sbjct: 404 PYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPP 463

Query: 308 YKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYK 403
           YK     PPVYK     PPV K    PP YK P   PP YK
Sbjct: 464 YKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYK 504

 Score =  115 bits (288), Expect = 2e-24
 Identities = 77/164 (46%), Positives = 79/164 (48%), Gaps = 32/164 (19%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKP 151
           PP YK P   PP Y      PP+YK     PPVYK     PPV K    PP YK P   P
Sbjct: 402 PPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPP 461

Query: 152 PVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PP 289
           P YK     PPVYK     PPV K    PP YK P   PP YK     PPVYK     PP
Sbjct: 462 PPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPP 521

Query: 290 VEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           V K    PP YK P   PPVYK     PPVYK     PPV+ PP
Sbjct: 522 VYKYKSPPPPYKYPSPPPPVYKYKSPPPPVYKYNSPPPPVHSPP 565

 Score =  115 bits (287), Expect = 2e-24
 Identities = 77/162 (47%), Positives = 78/162 (48%), Gaps = 32/162 (19%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKP 151
           PP YK P   PP Y      PP+YK     PPV K    PP YK P   PP YK P   P
Sbjct: 363 PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPP 422

Query: 152 PVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PP 289
           PVYK     PPVYK     PPV K    PP YK P   PP YK     PPVYK     PP
Sbjct: 423 PVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPP 482

Query: 290 VEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
           V K    PP YK P   PP YK     PPVYK     PPVYK
Sbjct: 483 VYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYK 524

 Score =  110 bits (274), Expect = 6e-23
 Identities = 74/157 (47%), Positives = 77/157 (49%), Gaps = 25/157 (15%)
 Frame = +2

Query: 14  PPVY---KPPVEKPPEYTPPIYKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PP Y    PP + P +Y+ P   PPV K    PP YK P   PP YK     PPVYK   
Sbjct: 264 PPYYYHSPPPPKNPYKYSSP--PPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKS 321

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVE 325
             PPVYK     PPVYK     PPVYK     PPV K    PP YK P   PP YK P  
Sbjct: 322 PPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSP 381

Query: 326 KPPVYK-----PPVEK----PPVYKPPVEKPPVYKPP 409
            PPVYK     PPV K    PP YK P   PP YK P
Sbjct: 382 PPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYP 418

 Score =  105 bits (262), Expect = 2e-21
 Identities = 70/152 (46%), Positives = 74/152 (48%), Gaps = 22/152 (14%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP----IYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPP 154
           PP Y      PP+++PP     + PP  K P YK     PPV K    PP YK P   PP
Sbjct: 247 PPPYYYHSPPPPKHSPPPPYYYHSPPPPKNP-YKYSSPPPPVYKYKSPPPPYKYPSPPPP 305

Query: 155 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPV 307
            YK     PPVYK     PPVYK     PPVYK     PPVYK     PPV K    PP 
Sbjct: 306 PYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPP 365

Query: 308 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
           YK P   PP YK P   PPVYK     PPVYK
Sbjct: 366 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 397

 Score =  102 bits (253), Expect = 2e-20
 Identities = 69/151 (45%), Positives = 71/151 (47%), Gaps = 22/151 (14%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT----PPIYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PP 154
           PPVYK     PP Y     PP YK P   PP YK     PPVYK     PPV K    PP
Sbjct: 432 PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPP 491

Query: 155 VYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPV 307
            YK P   PP YK     PPVYK     PPV K    PP YK P   PPVYK     PPV
Sbjct: 492 PYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPVYKYKSPPPPV 551

Query: 308 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 400
           YK     PPV+ PP   PP Y      PP +
Sbjct: 552 YKYNSPPPPVHSPP---PPHYIYASPPPPYH 579

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 71/154 (46%), Positives = 73/154 (47%), Gaps = 24/154 (15%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY----TPPIYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYK---- 163
           PP + PP   PP Y     PP + PP   PP Y   PP  K P YK     PPVYK    
Sbjct: 241 PPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPPPPKNP-YKYSSPPPPVYKYKSP 293

Query: 164 PPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 313
           PP  K     PP YK     PPVYK     PPVYK     PPVYK     PPVYK     
Sbjct: 294 PPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPP 353

Query: 314 PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK 403
           PPV K    PP YK P   PP YK P   PPVYK
Sbjct: 354 PPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYK 387

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 63/138 (45%), Positives = 66/138 (47%), Gaps = 8/138 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY----TPPIYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 169
           PP + PP   PP Y     PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 225 PPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 272

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
             K P YK     PPVYK     PP YK P   PP YK     PPVYK     PPVYK  
Sbjct: 273 PPKNP-YKYSSPPPPVYKYK-SPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYK 330

Query: 350 VEKPPVYKPPVEKPPVYK 403
              PPVYK     PPVYK
Sbjct: 331 SPPPPVYKYNSPPPPVYK 348

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 67/162 (41%), Positives = 70/162 (43%), Gaps = 32/162 (19%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY----TPPIYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 169
           PP + PP   PP Y     PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 209 PPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 256

Query: 170 VEK---PPVY-----------------KPPVEK----PPVYKPPVEKPPVYKPPVEKPPV 277
             K   PP Y                  PPV K    PP YK P   PP YK     PPV
Sbjct: 257 PPKHSPPPPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPV 316

Query: 278 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
           YK     PPVYK     PPVYK     PPVYK     PPVYK
Sbjct: 317 YKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYK 358

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 63/164 (38%), Positives = 70/164 (42%), Gaps = 34/164 (20%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 175
           PP Y      PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 183 PPPYYYHSPPPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 231

Query: 176 KPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEK----PPVY----------------K 283
            PP Y   PP   PP + PP   PP Y   PP  K    PP Y                 
Sbjct: 232 -PPYYYHSPP---PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKNPYKYSSPP 284

Query: 284 PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
           PPV K    PP YK P   PP YK     PPVYK     PPVYK
Sbjct: 285 PPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYK 328

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 58/148 (39%), Positives = 67/148 (45%), Gaps = 18/148 (12%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 175
           PP Y      PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 167 PPPYYYHSPPPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 215

Query: 176 KPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY----KPPVEKP 331
            PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y     PP   P
Sbjct: 216 -PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPPPPKHSP 262

Query: 332 P----VYKPPVEKPPVYKPPVEKPPVYK 403
           P     + PP  K P YK     PPVYK
Sbjct: 263 PPPYYYHSPPPPKNP-YKYSSPPPPVYK 289

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 59/147 (40%), Positives = 70/147 (47%), Gaps = 14/147 (9%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPV 172
           KP  Y+ P   PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP 
Sbjct: 40  KPYYYQSP--PPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP- 87

Query: 173 EKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPP 334
             PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP
Sbjct: 88  --PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PP 130

Query: 335 VYKPPVEKPPVY--KPPVEKPPVYKPP 409
            + PP   PP Y   PP   PP + PP
Sbjct: 131 KHSPP---PPYYYHSPP---PPKHSPP 151

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 58/146 (39%), Positives = 68/146 (46%), Gaps = 14/146 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 175
           PP Y      PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 55  PPPYYYHSPPPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 103

Query: 176 KPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 337
            PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP 
Sbjct: 104 -PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPK 147

Query: 338 YKPPVEKPPVY--KPPVEKPPVYKPP 409
           + PP   PP Y   PP   PP + PP
Sbjct: 148 HSPP---PPYYYHSPP---PPKHSPP 167

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 58/146 (39%), Positives = 68/146 (46%), Gaps = 14/146 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 175
           PP Y      PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 103 PPPYYYHSPPPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 151

Query: 176 KPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 337
            PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP 
Sbjct: 152 -PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPK 195

Query: 338 YKPPVEKPPVY--KPPVEKPPVYKPP 409
           + PP   PP Y   PP   PP + PP
Sbjct: 196 HSPP---PPYYYHSPP---PPKHSPP 215

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 58/146 (39%), Positives = 68/146 (46%), Gaps = 14/146 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 175
           PP Y      PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 119 PPPYYYHSPPPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 167

Query: 176 KPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 337
            PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP 
Sbjct: 168 -PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPK 211

Query: 338 YKPPVEKPPVY--KPPVEKPPVYKPP 409
           + PP   PP Y   PP   PP + PP
Sbjct: 212 HSPP---PPYYYHSPP---PPKHSPP 231

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 58/146 (39%), Positives = 68/146 (46%), Gaps = 14/146 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 175
           PP Y      PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 135 PPPYYYHSPPPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 183

Query: 176 KPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 337
            PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP 
Sbjct: 184 -PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPK 227

Query: 338 YKPPVEKPPVY--KPPVEKPPVYKPP 409
           + PP   PP Y   PP   PP + PP
Sbjct: 228 HSPP---PPYYYHSPP---PPKHSPP 247

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 58/146 (39%), Positives = 68/146 (46%), Gaps = 14/146 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP----IYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 175
           PP Y      PP+++PP     + PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 151 PPPYYYHSPPPPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 199

Query: 176 KPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 337
            PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP 
Sbjct: 200 -PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPK 243

Query: 338 YKPPVEKPPVY--KPPVEKPPVYKPP 409
           + PP   PP Y   PP   PP + PP
Sbjct: 244 HSPP---PPYYYHSPP---PPKHSPP 263

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 50/123 (40%), Positives = 56/123 (45%), Gaps = 11/123 (8%)
 Frame = +2

Query: 74  PPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKP 241
           PP  KP  Y+ P   PP + PP   PP Y   PP   PP + PP   PP Y   PP   P
Sbjct: 36  PPPPKPYYYQSP--PPPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---P 81

Query: 242 PVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVY 400
           P + PP   PP Y   PP   PP + PP   PP Y   PP  K   PP Y      PP +
Sbjct: 82  PKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKH 132

Query: 401 KPP 409
            PP
Sbjct: 133 SPP 135

[99][TOP]
>UniRef100_A5AVB2 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5AVB2_VITVI
          Length = 296

 Score =  120 bits (300), Expect = 6e-26
 Identities = 63/136 (46%), Positives = 75/136 (55%), Gaps = 3/136 (2%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           +PP  KPP  +PP   PP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  
Sbjct: 54  QPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGA 113

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVY-KPPVEKP 361
           +PP  KPP  +PP  KPP  +PP   PP  +PPV KPP +   PP   PP+Y  PP   P
Sbjct: 114 QPPNGKPPGAQPPNGKPPGAQPPKGTPPGAQPPVAKPPSHYGYPPYGSPPIYASPPYAAP 173

Query: 362 PVYKPPVEKPPVYKPP 409
           P        PPV  PP
Sbjct: 174 PTNGSITPTPPVLSPP 189

 Score =  112 bits (280), Expect = 1e-23
 Identities = 61/131 (46%), Positives = 73/131 (55%), Gaps = 2/131 (1%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYT--PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           + P     P   P  YT  PP+  PP   PP  +PP  KPP  +PP  KPP  +PP  KP
Sbjct: 22  QPPTPTTTPTPAPAPYTASPPL-SPPNGIPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKP 80

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           P  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP   P
Sbjct: 81  PGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPNGKPPGAQPPNGKPPGAQPPKGTP 140

Query: 362 PVYKPPVEKPP 394
           P  +PPV KPP
Sbjct: 141 PGAQPPVAKPP 151

 Score =  111 bits (277), Expect = 3e-23
 Identities = 61/132 (46%), Positives = 73/132 (55%), Gaps = 3/132 (2%)
 Frame = +2

Query: 23  YKPPVEKP---PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           Y+PP       P   P    PP+  PP   PP  +PP  KPP  +PP  KPP  +PP  K
Sbjct: 21  YQPPTPTTTPTPAPAPYTASPPLS-PPNGIPPGAQPPKGKPPGAQPPNGKPPGAQPPKGK 79

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP   
Sbjct: 80  PPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPNGKPPGAQPPNGKPPGAQPPKGT 139

Query: 374 PPVEKPPVYKPP 409
           PP  +PPV KPP
Sbjct: 140 PPGAQPPVAKPP 151

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 54/130 (41%), Positives = 64/130 (49%), Gaps = 3/130 (2%)
 Frame = +2

Query: 29  PPVEKPPEYTPPI---YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 199
           PP   P    PP    Y+PP        P     P   P    PP+  PP   PP  +PP
Sbjct: 5   PPPPPPQHPMPPCKCGYQPPT-------PTTTPTPAPAPYTASPPL-SPPNGIPPGAQPP 56

Query: 200 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 379
             KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP
Sbjct: 57  KGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPP 116

Query: 380 VEKPPVYKPP 409
             KPP  +PP
Sbjct: 117 NGKPPGAQPP 126

[100][TOP]
>UniRef100_Q27409 Adhesive plaque matrix protein n=1 Tax=Mytilus galloprovincialis
           RepID=FP1_MYTGA
          Length = 751

 Score =  120 bits (300), Expect = 6e-26
 Identities = 60/135 (44%), Positives = 63/135 (46%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PPVYKP +  PP Y P     P YKP    P  YK     P  YKP    PP YKP +  
Sbjct: 106 PPVYKPKMTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPTYKPKLTY 165

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP    PP YKP    P  YK     PP YK     P  YKP    P  YKP V  
Sbjct: 166 PPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTYPSTYKPKVSY 225

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     PP+YK
Sbjct: 226 PPTYKSKKSYPPIYK 240

 Score =  114 bits (285), Expect = 3e-24
 Identities = 58/136 (42%), Positives = 60/136 (44%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP    PP Y      P  YK     P  YKP    PP YKP +  PP YKP    
Sbjct: 116 PPTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSY 175

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP    P  YK     PP YK     P  YKP    P  YKP V  PP YK     
Sbjct: 176 PPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTYPSTYKPKVSYPPTYKSKKSY 235

Query: 359 PPVYKPPVEKPPVYKP 406
           PP+YK     P  YKP
Sbjct: 236 PPIYKTKASYPSSYKP 251

 Score =  114 bits (285), Expect = 3e-24
 Identities = 58/136 (42%), Positives = 60/136 (44%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP    P  Y      P  YKP    PP YKP +  PP YKP    PP YKP    
Sbjct: 126 PPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSY 185

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           P  YK     PP YK     P  YKP    P  YKP V  PP YK     PP+YK     
Sbjct: 186 PATYKSKSSYPPSYKTKKTYPSSYKPKKTYPSTYKPKVSYPPTYKSKKSYPPIYKTKASY 245

Query: 359 PPVYKPPVEKPPVYKP 406
           P  YKP    P  YKP
Sbjct: 246 PSSYKPKKTYPSTYKP 261

 Score =  112 bits (280), Expect = 1e-23
 Identities = 58/139 (41%), Positives = 60/139 (43%), Gaps = 9/139 (6%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---- 166
            PP YK     PP Y      PP YK     PP YK     PP YK     PP YK     
Sbjct: 596  PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 655

Query: 167  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
            P   P  YK     PP YK     PP YKP    PP YK     P  YKP    PP YKP
Sbjct: 656  PATYPSTYKAKPSYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKP 715

Query: 347  PVEKPPVYKPPVEKPPVYK 403
             +  PP+YKP    PP YK
Sbjct: 716  KLTYPPIYKPKPSYPPTYK 734

 Score =  110 bits (275), Expect = 5e-23
 Identities = 52/116 (44%), Positives = 55/116 (47%)
 Frame = +2

Query: 59  PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 238
           PP+YKP +  PP YKP    PP YKP    P  YK     P  YKP    PP YKP +  
Sbjct: 106 PPVYKPKMTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPTYKPKLTY 165

Query: 239 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           PP YKP    PP YKP    P  YK     PP YK     P  YKP    P  YKP
Sbjct: 166 PPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTYPSTYKP 221

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/135 (40%), Positives = 58/135 (42%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     PP Y      PP YKP    PP YKP +  PP YK     PP+YK     
Sbjct: 326 PPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSY 385

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK      P YK     PP YK     P  YK     PP YK     PP YK  +  
Sbjct: 386 PPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYKAKLSY 445

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     PP YK
Sbjct: 446 PPTYKAKPSYPPTYK 460

 Score =  109 bits (273), Expect = 8e-23
 Identities = 56/132 (42%), Positives = 57/132 (43%), Gaps = 5/132 (3%)
 Frame = +2

Query: 23  YKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           Y      PP Y P     P YKP    PP YKP    P  YK     P  YKP    PP 
Sbjct: 99  YNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPT 158

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
           YKP +  PP YKP    PP YKP    P  YK     PP YK     P  YKP    P  
Sbjct: 159 YKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTYPST 218

Query: 368 YKPPVEKPPVYK 403
           YKP V  PP YK
Sbjct: 219 YKPKVSYPPTYK 230

 Score =  108 bits (271), Expect = 1e-22
 Identities = 55/130 (42%), Positives = 58/130 (44%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           P  YKP         PP YKP +  PP YKP    PP YKP    P  YK     PP YK
Sbjct: 146 PSSYKPKKT-----YPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYK 200

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
                P  YKP    P  YKP V  PP YK     PP+YK     P  YKP    P  YK
Sbjct: 201 TKKTYPSSYKPKKTYPSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTYPSTYK 260

Query: 374 PPVEKPPVYK 403
           P +  PP YK
Sbjct: 261 PKISYPPTYK 270

 Score =  108 bits (271), Expect = 1e-22
 Identities = 55/135 (40%), Positives = 58/135 (42%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYK-----PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     PP  KP    PP YKP +  PP YK     PP+YK     PP YK     
Sbjct: 336 PPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSY 395

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
            P YK     PP YK     P  YK     PP YK     PP YK  +  PP YK     
Sbjct: 396 LPTYKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSY 455

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     PP YK
Sbjct: 456 PPTYKAKPSYPPTYK 470

 Score =  108 bits (270), Expect = 2e-22
 Identities = 61/160 (38%), Positives = 63/160 (39%), Gaps = 29/160 (18%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
            PP YK     PP Y      PP YK     PP YK     PP YK     PP YK     
Sbjct: 566  PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 625

Query: 179  PPVYKPPVEKPPVYK-----PPVEK-------------------PPVYKPPVEKPPVYKP 286
            PP YK     PP YK     PP  K                   PP YK     PP YKP
Sbjct: 626  PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKAKPSYPPTYKAKPSYPPTYKP 685

Query: 287  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
                PP YK     P  YKP    PP YKP +  PP+YKP
Sbjct: 686  KPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPIYKP 725

 Score =  108 bits (269), Expect = 2e-22
 Identities = 55/130 (42%), Positives = 58/130 (44%), Gaps = 2/130 (1%)
 Frame = +2

Query: 23  YKPPVEKPPEYTP--PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           Y P  +K   Y P    Y      PPVYKP +  PP YKP    PP YKP    P  YK 
Sbjct: 82  YLPLAKKLSSYKPIKTTYNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYKPKPSYPATYKS 141

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
               P  YKP    PP YKP +  PP YKP    PP YKP    P  YK     PP YK 
Sbjct: 142 KSSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKT 201

Query: 377 PVEKPPVYKP 406
               P  YKP
Sbjct: 202 KKTYPSSYKP 211

 Score =  107 bits (268), Expect = 3e-22
 Identities = 54/131 (41%), Positives = 57/131 (43%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KP    PP  KP    PP YKP    PP YKP    P  YK     PP YK     P  Y
Sbjct: 150 KPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSY 209

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           KP    P  YKP V  PP YK     PP+YK     P  YKP    P  YKP +  PP Y
Sbjct: 210 KPKKTYPSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTYPSTYKPKISYPPTY 269

Query: 371 KPPVEKPPVYK 403
           K     P  Y+
Sbjct: 270 KAKPSYPTSYR 280

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/135 (40%), Positives = 57/135 (42%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP    PP Y P I  PP  K     PP+YK     PP YK      P YK     
Sbjct: 346 PPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSY 405

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK     P  YK     PP YK     PP YK  +  PP YK     PP YK     
Sbjct: 406 PPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKAKPSY 465

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     PP YK
Sbjct: 466 PPTYKAKPSYPPTYK 480

 Score =  107 bits (267), Expect = 4e-22
 Identities = 58/139 (41%), Positives = 60/139 (43%), Gaps = 9/139 (6%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKP----PVEKPPVYKP 166
            PP YK     PP Y      PP YK     PP YK     PP YK     P   P  YK 
Sbjct: 606  PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKA 665

Query: 167  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
                PP YK     PP YKP    PP YK     P  YKP    PP YKP +  PP+YKP
Sbjct: 666  KPSYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPIYKP 725

Query: 347  PVEKPPVYKPPVEKPPVYK 403
                PP YK     PP YK
Sbjct: 726  KPSYPPTYKS--SYPPRYK 742

 Score =  107 bits (266), Expect = 5e-22
 Identities = 61/165 (36%), Positives = 64/165 (38%), Gaps = 35/165 (21%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 163
           P  YKP V  PP Y      PPIYK     P  YKP    P  YKP +  PP YK     
Sbjct: 216 PSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTYPSTYKPKISYPPTYKAKPSY 275

Query: 164 --------------------PPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 268
                               PP  K     PP YK     P  YK     PP YK     
Sbjct: 276 PTSYRAKPSYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKAKPSY 335

Query: 269 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
           PP YK     PP YKP    PP YKP +  PP YK     PP+YK
Sbjct: 336 PPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYK 380

 Score =  106 bits (265), Expect = 7e-22
 Identities = 53/135 (39%), Positives = 57/135 (42%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           P  YKP +  PP Y      P  Y+     P  YK     PP YK     PP YK     
Sbjct: 256 PSTYKPKISYPPTYKAKPSYPTSYRAKPSYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTY 315

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           P  YK     PP YK     PP YK     PP YKP    PP YKP +  PP YK     
Sbjct: 316 PSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSY 375

Query: 359 PPVYKPPVEKPPVYK 403
           PP+YK     PP YK
Sbjct: 376 PPIYKAKPSYPPTYK 390

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/135 (40%), Positives = 58/135 (42%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y P     P YKP    P  YK     PP YK     P  YKP    
Sbjct: 156 PPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTY 215

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           P  YKP V  PP YK     PP+YK     P  YKP    P  YKP +  PP YK     
Sbjct: 216 PSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTYPSTYKPKISYPPTYKAKPSY 275

Query: 359 PPVYKPPVEKPPVYK 403
           P  Y+     P  YK
Sbjct: 276 PTSYRAKPSYPSTYK 290

 Score =  105 bits (263), Expect = 1e-21
 Identities = 54/135 (40%), Positives = 56/135 (41%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     PP Y      P  YK     PP YK     PP YK     PP YKP    
Sbjct: 296 PPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTY 355

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP +  PP YK     PP+YK     PP YK      P YK     PP YK     
Sbjct: 356 PPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRY 415

Query: 359 PPVYKPPVEKPPVYK 403
           P  YK     PP YK
Sbjct: 416 PTTYKAKPSYPPTYK 430

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/135 (40%), Positives = 56/135 (41%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     P  Y      PP YK     PP YK     PP YKP    PP YKP +  
Sbjct: 306 PPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISY 365

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK     PP+YK     PP YK      P YK     PP YK     P  YK     
Sbjct: 366 PPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTTYKAKPSY 425

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     PP YK
Sbjct: 426 PPTYKAKPSYPPTYK 440

 Score =  104 bits (260), Expect = 3e-21
 Identities = 54/135 (40%), Positives = 56/135 (41%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP +  PP Y      PPIYK     PP YK      P YK     PP YK     
Sbjct: 356 PPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRY 415

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           P  YK     PP YK     PP YK  +  PP YK     PP YK     PP YK     
Sbjct: 416 PTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 475

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     P  YK
Sbjct: 476 PPTYKTKPSYPRTYK 490

 Score =  104 bits (260), Expect = 3e-21
 Identities = 54/135 (40%), Positives = 54/135 (40%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     PP Y      PP YK     PP YK     PP YK     P  YK     
Sbjct: 506 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSY 565

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK     PP YK     PP YK     PP YK     PP YK     PP YK     
Sbjct: 566 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 625

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     PP YK
Sbjct: 626 PPTYKAKPSYPPTYK 640

 Score =  104 bits (260), Expect = 3e-21
 Identities = 54/135 (40%), Positives = 54/135 (40%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     PP Y      PP YK     PP YK     P  YK     PP YK     
Sbjct: 516 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSY 575

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK     PP YK     PP YK     PP YK     PP YK     PP YK     
Sbjct: 576 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 635

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     PP YK
Sbjct: 636 PPTYKAKPSYPPTYK 650

 Score =  103 bits (258), Expect = 5e-21
 Identities = 53/139 (38%), Positives = 57/139 (41%), Gaps = 5/139 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YK     P  Y      P  YK     PP YK     PP YK     P  YK 
Sbjct: 262 KISYPPTYKAKPSYPTSYRAKPSYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKA 321

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
               PP YK     PP YK     PP YKP    PP YKP +  PP YK     PP+YK 
Sbjct: 322 KPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKA 381

Query: 347 PVEKPPVYKPPVEKPPVYK 403
               PP YK      P YK
Sbjct: 382 KPSYPPTYKAKPSYLPTYK 400

 Score =  103 bits (257), Expect = 6e-21
 Identities = 58/146 (39%), Positives = 59/146 (40%), Gaps = 14/146 (9%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
            PP YK     PP Y      PP YK     PP YK     PP YK     PP YK     
Sbjct: 586  PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 645

Query: 179  PPVYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
            PP YK     P   P  YK     PP YK     PP YKP    PP YK     P  YKP
Sbjct: 646  PPTYKAKPSYPATYPSTYKAKPSYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKP 705

Query: 347  PVEKPPVYKP-----PVEKPPVYKPP 409
                PP YKP     P+ KP    PP
Sbjct: 706  KKTYPPTYKPKLTYPPIYKPKPSYPP 731

 Score =  103 bits (256), Expect = 8e-21
 Identities = 52/129 (40%), Positives = 55/129 (42%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P Y    +  P Y PP YK     PP YK     P  YK     PP YK     PP YK 
Sbjct: 283 PSYPSTYKAKPSY-PPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKA 341

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
               PP YKP    PP YKP +  PP YK     PP+YK     PP YK      P YK 
Sbjct: 342 KPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKA 401

Query: 377 PVEKPPVYK 403
               PP YK
Sbjct: 402 KPSYPPTYK 410

 Score =  102 bits (255), Expect = 1e-20
 Identities = 53/135 (39%), Positives = 56/135 (41%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP    P  Y      PP YK     P  YKP    P  YKP V  PP YK     
Sbjct: 176 PPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTYPSTYKPKVSYPPTYKSKKSY 235

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP+YK     P  YKP    P  YKP +  PP YK     P  Y+     P  YK     
Sbjct: 236 PPIYKTKASYPSSYKPKKTYPSTYKPKISYPPTYKAKPSYPTSYRAKPSYPSTYKAKPSY 295

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     PP YK
Sbjct: 296 PPTYKAKPSYPPTYK 310

 Score =  102 bits (254), Expect = 1e-20
 Identities = 53/135 (39%), Positives = 56/135 (41%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP    PP Y      P  YK     PP YK     P  YKP    P  YKP V  
Sbjct: 166 PPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTYPSTYKPKVSY 225

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK     PP+YK     P  YKP    P  YKP +  PP YK     P  Y+     
Sbjct: 226 PPTYKSKKSYPPIYKTKASYPSSYKPKKTYPSTYKPKISYPPTYKAKPSYPTSYRAKPSY 285

Query: 359 PPVYKPPVEKPPVYK 403
           P  YK     PP YK
Sbjct: 286 PSTYKAKPSYPPTYK 300

 Score =  102 bits (254), Expect = 1e-20
 Identities = 52/129 (40%), Positives = 53/129 (41%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P Y P  +  P Y PP YK     PP YK     PP YK     PP YK     P  YK 
Sbjct: 503 PSYPPTYKAKPSY-PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKA 561

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
               PP YK     PP YK     PP YK     PP YK     PP YK     PP YK 
Sbjct: 562 KSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKA 621

Query: 377 PVEKPPVYK 403
               PP YK
Sbjct: 622 KPSYPPTYK 630

 Score =  102 bits (254), Expect = 1e-20
 Identities = 55/139 (39%), Positives = 55/139 (39%), Gaps = 9/139 (6%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           P  YK     PP Y      PP YK     PP YK     PP YK     PP YK     
Sbjct: 556 PQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 615

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPPVYKP 346
           PP YK     PP YK     PP YK     PP YK     P   P  YK     PP YK 
Sbjct: 616 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKAKPSYPPTYKA 675

Query: 347 PVEKPPVYKPPVEKPPVYK 403
               PP YKP    PP YK
Sbjct: 676 KPSYPPTYKPKPSYPPTYK 694

 Score =  102 bits (253), Expect = 2e-20
 Identities = 55/140 (39%), Positives = 55/140 (39%), Gaps = 9/140 (6%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     P  Y      PP YK     PP YK     PP YK     PP YK     
Sbjct: 546 PPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 605

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP----PVEKPPVYKP 346
           PP YK     PP YK     PP YK     PP YK     PP YK     P   P  YK 
Sbjct: 606 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKA 665

Query: 347 PVEKPPVYKPPVEKPPVYKP 406
               PP YK     PP YKP
Sbjct: 666 KPSYPPTYKAKPSYPPTYKP 685

 Score =  101 bits (252), Expect = 2e-20
 Identities = 53/135 (39%), Positives = 57/135 (42%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPPIYKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           P  YK     PP Y   P Y P  +     PP YKP    PP YKP +  PP YK     
Sbjct: 316 PSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSY 375

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP+YK     PP YK      P YK     PP YK     P  YK     PP YK     
Sbjct: 376 PPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYKAKPSY 435

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK  +  PP YK
Sbjct: 436 PPTYKAKLSYPPTYK 450

 Score =  100 bits (250), Expect = 4e-20
 Identities = 60/166 (36%), Positives = 63/166 (37%), Gaps = 35/166 (21%)
 Frame = +2

Query: 14  PPVYK-----PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     P   KP +  P  YKP V  PP YK     PP+YK     P  YKP    
Sbjct: 196 PPSYKTKKTYPSSYKPKKTYPSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTY 255

Query: 179 PPVYKPPVEKPPVYK-------------------------PPVEK-----PPVYKPPVEK 268
           P  YKP +  PP YK                         PP  K     PP YK     
Sbjct: 256 PSTYKPKISYPPTYKAKPSYPTSYRAKPSYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTY 315

Query: 269 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           P  YK     PP YK     PP YK     PP YKP    PP YKP
Sbjct: 316 PSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKP 361

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 52/134 (38%), Positives = 52/134 (38%), Gaps = 5/134 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     PP Y      PP YK     P  YK     PP YK     PP YK     
Sbjct: 526 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSY 585

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK     PP YK     PP YK     PP YK     PP YK     PP YK     
Sbjct: 586 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 645

Query: 359 PPVYKPPVEKPPVY 400
           PP YK     P  Y
Sbjct: 646 PPTYKAKPSYPATY 659

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 54/139 (38%), Positives = 54/139 (38%), Gaps = 9/139 (6%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     PP Y      P  YK     PP YK     PP YK     PP YK     
Sbjct: 536 PPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 595

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---- 346
           PP YK     PP YK     PP YK     PP YK     PP YK     PP YK     
Sbjct: 596 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 655

Query: 347 PVEKPPVYKPPVEKPPVYK 403
           P   P  YK     PP YK
Sbjct: 656 PATYPSTYKAKPSYPPTYK 674

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 52/135 (38%), Positives = 55/135 (40%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPPIYKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           P  YK     PP Y   P Y P  +     P  YK     PP YK     PP YK     
Sbjct: 286 PSTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSY 345

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YKP    PP YKP +  PP YK     PP+YK     PP YK      P YK     
Sbjct: 346 PPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSY 405

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     P  YK
Sbjct: 406 PPTYKAKPRYPTTYK 420

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 50/129 (38%), Positives = 52/129 (40%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P Y P  +  P Y PP YK  +  PP YK     PP YK     PP YK     PP YK 
Sbjct: 423 PSYPPTYKAKPSY-PPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKT 481

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
               P  YK        YK     PP YK     PP YK     PP YK     PP YK 
Sbjct: 482 KPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKA 541

Query: 377 PVEKPPVYK 403
               PP YK
Sbjct: 542 KPSYPPTYK 550

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 51/135 (37%), Positives = 52/135 (38%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     P  Y      PP YK     PP YK  +  PP YK     PP YK     
Sbjct: 406 PPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKAKPSY 465

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK     PP YK     P  YK        YK     PP YK     PP YK     
Sbjct: 466 PPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSY 525

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     PP YK
Sbjct: 526 PPTYKAKPSYPPTYK 540

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 51/135 (37%), Positives = 52/135 (38%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK  +  PP Y      PP YK     PP YK     PP YK     P  YK     
Sbjct: 436 PPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYKAKPSY 495

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
              YK     PP YK     PP YK     PP YK     PP YK     PP YK     
Sbjct: 496 SSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 555

Query: 359 PPVYKPPVEKPPVYK 403
           P  YK     PP YK
Sbjct: 556 PQTYKAKSSYPPTYK 570

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/145 (37%), Positives = 54/145 (37%), Gaps = 15/145 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPP--------------IYKPPVEKPPVYKPPVEKPPVYKPPVEK 148
           PP YK     PP Y T P               YK     PP YK     PP YK     
Sbjct: 466 PPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSY 525

Query: 149 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
           PP YK     PP YK     PP YK     P  YK     PP YK     PP YK     
Sbjct: 526 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSY 585

Query: 329 PPVYKPPVEKPPVYKPPVEKPPVYK 403
           PP YK     PP YK     PP YK
Sbjct: 586 PPTYKAKPSYPPTYKAKPSYPPTYK 610

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 52/128 (40%), Positives = 55/128 (42%), Gaps = 9/128 (7%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYT-----PPIYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
            PP YK     PP Y      PP YK     P   P  YK     PP YK     PP YKP
Sbjct: 626  PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKAKPSYPPTYKAKPSYPPTYKP 685

Query: 167  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
                PP YK     P  YKP    PP YKP +  PP+YKP    PP YK     PP YK 
Sbjct: 686  KPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPIYKPKPSYPPTYKS--SYPPRYKK 743

Query: 347  PVEKPPVY 370
             +  P  Y
Sbjct: 744  KISYPSQY 751

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 51/139 (36%), Positives = 53/139 (38%), Gaps = 5/139 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           ++  PP YK     PP Y      PP YK     PP YK     P  YK        YK 
Sbjct: 442 KLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKA 501

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
               PP YK     PP YK     PP YK     PP YK     PP YK     P  YK 
Sbjct: 502 KPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKA 561

Query: 347 PVEKPPVYKPPVEKPPVYK 403
               PP YK     PP YK
Sbjct: 562 KSSYPPTYKAKPSYPPTYK 580

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/135 (37%), Positives = 51/135 (37%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     PP Y      PP YK     PP YK     PP YK     PP YK     
Sbjct: 426 PPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKTKPSY 485

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           P  YK        YK     PP YK     PP YK     PP YK     PP YK     
Sbjct: 486 PRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 545

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     P  YK
Sbjct: 546 PPTYKAKPSYPQTYK 560

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/135 (37%), Positives = 51/135 (37%), Gaps = 5/135 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK     PP Y      PP YK     P  YK        YK     PP YK     
Sbjct: 456 PPTYKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSY 515

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP YK     PP YK     PP YK     PP YK     P  YK     PP YK     
Sbjct: 516 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSY 575

Query: 359 PPVYKPPVEKPPVYK 403
           PP YK     PP YK
Sbjct: 576 PPTYKAKPSYPPTYK 590

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 49/129 (37%), Positives = 51/129 (39%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P Y P  +  P Y P  YK     PP YK     PP YK  +  PP YK     PP YK 
Sbjct: 403 PSYPPTYKAKPRY-PTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKA 461

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
               PP YK     PP YK     P  YK        YK     PP YK     PP YK 
Sbjct: 462 KPSYPPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKA 521

Query: 377 PVEKPPVYK 403
               PP YK
Sbjct: 522 KPSYPPTYK 530

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 58/144 (40%), Positives = 61/144 (42%), Gaps = 15/144 (10%)
 Frame = +2

Query: 17  PVYKP------PVEK-PPEY-TPPIYKPPVEKPPVYKP--PVEKPPVYKPPVEKP----- 151
           PVYKP      P    PP Y +   Y P  +K   YKP           PPV KP     
Sbjct: 57  PVYKPVKTSYHPTNSYPPTYGSKTNYLPLAKKLSSYKPIKTTYNAKTNYPPVYKPKMTYP 116

Query: 152 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 331
           P YKP    PP YKP    P  YK     P  YKP    PP YKP +  PP YKP    P
Sbjct: 117 PTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYP 176

Query: 332 PVYKPPVEKPPVYKPPVEKPPVYK 403
           P YKP    P  YK     PP YK
Sbjct: 177 PTYKPKPSYPATYKSKSSYPPSYK 200

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 52/145 (35%), Positives = 53/145 (36%), Gaps = 15/145 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-----------TPPIYKPPVEK----PPVYKPPVEKPPVYKPPVEK 148
           PP YK     P  Y             P Y P  +     PP YK     PP YK     
Sbjct: 476 PPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 535

Query: 149 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
           PP YK     PP YK     P  YK     PP YK     PP YK     PP YK     
Sbjct: 536 PPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 595

Query: 329 PPVYKPPVEKPPVYKPPVEKPPVYK 403
           PP YK     PP YK     PP YK
Sbjct: 596 PPTYKAKPSYPPTYKAKPSYPPTYK 620

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/136 (37%), Positives = 54/136 (39%), Gaps = 6/136 (4%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPPIYKPPVEKPPVYKPPVEK-----PPVYKPPVEKPPVYKPPVE 175
           PP+YK     PP Y   P Y P  +  P Y PP  K     P  YK     PP YK    
Sbjct: 376 PPIYKAKPSYPPTYKAKPSYLPTYKAKPSY-PPTYKAKPRYPTTYKAKPSYPPTYKAKPS 434

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
            PP YK  +  PP YK     PP YK     PP YK     PP YK     P  YK    
Sbjct: 435 YPPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYKAKPS 494

Query: 356 KPPVYKPPVEKPPVYK 403
               YK     PP YK
Sbjct: 495 YSSTYKAKPSYPPTYK 510

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 46/122 (37%), Positives = 49/122 (40%), Gaps = 7/122 (5%)
 Frame = +2

Query: 62  PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP--PVEKPPVYKPPVE 235
           P+YKP       Y P    PP Y         Y P  +K   YKP           PPV 
Sbjct: 57  PVYKPVKTS---YHPTNSYPPTYGSKTN----YLPLAKKLSSYKPIKTTYNAKTNYPPVY 109

Query: 236 KP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 400
           KP     P YKP    PP YKP    P  YK     P  YKP    PP YKP +  PP Y
Sbjct: 110 KPKMTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPTYKPKLTYPPTY 169

Query: 401 KP 406
           KP
Sbjct: 170 KP 171

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 44/123 (35%), Positives = 46/123 (37%), Gaps = 7/123 (5%)
 Frame = +2

Query: 59  PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP--PV 232
           P  Y    +  PVYKP       Y P    PP Y         Y P  +K   YKP    
Sbjct: 46  PNAYPYGTKHGPVYKPVKTS---YHPTNSYPPTYGSKTN----YLPLAKKLSSYKPIKTT 98

Query: 233 EKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 397
                  PPV KP     P YKP    PP YKP    P  YK     P  YKP    PP 
Sbjct: 99  YNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPT 158

Query: 398 YKP 406
           YKP
Sbjct: 159 YKP 161

[101][TOP]
>UniRef100_C5V8E8 Iron-sulphur-binding reductase n=1 Tax=Corynebacterium matruchotii
            ATCC 14266 RepID=C5V8E8_9CORY
          Length = 1034

 Score =  119 bits (298), Expect = 1e-25
 Identities = 61/135 (45%), Positives = 69/135 (51%), Gaps = 10/135 (7%)
 Frame = +2

Query: 32   PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYK-------PPVEKPPVYKPPVEKPPVY 190
            P    P+ TPP   PP  +PPV +PP    P          P    P    P   +PPV 
Sbjct: 885  PPAAMPKATPPKAAPPTAQPPVARPPAATAPTAPAAPGGSVPKTVAPGATIPGTARPPVA 944

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPVEKP 361
            KPP   PP  KPP   PPV KPP   PP   PP  +P   PV KPP  KPPV +PPV KP
Sbjct: 945  KPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVAKP 1004

Query: 362  PVYKPPVEKPPVYKP 406
            PV KPP+ KPP+  P
Sbjct: 1005 PVAKPPMAKPPMVPP 1019

 Score =  114 bits (286), Expect = 3e-24
 Identities = 60/136 (44%), Positives = 68/136 (50%), Gaps = 15/136 (11%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEK------------PPVYKPPVEKPPV 157
            PP   P    PP+  PP  +PPV +PP    P               P    P   +PPV
Sbjct: 885  PPAAMPKAT-PPKAAPPTAQPPVARPPAATAPTAPAAPGGSVPKTVAPGATIPGTARPPV 943

Query: 158  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPVEK 328
             KPP   PP  KPP   PPV KPP   PP   PP  +P   PV KPP  KPPV +PPV K
Sbjct: 944  AKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVAK 1003

Query: 329  PPVYKPPVEKPPVYKP 376
            PPV KPP+ KPP+  P
Sbjct: 1004 PPVAKPPMAKPPMVPP 1019

 Score =  111 bits (278), Expect = 2e-23
 Identities = 64/162 (39%), Positives = 70/162 (43%), Gaps = 30/162 (18%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
            PP   PP  +P   TPP    P    P    P    P   PP   PP  +PPV +PP   
Sbjct: 854  PPGATPPGGRPATPTPPGVAVPGAAAPGSAVPPAAMPKATPPKAAPPTAQPPVARPPAAT 913

Query: 194  PPVE----------------------KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 307
             P                        +PPV KPP   PP  KPP   PPV KPP   PP 
Sbjct: 914  APTAPAAPGGSVPKTVAPGATIPGTARPPVAKPPAPTPPTAKPPAAAPPVAKPPTATPPG 973

Query: 308  YKP--------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
              P        PV KPP  KPPV +PPV KPPV KPP+ KPP
Sbjct: 974  AMPPGSRPAASPVAKPPAAKPPVAQPPVAKPPVAKPPMAKPP 1015

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/82 (53%), Positives = 49/82 (59%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PPV KPP   PP   PP   PPV KPP   PP   PP  +P     PV KPP  KPPV 
Sbjct: 940  RPPVAKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAAS--PVAKPPAAKPPVA 997

Query: 191  KPPVEKPPVYKPPVEKPPVYKP 256
            +PPV KPPV KPP+ KPP+  P
Sbjct: 998  QPPVAKPPVAKPPMAKPPMVPP 1019

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 42/77 (54%), Positives = 47/77 (61%), Gaps = 3/77 (3%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPVE 175
            V KPP   PP  KPP   PP+ KPP   PP   PP  +P   PV KPP  KPPV +PPV 
Sbjct: 943  VAKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVA 1002

Query: 176  KPPVYKPPVEKPPVYKP 226
            KPPV KPP+ KPP+  P
Sbjct: 1003 KPPVAKPPMAKPPMVPP 1019

[102][TOP]
>UniRef100_A8WLZ2 Putative uncharacterized protein (Fragment) n=1 Tax=Caenorhabditis
           briggsae AF16 RepID=A8WLZ2_CAEBR
          Length = 1042

 Score =  119 bits (298), Expect = 1e-25
 Identities = 65/135 (48%), Positives = 78/135 (57%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE+ P    P+   PVE+ PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 224 VEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAP 283

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PVE+ PV+  PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 284 VKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 343

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV + P
Sbjct: 344 VEEKPVEAAPVEEKP 358

 Score =  116 bits (291), Expect = 7e-25
 Identities = 64/135 (47%), Positives = 77/135 (57%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE+ P    P+ + PVE  PV   PVE+ PV+  PVE  PV + PVE  P
Sbjct: 264 VEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAP 323

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ P
Sbjct: 324 VEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKP 383

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 384 VEAAPVEAAPVKEKP 398

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/135 (47%), Positives = 76/135 (56%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE       P+ + PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 204 VEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAP 263

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV + PVE  PV + PVE  PV   PVE+ PV+  PVE  PV + PVE  P
Sbjct: 264 VEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAP 323

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 324 VEAAPVEEKPVDAAP 338

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/135 (47%), Positives = 76/135 (56%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE   V   PVE+ P    P+ + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 214 VEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAP 273

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV + PVE  PV   PVE+ PV+  PVE  PV + PVE  PV   PVE+ P
Sbjct: 274 VEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKP 333

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 334 VDAAPVEAAPVEEKP 348

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/135 (47%), Positives = 76/135 (56%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+ + PVE  PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 244 VEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKP 303

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V+  PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE   
Sbjct: 304 VHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQ 363

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 364 VEAAPVEEKPVEAAP 378

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/135 (47%), Positives = 76/135 (56%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P    P+ + PVE  PV + PVE  PV   PVE+ PV+  PVE  P
Sbjct: 254 VEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAP 313

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE   V   PVE+ P
Sbjct: 314 VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKP 373

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 374 VEAAPVEEKPVEAAP 388

 Score =  115 bits (288), Expect = 2e-24
 Identities = 64/136 (47%), Positives = 75/136 (55%)
 Frame = +2

Query: 2    RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
            +VE  PV + PVE  P    P+ + PVE  PV   PVE+ PV   PVE  PV   PVE+ 
Sbjct: 621  KVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEK 680

Query: 182  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
            PV   P E  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   PVE+ 
Sbjct: 681  PVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEK 740

Query: 362  PVYKPPVEKPPVYKPP 409
            PV   PVE+ PV   P
Sbjct: 741  PVEAAPVEEKPVEAAP 756

 Score =  115 bits (287), Expect = 2e-24
 Identities = 64/136 (47%), Positives = 76/136 (55%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           +VE  PV + PVE  P    P+    VE  PV + PVE  PV + PVE  PV   PVE+ 
Sbjct: 193 QVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEK 252

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV   PVE  PV + PVE  PV + PVE  PV + PVE  PV   PVE+ PV+  PVE  
Sbjct: 253 PVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAA 312

Query: 362 PVYKPPVEKPPVYKPP 409
           PV + PVE  PV   P
Sbjct: 313 PVKEKPVEAAPVEAAP 328

 Score =  114 bits (286), Expect = 3e-24
 Identities = 64/135 (47%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE+ P    P+   PVE+ PV   PVE  PV   PVE+ PV   P E  P
Sbjct: 632  VEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAP 691

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE+ P
Sbjct: 692  VEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKP 751

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 752  VEAAPVEAAPVKEKP 766

 Score =  114 bits (286), Expect = 3e-24
 Identities = 64/135 (47%), Positives = 75/135 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+ + PVE  PV   PVE+ PV   PVE  PV   PVE+ P
Sbjct: 672  VEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKP 731

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 732  VDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 791

Query: 365  VYKPPVEKPPVYKPP 409
            V + PV+  PV   P
Sbjct: 792  VEEKPVDAAPVEAAP 806

 Score =  114 bits (285), Expect = 3e-24
 Identities = 64/135 (47%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE  P    P+   PVE  PV + PVE  PV + PVE  PV + PVE  P
Sbjct: 234 VEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAP 293

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV+  PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 294 VEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAP 353

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE   V   P
Sbjct: 354 VEEKPVEAAQVEAAP 368

 Score =  114 bits (285), Expect = 3e-24
 Identities = 63/135 (46%), Positives = 76/135 (56%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PV++ P    P+   PVE+ PV+  PVE  PV + PVE  PV   PVE+ P
Sbjct: 274 VEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKP 333

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 334 VDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 393

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 394 VKEKPVEAAPVEAAP 408

 Score =  114 bits (285), Expect = 3e-24
 Identities = 64/135 (47%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+   PVE+ PV   P E  PV + PVE  PV   PVE+ P
Sbjct: 652  VEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETP 711

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 712  VEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 771

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 772  VEAAPVEEKPVDAAP 786

 Score =  113 bits (283), Expect = 6e-24
 Identities = 64/135 (47%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+   PVE  PV   PVE+ PV   P E  PV + PVE  P
Sbjct: 642  VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAP 701

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 702  VEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAP 761

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV   P
Sbjct: 762  VKEKPVEAAPVEAAP 776

 Score =  113 bits (282), Expect = 8e-24
 Identities = 64/135 (47%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE  P    P+   P E  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 662  VEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAP 721

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 722  VEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 781

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 782  VDAAPVEAAPVEEKP 796

 Score =  112 bits (281), Expect = 1e-23
 Identities = 63/135 (46%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V++ PV   PVE  P    P++  PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 284 VKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 343

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 344 VEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 403

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 404 VEAAPVEEKPVDAAP 418

 Score =  112 bits (281), Expect = 1e-23
 Identities = 63/135 (46%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+   PVE  PV + PVE  PV   PVE  PV + PVE  P
Sbjct: 627  VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAP 686

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
                PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PV+  PV + PVE  P
Sbjct: 687  FEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAP 746

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV   P
Sbjct: 747  VEEKPVEAAPVEAAP 761

 Score =  112 bits (280), Expect = 1e-23
 Identities = 62/135 (45%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+ + PVE  PV   PVE  PV + PVE  P    PVE+ P
Sbjct: 637  VEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKP 696

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PVE  PV + PV+  PV + PVE  PV + PVE  P
Sbjct: 697  VEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAP 756

Query: 365  VYKPPVEKPPVYKPP 409
            V   PV++ PV   P
Sbjct: 757  VEAAPVKEKPVEAAP 771

 Score =  112 bits (280), Expect = 1e-23
 Identities = 62/135 (45%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE+ P    P+   PVE  PV + PVE  P    PVE+ PV   PVE  P
Sbjct: 647  VEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAP 706

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE  PV + PV+  PV + PVE  PV + PVE  PV   PV++ P
Sbjct: 707  VEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKP 766

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 767  VEAAPVEAAPVEEKP 781

 Score =  112 bits (279), Expect = 2e-23
 Identities = 63/135 (46%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P     +   PVE+ PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 174 VEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAP 233

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV + PVE  P
Sbjct: 234 VEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAP 293

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV+  P
Sbjct: 294 VEAAPVEEKPVHAAP 308

 Score =  112 bits (279), Expect = 2e-23
 Identities = 63/135 (46%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV    VE  P    P+   PVE+ PV    VE  PV + PVE  PV + PVE  P
Sbjct: 184 VEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAP 243

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE  PV + PVE  PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 244 VEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKP 303

Query: 365 VYKPPVEKPPVYKPP 409
           V+  PVE  PV + P
Sbjct: 304 VHAAPVEAAPVKEKP 318

 Score =  111 bits (278), Expect = 2e-23
 Identities = 62/135 (45%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE+ P    P    PVE+ PV   PVE  PV + PVE  PV   PVE  P
Sbjct: 667  VEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAP 726

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PV+  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 727  VEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 786

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 787  VEAAPVEEKPVDAAP 801

 Score =  111 bits (277), Expect = 3e-23
 Identities = 61/135 (45%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+ + PVE  P    PVE+ PV   PVE  PV + PVE  P
Sbjct: 657  VEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAP 716

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PV+  PV + PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 717  VEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 776

Query: 365  VYKPPVEKPPVYKPP 409
            V + PV+  PV   P
Sbjct: 777  VEEKPVDAAPVEAAP 791

 Score =  110 bits (276), Expect = 4e-23
 Identities = 62/135 (45%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE   V   PVE+ P    P+   PVE+ PV   PVE  PV + PVE  PV   PVE  P
Sbjct: 617  VEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAP 676

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  P    PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PV+  P
Sbjct: 677  VEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAP 736

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV + P
Sbjct: 737  VEEKPVEAAPVEEKP 751

 Score =  110 bits (276), Expect = 4e-23
 Identities = 63/135 (46%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+   PVE  PV   PVE+ PV   PVE+ PV   PVE+ P
Sbjct: 692  VEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKP 751

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   PVE   
Sbjct: 752  VEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQ 811

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 812  VEAAPVEEKPVEAAP 826

 Score =  110 bits (276), Expect = 4e-23
 Identities = 62/131 (47%), Positives = 73/131 (55%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+   PVE+ PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 702  VEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAP 761

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   PVE   V   PVE+ P
Sbjct: 762  VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKP 821

Query: 365  VYKPPVEKPPV 397
            V   PVE+ PV
Sbjct: 822  VEAAPVEEKPV 832

 Score =  110 bits (275), Expect = 5e-23
 Identities = 63/135 (46%), Positives = 72/135 (53%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV    VE  P    P+   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 612  VEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 671

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   P E  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ P
Sbjct: 672  VEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKP 731

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 732  VDAAPVEEKPVEAAP 746

 Score =  110 bits (274), Expect = 6e-23
 Identities = 60/135 (44%), Positives = 75/135 (55%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P +  P+   PV++ PV   PVE  PV + PV+  PV   PVE+ P
Sbjct: 289 VEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKP 348

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV    VE  PV + PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 349 VEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 408

Query: 365 VYKPPVEKPPVYKPP 409
           V + PV+  PV   P
Sbjct: 409 VEEKPVDAAPVEAAP 423

 Score =  110 bits (274), Expect = 6e-23
 Identities = 62/131 (47%), Positives = 72/131 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PV   P    P+ + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 294 VEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAP 353

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 354 VEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 413

Query: 365 VYKPPVEKPPV 397
           V   PVE  PV
Sbjct: 414 VDAAPVEAAPV 424

 Score =  109 bits (273), Expect = 8e-23
 Identities = 61/135 (45%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V+  PV + PVE       P+ + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 607  VDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 666

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PVE  P    PVE+ PV   PVE  PV + PVE  PV   PVE  P
Sbjct: 667  VEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAP 726

Query: 365  VYKPPVEKPPVYKPP 409
            V + PV+  PV + P
Sbjct: 727  VEEKPVDAAPVEEKP 741

 Score =  109 bits (273), Expect = 8e-23
 Identities = 61/135 (45%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE+ P    P+   PVE  PV + PV+  PV + PVE  PV + PVE  P
Sbjct: 697  VEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAP 756

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PV++ PV   PVE  PV + PV+  PV   PVE+ PV   PVE  PV    VE  P
Sbjct: 757  VEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAP 816

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV + P
Sbjct: 817  VEEKPVEAAPVEEKP 831

 Score =  109 bits (272), Expect = 1e-22
 Identities = 62/135 (45%), Positives = 72/135 (53%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  P    PVE+ P    P+   PVE+ PV   PVE  PV   PVE+ PV   PVE+ P
Sbjct: 682  VEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKP 741

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV+  P
Sbjct: 742  VEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAP 801

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE   V   P
Sbjct: 802  VEAAPVEAAQVEAAP 816

 Score =  108 bits (270), Expect = 2e-22
 Identities = 60/131 (45%), Positives = 72/131 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   P E  P    P+   PVE  PV + PVE  PV   PVE  PV + PV+  P
Sbjct: 677  VEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAP 736

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PVE+ P
Sbjct: 737  VEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKP 796

Query: 365  VYKPPVEKPPV 397
            V   PVE  PV
Sbjct: 797  VDAAPVEAAPV 807

 Score =  108 bits (269), Expect = 2e-22
 Identities = 62/136 (45%), Positives = 74/136 (54%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           +VE  PV   PVE  P    P+    VE  PV + PVE  PV + PVE   V   PVE+ 
Sbjct: 168 QVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEK 227

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PV++ 
Sbjct: 228 PVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEK 287

Query: 362 PVYKPPVEKPPVYKPP 409
           PV   PVE  PV + P
Sbjct: 288 PVEAAPVEAAPVEEKP 303

 Score =  108 bits (269), Expect = 2e-22
 Identities = 62/135 (45%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V++ PV   PVE  P    P+   PVE  PV + PVE  PV + PVE   V   PVE+ P
Sbjct: 314 VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKP 373

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV    VE  P
Sbjct: 374 VEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAP 433

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV + P
Sbjct: 434 VEEKPVEAAPVEEKP 448

 Score =  108 bits (269), Expect = 2e-22
 Identities = 60/134 (44%), Positives = 73/134 (54%)
 Frame = +2

Query: 8    EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
            E  PV + PVE  P    P+ + PVE  PV   PVE  PV + PV+  PV + PVE  PV
Sbjct: 688  EAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPV 747

Query: 188  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
             + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PVE+ PV   PVE  PV
Sbjct: 748  EEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPV 807

Query: 368  YKPPVEKPPVYKPP 409
                VE  PV + P
Sbjct: 808  EAAQVEAAPVEEKP 821

 Score =  107 bits (268), Expect = 3e-22
 Identities = 61/131 (46%), Positives = 70/131 (53%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           PV   PVE+ P     +   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 606 PVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAA 665

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
           PVE  PV   PVE+ PV   P E  PV + PVE  PV   PVE+ PV   PVE  PV   
Sbjct: 666 PVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAA 725

Query: 377 PVEKPPVYKPP 409
           PVE+ PV   P
Sbjct: 726 PVEEKPVDAAP 736

 Score =  107 bits (267), Expect = 4e-22
 Identities = 62/135 (45%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE+ P     +   PVE  PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 149 VEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAP 208

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 209 VEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKP 268

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 269 VEAAPVEEKPVEAAP 283

 Score =  107 bits (267), Expect = 4e-22
 Identities = 60/135 (44%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV+  PVE  P    P+   PVE  PV + PV+  PV   PVE+ PV   PVE+ P
Sbjct: 299 VEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKP 358

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V    VE  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 359 VEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 418

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE   V   P
Sbjct: 419 VEAAPVEAAQVEAAP 433

 Score =  107 bits (267), Expect = 4e-22
 Identities = 62/135 (45%), Positives = 72/135 (53%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE  P    P+   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 712  VEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 771

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ P
Sbjct: 772  VEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKP 831

Query: 365  VYKPPVEKPPVYKPP 409
            V    VE  PV + P
Sbjct: 832  VDAAQVEAAPVKEKP 846

 Score =  107 bits (266), Expect = 5e-22
 Identities = 60/135 (44%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+ + PV+  PV   PVE+ PV   PVE+ PV    VE  P
Sbjct: 309 VEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAP 368

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PVE   
Sbjct: 369 VEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQ 428

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 429 VEAAPVEEKPVEAAP 443

 Score =  107 bits (266), Expect = 5e-22
 Identities = 61/135 (45%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+ + PVE  PV   PVE+ PV   PVE  PV + PV+  P
Sbjct: 742  VEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAP 801

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV   PV++ P
Sbjct: 802  VEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKP 861

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 862  VEAAPVEEKPVDAAP 876

 Score =  106 bits (265), Expect = 7e-22
 Identities = 61/135 (45%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE       P+   PVE  PV + PV+   V   PVE+ PV   PVE+ P
Sbjct: 154 VEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKP 213

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V    VE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 214 VEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAP 273

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV + P
Sbjct: 274 VEEKPVEAAPVKEKP 288

 Score =  106 bits (265), Expect = 7e-22
 Identities = 63/138 (45%), Positives = 74/138 (53%), Gaps = 4/138 (2%)
 Frame = +2

Query: 8   EKP----PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 175
           EKP    PV   PV++ P    P+   PVE+ PV   PVE  PV + PVE  PV + PVE
Sbjct: 301 EKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVE 360

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
              V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE
Sbjct: 361 AAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVE 420

Query: 356 KPPVYKPPVEKPPVYKPP 409
             PV    VE  PV + P
Sbjct: 421 AAPVEAAQVEAAPVEEKP 438

 Score =  106 bits (265), Expect = 7e-22
 Identities = 60/131 (45%), Positives = 72/131 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P    P+   PVE+ PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 319 VEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAP 378

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PVE   V   PVE+ P
Sbjct: 379 VEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKP 438

Query: 365 VYKPPVEKPPV 397
           V   PVE+ PV
Sbjct: 439 VEAAPVEEKPV 449

 Score =  106 bits (265), Expect = 7e-22
 Identities = 60/135 (44%), Positives = 74/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE+ P    P+   PV++ PV   PVE  PV + PV+  PV   PVE   
Sbjct: 369 VEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQ 428

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV   PV++ PV   PVE+ P
Sbjct: 429 VEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKP 488

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 489 VDAAPVEAAPVEEKP 503

 Score =  106 bits (265), Expect = 7e-22
 Identities = 61/135 (45%), Positives = 72/135 (53%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PV+  P    P+   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 722  VEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 781

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ PV    VE  P
Sbjct: 782  VDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAP 841

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV   P
Sbjct: 842  VKEKPVEAAPVEAAP 856

 Score =  106 bits (264), Expect = 9e-22
 Identities = 61/135 (45%), Positives = 72/135 (53%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE   V   PVE  P    P+ + PV+   V   PVE+ PV   PVE+ PV    VE  P
Sbjct: 164 VEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAP 223

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 224 VEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAP 283

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 284 VKEKPVEAAPVEAAP 298

 Score =  106 bits (264), Expect = 9e-22
 Identities = 60/135 (44%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+ + PVE  PV   PVE+ PV   PVE  PV    VE  P
Sbjct: 374 VEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAP 433

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV + PV+   V   PV++ PV   PVE  PV + PVE  PV + PV+  P
Sbjct: 434 VEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAP 493

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 494 VEAAPVEEKPVDAAP 508

 Score =  105 bits (263), Expect = 1e-21
 Identities = 61/136 (44%), Positives = 73/136 (53%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           +VE  PV + PVE  P    P+    VE  PV   PVE  PV + PV+   V   PVE+ 
Sbjct: 143 QVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEK 202

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV   PVE+ PV    VE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  
Sbjct: 203 PVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAA 262

Query: 362 PVYKPPVEKPPVYKPP 409
           PV + PVE  PV + P
Sbjct: 263 PVEEKPVEAAPVEEKP 278

 Score =  105 bits (263), Expect = 1e-21
 Identities = 61/135 (45%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV    VE  P    P+   PVE+ PV    VE  PV + PVE  PV + PVE   
Sbjct: 159 VEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQ 218

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE+ P
Sbjct: 219 VEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKP 278

Query: 365 VYKPPVEKPPVYKPP 409
           V   PV++ PV   P
Sbjct: 279 VEAAPVKEKPVEAAP 293

 Score =  105 bits (263), Expect = 1e-21
 Identities = 60/136 (44%), Positives = 73/136 (53%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           +VE  PV + PVE  P    P+   PVE  PV + PVE  PV   PVE+ PV   PVE  
Sbjct: 363 QVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAA 422

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV    VE  PV + PVE  PV + PV+   V   PV++ PV   PVE  PV + PVE  
Sbjct: 423 PVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAA 482

Query: 362 PVYKPPVEKPPVYKPP 409
           PV + PV+  PV   P
Sbjct: 483 PVEEKPVDAAPVEAAP 498

 Score =  105 bits (263), Expect = 1e-21
 Identities = 59/135 (43%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE+ P    P+   PV++ PV   PVE  PV + PV+  PV   PVE+ P
Sbjct: 737  VEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKP 796

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV    VE  PV + PVE  PV + PV+   V   PV++ PV   PVE  P
Sbjct: 797  VDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAP 856

Query: 365  VYKPPVEKPPVYKPP 409
            V + PVE  PV + P
Sbjct: 857  VKEKPVEAAPVEEKP 871

 Score =  105 bits (262), Expect = 2e-21
 Identities = 60/135 (44%), Positives = 73/135 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE+ P     +   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 344 VEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 403

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV+   V   PV++ P
Sbjct: 404 VEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKP 463

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 464 VEAAPVEAAPVKEKP 478

 Score =  105 bits (262), Expect = 2e-21
 Identities = 59/135 (43%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+ + PV+  PV + PVE  PV + PVE  PV   PV++ P
Sbjct: 707  VEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKP 766

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE  PV + PV+  PV   PVE+ PV   PVE  PV    VE  PV + PVE  P
Sbjct: 767  VEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAP 826

Query: 365  VYKPPVEKPPVYKPP 409
            V + PV+   V   P
Sbjct: 827  VEEKPVDAAQVEAAP 841

 Score =  105 bits (262), Expect = 2e-21
 Identities = 59/135 (43%), Positives = 74/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE+ P    P+ + PVE  PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 727  VEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 786

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV+   V   PV++ P
Sbjct: 787  VEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKP 846

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 847  VEAAPVEAAPVKEKP 861

 Score =  105 bits (262), Expect = 2e-21
 Identities = 60/135 (44%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PV++ P    P+   PVE+ PV   PVE  PV + PV+  PV   PVE   
Sbjct: 752  VEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQ 811

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV   PV++ PV   PVE+ P
Sbjct: 812  VEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKP 871

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE  PV + P
Sbjct: 872  VDAAPVEAAPVEEKP 886

 Score =  105 bits (261), Expect = 2e-21
 Identities = 60/135 (44%), Positives = 72/135 (53%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PV+  P    P+ + PVE  PV + PVE   V   PVE+ PV   PVE+ P
Sbjct: 324 VEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKP 383

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PVE  PV   PVE+ PV   PVE  PV    VE  PV + PVE  P
Sbjct: 384 VEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAP 443

Query: 365 VYKPPVEKPPVYKPP 409
           V + PV+   V   P
Sbjct: 444 VEEKPVDAAQVEAAP 458

 Score =  105 bits (261), Expect = 2e-21
 Identities = 60/135 (44%), Positives = 72/135 (53%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V+  PV + PVE  P    P+   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 732  VDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 791

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PV+  PV   PVE   V   PVE+ PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 792  VEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAP 851

Query: 365  VYKPPVEKPPVYKPP 409
            V   PV++ PV   P
Sbjct: 852  VEAAPVKEKPVEAAP 866

 Score =  105 bits (261), Expect = 2e-21
 Identities = 59/135 (43%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV + PVE  P    P+ + PV+  PV   PVE+ PV   PVE  PV    VE  P
Sbjct: 757  VEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAP 816

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PVE  PV + PV+   V   PV++ PV   PVE  PV + PVE  PV + PV+  P
Sbjct: 817  VEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAP 876

Query: 365  VYKPPVEKPPVYKPP 409
            V   PVE+ PV   P
Sbjct: 877  VEAAPVEEKPVDAAP 891

 Score =  104 bits (260), Expect = 3e-21
 Identities = 59/135 (43%), Positives = 73/135 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE  PV   PVE+ P    P+ + PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 717  VEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 776

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V + PV+  PV   PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV+   
Sbjct: 777  VEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQ 836

Query: 365  VYKPPVEKPPVYKPP 409
            V   PV++ PV   P
Sbjct: 837  VEAAPVKEKPVEAAP 851

 Score =  104 bits (259), Expect = 4e-21
 Identities = 60/135 (44%), Positives = 72/135 (53%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV    VE  P    P+   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 354 VEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 413

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV    VE  PV + PVE  PV + PV+   V   PV++ PV   PVE  P
Sbjct: 414 VDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAP 473

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV + P
Sbjct: 474 VKEKPVEAAPVEEKP 488

 Score =  104 bits (259), Expect = 4e-21
 Identities = 59/135 (43%), Positives = 72/135 (53%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            VE+ PV   PVE  P    P+   PVE  PV + PV+  PV   PVE+ PV   PVE  P
Sbjct: 747  VEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAP 806

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V    VE  PV + PVE  PV + PV+   V   PV++ PV   PVE  PV + PVE  P
Sbjct: 807  VEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAP 866

Query: 365  VYKPPVEKPPVYKPP 409
            V + PV+  PV   P
Sbjct: 867  VEEKPVDAAPVEAAP 881

 Score =  103 bits (258), Expect = 5e-21
 Identities = 60/135 (44%), Positives = 72/135 (53%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE  P    P+   PVE+ PV    VE  PV + PVE  PV + PVE  P
Sbjct: 329 VEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAP 388

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PV++ PV   PVE  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ P
Sbjct: 389 VEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKP 448

Query: 365 VYKPPVEKPPVYKPP 409
           V    VE  PV + P
Sbjct: 449 VDAAQVEAAPVKEKP 463

 Score =  103 bits (257), Expect = 6e-21
 Identities = 59/135 (43%), Positives = 72/135 (53%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V+  PV   PVE+ P    P+ + PVE   V   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 334 VDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 393

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV   PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV+   
Sbjct: 394 VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQ 453

Query: 365 VYKPPVEKPPVYKPP 409
           V   PV++ PV   P
Sbjct: 454 VEAAPVKEKPVEAAP 468

 Score =  103 bits (257), Expect = 6e-21
 Identities = 60/135 (44%), Positives = 71/135 (52%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+    VE  PV + PVE  PV + PVE  PV   PV++ P
Sbjct: 339 VEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKP 398

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ PV    VE  P
Sbjct: 399 VEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAP 458

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 459 VKEKPVEAAPVEAAP 473

 Score =  103 bits (256), Expect = 8e-21
 Identities = 61/136 (44%), Positives = 72/136 (52%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           +VE  PV + PVE  P    P+    VE  PV + PVE  PV + PVE   V   PVE  
Sbjct: 118 QVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAK 177

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV   PVE+ PV    VE  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ 
Sbjct: 178 PVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEK 237

Query: 362 PVYKPPVEKPPVYKPP 409
           PV   PVE  PV + P
Sbjct: 238 PVEAAPVEAAPVEEKP 253

 Score =  103 bits (256), Expect = 8e-21
 Identities = 59/135 (43%), Positives = 72/135 (53%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE       P+ + PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 349 VEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 408

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PV+  PV   PVE   V   PVE+ PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 409 VEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAP 468

Query: 365 VYKPPVEKPPVYKPP 409
           V   PV++ PV   P
Sbjct: 469 VEAAPVKEKPVEAAP 483

 Score =  102 bits (255), Expect = 1e-20
 Identities = 60/135 (44%), Positives = 72/135 (53%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE+ P     +   PVE+ PV   PVE+ PV    VE  PV   PVE  P
Sbjct: 124 VEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAP 183

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PV+   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PVE  P
Sbjct: 184 VEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAP 243

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 244 VEAAPVEEKPVEVAP 258

 Score =  102 bits (255), Expect = 1e-20
 Identities = 59/135 (43%), Positives = 72/135 (53%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE   V   PVE+ P    P+ + PVE  PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 359 VEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 418

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV   PV++ P
Sbjct: 419 VEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKP 478

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 479 VEAAPVEEKPVDAAP 493

 Score =  102 bits (255), Expect = 1e-20
 Identities = 58/131 (44%), Positives = 71/131 (54%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE  P    P+   PVE  PV + PV+  PV   PVE   V   PVE+ P
Sbjct: 379 VEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKP 438

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV    VE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  P
Sbjct: 439 VEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAP 498

Query: 365 VYKPPVEKPPV 397
           V + PV+  P+
Sbjct: 499 VEEKPVDAAPL 509

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/135 (44%), Positives = 71/135 (52%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V+   V   PVE+ P    P+ + PVE   V   PVE  PV   PVE+ PV    VE  P
Sbjct: 139 VDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAP 198

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 199 VEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAP 258

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 259 VEAAPVEEKPVEAAP 273

 Score =  102 bits (253), Expect = 2e-20
 Identities = 60/135 (44%), Positives = 71/135 (52%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PV+       P+ + PVE  PV + PVE   V   PVE  PV   PVE+ P
Sbjct: 129 VEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKP 188

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V    VE  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 189 VDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 248

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 249 VEEKPVEVAPVEAAP 263

 Score =  102 bits (253), Expect = 2e-20
 Identities = 60/135 (44%), Positives = 71/135 (52%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV    VE  P    P+   PVE+ PV    VE  PV   PVE  PV + PV+   
Sbjct: 134 VEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQ 193

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 194 VEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 253

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV + P
Sbjct: 254 VEVAPVEAAPVEEKP 268

 Score =  101 bits (251), Expect = 3e-20
 Identities = 61/136 (44%), Positives = 72/136 (52%), Gaps = 2/136 (1%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK--P 181
           E+ PV   PVE+ P    P+ + PVE  PV + PVE  PV    VE+  V   PVE    
Sbjct: 546 EEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALK 605

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           PV   PVE+ PV    VE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  
Sbjct: 606 PVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAA 665

Query: 362 PVYKPPVEKPPVYKPP 409
           PV   PVE  PV + P
Sbjct: 666 PVEAAPVEAAPVEEKP 681

 Score =  100 bits (250), Expect = 4e-20
 Identities = 57/131 (43%), Positives = 71/131 (54%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            V++ PV   PVE  P    P+   PVE  PV + PV+  PV   PVE   V   PVE+ P
Sbjct: 762  VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKP 821

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE+ PV    VE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  P
Sbjct: 822  VEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAP 881

Query: 365  VYKPPVEKPPV 397
            V + PV+  P+
Sbjct: 882  VEEKPVDAAPL 892

 Score =  100 bits (248), Expect = 7e-20
 Identities = 60/135 (44%), Positives = 70/135 (51%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE  P    P+ + PVE   V   PVE+ PV   PVE+ PV    VE  P
Sbjct: 89  VEAAPVEEEPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAP 148

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE  PV + PVE   V   PVE  PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 149 VEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAP 208

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE   V   P
Sbjct: 209 VEEKPVEAAQVEAAP 223

 Score =  100 bits (248), Expect = 7e-20
 Identities = 60/135 (44%), Positives = 70/135 (51%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE+ P     +   PVE+ PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 99  VEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAP 158

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PVE   V   PVE  PV   PVE+ PV    VE  PV + PVE  PV + PVE   
Sbjct: 159 VEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQ 218

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 219 VEAAPVEEKPVEAAP 233

 Score =  100 bits (248), Expect = 7e-20
 Identities = 61/137 (44%), Positives = 71/137 (51%), Gaps = 2/137 (1%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEK 178
           VE  PV + PVE  P    P+   PVE+ PV   PVE   V +  VE  PV     PV+ 
Sbjct: 550 VEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALKPVDA 609

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
            PV + PVE   V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE 
Sbjct: 610 APVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEA 669

Query: 359 PPVYKPPVEKPPVYKPP 409
            PV   PVE+ PV   P
Sbjct: 670 APVEAAPVEEKPVEAAP 686

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 57/130 (43%), Positives = 70/130 (53%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           E+ PV   PVE+ P    P+   PVE+ PV    VE  PV + PVE  PV + PV+   V
Sbjct: 85  EEKPVEAAPVEEEPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQV 144

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
              PVE+ PV   PVE+ PV    VE  PV   PVE  PV + PV+   V   PVE+ PV
Sbjct: 145 EAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPV 204

Query: 368 YKPPVEKPPV 397
              PVE+ PV
Sbjct: 205 EAAPVEEKPV 214

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 60/135 (44%), Positives = 70/135 (51%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV    VE  P    P+   PVE+ PV    VE  PV + PVE  PV + PVE   
Sbjct: 109 VEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQ 168

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV   PVE+ PV    VE  PV + PVE  PV + PVE   V   PVE+ P
Sbjct: 169 VEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKP 228

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 229 VEAAPVEEKPVEAAP 243

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 58/135 (42%), Positives = 71/135 (52%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV + PVE       P+ + PVE  PV + PV+   V   PVE+ PV   PVE+ P
Sbjct: 104 VEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKP 163

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V    VE  PV   PVE  PV + PV+   V   PVE+ PV   PVE+ PV    VE  P
Sbjct: 164 VEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAP 223

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV + P
Sbjct: 224 VEEKPVEAAPVEEKP 238

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 58/135 (42%), Positives = 70/135 (51%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE   V   PVE+ P    P+ + PV+   V   PVE+ PV   PVE+ PV    VE  P
Sbjct: 114 VEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAP 173

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV + PV+   V   PVE+ PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 174 VEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAP 233

Query: 365 VYKPPVEKPPVYKPP 409
           V + PVE  PV   P
Sbjct: 234 VEEKPVEAAPVEAAP 248

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 58/135 (42%), Positives = 70/135 (51%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE+ PV   PVE  P    P+    VE  PV + PVE  PV + PV+   V   PVE+ P
Sbjct: 94  VEEEPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKP 153

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE+ PV    VE  PV   PVE  PV + PV+   V   PVE+ PV   PVE+ P
Sbjct: 154 VEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKP 213

Query: 365 VYKPPVEKPPVYKPP 409
           V    VE  PV + P
Sbjct: 214 VEAAQVEAAPVEEKP 228

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 64/143 (44%), Positives = 74/143 (51%), Gaps = 7/143 (4%)
 Frame = +2

Query: 2    RVEKPPVYKPPVEKP--PEYTPPIYKPPVEKPPVYKPPVE-KP----PVYKPPVEKPPVY 160
            +VE+  V   PVE    P    P+ + PVE   V   PVE KP    PV   PVE+ PV 
Sbjct: 589  KVEEKSVEAVPVEAALKPVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVE 648

Query: 161  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
              PVE  PV + PVE  PV   PVE  PV + PVE  P    PVE+ PV   PVE  PV 
Sbjct: 649  AAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVE 708

Query: 341  KPPVEKPPVYKPPVEKPPVYKPP 409
            + PVE  PV   PVE  PV + P
Sbjct: 709  ETPVEAAPVEAAPVEAAPVEEKP 731

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 57/126 (45%), Positives = 66/126 (52%)
 Frame = +2

Query: 32  PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 211
           PVE  P    P+   PVE  PV + PVE   V   PVE+ PV   PVE+ PV    VE  
Sbjct: 88  PVEAAPVEEEPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAA 147

Query: 212 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 391
           PV + PVE  PV + PVE   V   PVE  PV   PVE+ PV    VE  PV + PVE  
Sbjct: 148 PVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAA 207

Query: 392 PVYKPP 409
           PV + P
Sbjct: 208 PVEEKP 213

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 56/135 (41%), Positives = 69/135 (51%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           + + P      EKP E   P+ + PVE  PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 75  ISRIPQISVTEEKPVE-AAPVEEEPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAP 133

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V + PV+   V   PVE+ PV   PVE+ PV    VE  PV   PVE  PV + PV+   
Sbjct: 134 VEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQ 193

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE+ PV   P
Sbjct: 194 VEAAPVEEKPVEAAP 208

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 51/111 (45%), Positives = 60/111 (54%)
 Frame = +2

Query: 62   PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 241
            P+   PVE+ PV   PVE+ PV   PVE+ PV   PVE   V +  VE  PV    VE+ 
Sbjct: 932  PVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALVEEK 991

Query: 242  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 394
            PV   PVE+ PV    VE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 992  PVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 1042

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 51/111 (45%), Positives = 60/111 (54%)
 Frame = +2

Query: 77   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 256
            PVE  PV + PVE  PV + PVE  PV + PVE  PV    VE+  V   PVE   V + 
Sbjct: 932  PVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALVEEK 991

Query: 257  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PV+  PV + PVE   V   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 992  PVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 1042

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 59/172 (34%), Positives = 74/172 (43%), Gaps = 36/172 (20%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           +VE  PV + PVE  P    P+    VE  PV + PVE  PV   PV++ PV   PVE+ 
Sbjct: 428 QVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEK 487

Query: 182 PVYKPPVEKPPVYKPPVEKPPVY------------------------------------K 253
           PV   PVE  PV + PV+  P+                                     +
Sbjct: 488 PVDAAPVEAAPVEEKPVDAAPLVFSKAEIFCGLELDLLMESSEFIEGNISRIPQISVTEE 547

Query: 254 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            PVE  PV + PVE  PV + PVE  PV + PVE  PV    VE+  V   P
Sbjct: 548 KPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVP 599

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 59/172 (34%), Positives = 74/172 (43%), Gaps = 36/172 (20%)
 Frame = +2

Query: 2    RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
            +VE  PV + PVE  P    P+    VE  PV + PVE  PV   PV++ PV   PVE+ 
Sbjct: 811  QVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEK 870

Query: 182  PVYKPPVEKPPVYKPPVEKPPVY------------------------------------K 253
            PV   PVE  PV + PV+  P+                                     +
Sbjct: 871  PVDAAPVEAAPVEEKPVDAAPLVFSKAETFCGLELDLLMESSEFIEGNISRIPQISVTEE 930

Query: 254  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
             PVE  PV + PVE  PV + PVE  PV + PVE  PV    VE+  V   P
Sbjct: 931  KPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVP 982

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 52/125 (41%), Positives = 64/125 (51%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
            + + P      EKP E   P+ + PVE  PV + PVE  PV + PVE  PV    VE+  
Sbjct: 919  ISRIPQISVTEEKPVE-AAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKS 977

Query: 185  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
            V   PVE   V + PV+  PV + PVE   V   PVE+ PV   PVE  PV + PVE  P
Sbjct: 978  VEAVPVEAALVEEKPVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 1037

Query: 365  VYKPP 379
            V   P
Sbjct: 1038 VEAAP 1042

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 50/109 (45%), Positives = 59/109 (54%)
 Frame = +2

Query: 83   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 262
            E+ PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE   V +  VE  PV    V
Sbjct: 929  EEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALV 988

Query: 263  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            E+ PV   PVE+ PV    VE  PV + PVE  PV   PVE+ PV   P
Sbjct: 989  EEKPVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 1037

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 61/176 (34%), Positives = 76/176 (43%), Gaps = 41/176 (23%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVE-KP----PVYKPPVEKPPVYKPPVEKPPVYKPP 169
           VE+ PV   PVE  P     +   PVE KP    PV + PV+   V   PV++ PV   P
Sbjct: 409 VEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAP 468

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV------------------- 292
           VE  PV + PVE  PV + PV+  PV   PVE+ PV   P+                   
Sbjct: 469 VEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPLVFSKAEIFCGLELDLLMES 528

Query: 293 -----------------EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
                            E+ PV   PVE+ PV   PVE+ PV   PVE+ PV   P
Sbjct: 529 SEFIEGNISRIPQISVTEEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAP 584

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 61/176 (34%), Positives = 76/176 (43%), Gaps = 41/176 (23%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVE-KP----PVYKPPVEKPPVYKPPVEKPPVYKPP 169
            VE+ PV   PVE  P     +   PVE KP    PV + PV+   V   PV++ PV   P
Sbjct: 792  VEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAP 851

Query: 170  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV------------------- 292
            VE  PV + PVE  PV + PV+  PV   PVE+ PV   P+                   
Sbjct: 852  VEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPLVFSKAETFCGLELDLLMES 911

Query: 293  -----------------EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
                             E+ PV   PVE+ PV   PVE+ PV   PVE+ PV   P
Sbjct: 912  SEFIEGNISRIPQISVTEEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAP 967

[103][TOP]
>UniRef100_A6LW67 Cytochrome b5 n=1 Tax=Clostridium beijerinckii NCIMB 8052
           RepID=A6LW67_CLOB8
          Length = 325

 Score =  119 bits (297), Expect = 1e-25
 Identities = 60/121 (49%), Positives = 82/121 (67%)
 Frame = -1

Query: 378 GGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFST 199
           GG  TGG + GG+ TGG + GG+ TGG ++GG+ TGG + GG+ TGG + GG+ TGG + 
Sbjct: 194 GGPSTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTG 253

Query: 198 GGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVYSGGFSTGGLYT 19
           GG+ TGG + GG+ TGG ++GG+ TGG ++GG+ TGG + GG   GG   GG  TGG   
Sbjct: 254 GGMGTGGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGGTTGGGMGTGGTTR 313

Query: 18  G 16
           G
Sbjct: 314 G 314

 Score =  118 bits (295), Expect = 2e-25
 Identities = 60/121 (49%), Positives = 84/121 (69%)
 Frame = -1

Query: 408 GGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFST 229
           GG  TGG + GG+ TGG + GG+ TGG ++GG+ TGG + GG+ TGG + GG+ TGG + 
Sbjct: 194 GGPSTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTG 253

Query: 228 GGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVYS 49
           GG+ TGG + GG+ TGG ++GG+ TGG ++GG+ TGG + GG  TGG + GG+  GG   
Sbjct: 254 GGMGTGGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGGTTGGGMGTGGTTR 313

Query: 48  G 46
           G
Sbjct: 314 G 314

 Score =  114 bits (286), Expect = 3e-24
 Identities = 61/121 (50%), Positives = 67/121 (55%)
 Frame = -1

Query: 393 GGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYT 214
           GG STGG   GG  TGG   GG  TGG  +GG  TGG   GG  TGG   GG  TGG   
Sbjct: 194 GGPSTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTG 253

Query: 213 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVYSGGFST 34
           GG  TGG   GG  TGG  +GG  TGG  +GG  TGG   GG  TGG   GG+ +GG + 
Sbjct: 254 GGMGTGGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGGTTGGGMGTGGTTR 313

Query: 33  G 31
           G
Sbjct: 314 G 314

 Score =  114 bits (286), Expect = 3e-24
 Identities = 60/117 (51%), Positives = 66/117 (56%)
 Frame = -1

Query: 363 GGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYT 184
           GG STGG   GG  TGG   GG  TGG  +GG  TGG   GG  TGG   GG  TGG   
Sbjct: 194 GGPSTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTG 253

Query: 183 GGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVYSGGFSTGGLYTGG 13
           GG  TGG   GG  TGG  +GG  TGG  +GG  TGG   GG  +GG + GG+ TGG
Sbjct: 254 GGMGTGGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGGTTGGGMGTGG 310

 Score =  114 bits (285), Expect = 3e-24
 Identities = 57/115 (49%), Positives = 78/115 (67%)
 Frame = -1

Query: 348 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFST 169
           GG  TGG + GG+ TGG + GG+ TGG ++GG+ TGG + GG+ TGG + GG+ TGG + 
Sbjct: 194 GGPSTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTG 253

Query: 168 GGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVYSGGFSTGGLYTGGFST 4
           GG+ TGG + GG+ TGG ++GG+ TGG ++GG+  GG   GG  TGG   GG  T
Sbjct: 254 GGMGTGGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGGTTGGGMGT 308

 Score =  111 bits (278), Expect = 2e-23
 Identities = 58/113 (51%), Positives = 61/113 (53%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TGG   GG  TGG   GG  TGG  +GG  TGG   GG  TGG   GG  TGG   GG  
Sbjct: 198 TGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMG 257

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGG 73
           TGG   GG  TGG  +GG  TGG  +GG  TGG   GG  TGG   GG  TGG
Sbjct: 258 TGGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGGTTGGGMGTGG 310

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = -1

Query: 336 TGGFSTGGL*TGGFST-GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGL 160
           TG  +  G  + G +T GG+ TGG + GG+ TGG ++GG+ TGG + GG+ TGG + GG+
Sbjct: 187 TGATTLLGGPSTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGM 246

Query: 159 YTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVYSGGFSTGGLYTGGFST 4
            TGG + GG+ TGG + GG+ TGG ++GG+  GG  SGG  TGG   GG  T
Sbjct: 247 GTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGT 298

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 49/97 (50%), Positives = 52/97 (53%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TGG  +GG  TGG   GG  TGG   GG  TGG   GG  TGG   GG  TGG  +GG  
Sbjct: 218 TGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGTGGTTSGGMG 277

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTG 121
           TGG  +GG  TGG   GG  TGG   GG  TGG   G
Sbjct: 278 TGGTTSGGMGTGGTTGGGTGTGGTTGGGMGTGGTTRG 314

[104][TOP]
>UniRef100_C0E650 Putative uncharacterized protein n=1 Tax=Corynebacterium matruchotii
            ATCC 33806 RepID=C0E650_9CORY
          Length = 1035

 Score =  119 bits (297), Expect = 1e-25
 Identities = 62/141 (43%), Positives = 69/141 (48%), Gaps = 10/141 (7%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYK-------PPVEKPPVYKPPV 172
            P    PP    P+ TPP    P  +PPV +PP    P          P    P    P  
Sbjct: 880  PGSVAPPAAATPKATPPKAALPKAQPPVARPPTATAPAVPAAPGGSVPKTVAPGAAIPGT 939

Query: 173  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYK 343
             +PPV KPP   PP  KPP   PPV KPP   PP   PP  +P   PV KPP  KPPV +
Sbjct: 940  ARPPVAKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQ 999

Query: 344  PPVEKPPVYKPPVEKPPVYKP 406
            PPV KPPV KPP+ KPP   P
Sbjct: 1000 PPVAKPPVAKPPMAKPPTIPP 1020

 Score =  102 bits (254), Expect = 1e-20
 Identities = 56/137 (40%), Positives = 61/137 (44%), Gaps = 5/137 (3%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPV 187
            P    P    P    PP    P   PP    P  +PPV +PP    P     P    P  
Sbjct: 870  PGTAVPGAAAPGSVAPPAAATPKATPPKAALPKAQPPVARPPTATAPAVPAAPGGSVPKT 929

Query: 188  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---PVEK 358
              P    P   +PPV KPP   PP  KPP   PPV KPP   PP   PP  +P   PV K
Sbjct: 930  VAPGAAIPGTARPPVAKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAK 989

Query: 359  PPVYKPPVEKPPVYKPP 409
            PP  KPPV +PPV KPP
Sbjct: 990  PPAAKPPVAQPPVAKPP 1006

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 44/82 (53%), Positives = 48/82 (58%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PPV KPP   PP   PP   PPV KPP   PP   PP  +P     PV KPP  KPPV 
Sbjct: 941  RPPVAKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAAS--PVAKPPAAKPPVA 998

Query: 191  KPPVEKPPVYKPPVEKPPVYKP 256
            +PPV KPPV KPP+ KPP   P
Sbjct: 999  QPPVAKPPVAKPPMAKPPTIPP 1020

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 42/77 (54%), Positives = 46/77 (59%), Gaps = 3/77 (3%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPVE 175
            V KPP   PP  KPP   PP+ KPP   PP   PP  +P   PV KPP  KPPV +PPV 
Sbjct: 944  VAKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVA 1003

Query: 176  KPPVYKPPVEKPPVYKP 226
            KPPV KPP+ KPP   P
Sbjct: 1004 KPPVAKPPMAKPPTIPP 1020

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/125 (36%), Positives = 50/125 (40%), Gaps = 3/125 (2%)
 Frame = +2

Query: 44   PPEYTPPIYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 220
            PP  TPP  +     PP    P    P    PP    P   PP    P  +PPV +PP  
Sbjct: 854  PPAATPPGARLATPTPPGTAVPGAAAPGSVAPPAAATPKATPPKAALPKAQPPVARPPTA 913

Query: 221  KPPV--EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 394
              P     P    P    P    P   +PPV KPP   PP  KPP   PPV KPP   PP
Sbjct: 914  TAPAVPAAPGGSVPKTVAPGAAIPGTARPPVAKPPAPTPPTAKPPAAAPPVAKPPTATPP 973

Query: 395  VYKPP 409
               PP
Sbjct: 974  GAMPP 978

[105][TOP]
>UniRef100_Q39864 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39864_SOYBN
          Length = 199

 Score =  119 bits (297), Expect = 1e-25
 Identities = 76/152 (50%), Positives = 77/152 (50%), Gaps = 22/152 (14%)
 Frame = +2

Query: 14  PPVYK----PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           PPVYK    PP  K P   PP YK P   PPVYK     PPVYK     PP YK P   P
Sbjct: 13  PPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK-SPPPPYKYPSPPP 71

Query: 182 PVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PP 319
           P YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PP
Sbjct: 72  PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 131

Query: 320 VEK----PPVYKPPVEKPPVYKPPVEKPPVYK 403
           V K    PP +K P   PP YK P   PPVYK
Sbjct: 132 VYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYK 163

 Score =  117 bits (294), Expect = 3e-25
 Identities = 75/152 (49%), Positives = 76/152 (50%), Gaps = 22/152 (14%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT----PPIYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PP 154
           PPVYK     PP Y     PP YK P   PP YK P   PPVYK     PPV K    PP
Sbjct: 42  PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 101

Query: 155 VYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPV 307
            YK P   PP YK P   PPVYK     PPV K    PP +K P   PP YK P   PPV
Sbjct: 102 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPPV 161

Query: 308 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
           YK     PP YK P   PP YK P   PPVYK
Sbjct: 162 YKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYK 192

 Score =  112 bits (280), Expect = 1e-23
 Identities = 66/131 (50%), Positives = 66/131 (50%), Gaps = 4/131 (3%)
 Frame = +2

Query: 23  YKPPVEKPPEYT----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           YK P   PP Y     PP YK P   PP YK P   PPVYK     PPVYK     PP Y
Sbjct: 6   YKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK-SPPPPY 64

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 370
           K P   PP YK P   PPVYK     PPVYK     PP YK P   PP YK P   PPVY
Sbjct: 65  KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVY 123

Query: 371 KPPVEKPPVYK 403
           K     PPVYK
Sbjct: 124 KYKSPPPPVYK 134

 Score =  105 bits (261), Expect = 2e-21
 Identities = 63/132 (47%), Positives = 65/132 (49%), Gaps = 5/132 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YK P   PP Y      PP+YK     PP YK P   PP YK P   PPVYK     
Sbjct: 71  PPPYKYPSPPPPVYKYKSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 129

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PPVYK     PP +K P   PP YK P   PPVYK     PP YK P   PP YK P   
Sbjct: 130 PPVYKYK-SPPPPHKYPSPPPPPYKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPP 187

Query: 359 PPVYKPPVEKPP 394
           PPVYK     PP
Sbjct: 188 PPVYKYKSPPPP 199

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 60/120 (50%), Positives = 61/120 (50%), Gaps = 9/120 (7%)
 Frame = +2

Query: 77  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 256
           P +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK     PPVYK 
Sbjct: 1   PPKKP--YKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 57

Query: 257 PVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPP 409
               PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P
Sbjct: 58  K-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYP 116

[106][TOP]
>UniRef100_A5E4F6 Putative uncharacterized protein n=1 Tax=Lodderomyces elongisporus
           RepID=A5E4F6_LODEL
          Length = 977

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/135 (47%), Positives = 67/135 (49%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE  P  + P+   PV+  PV   PVE  PV   PVE  PV   PVE  P
Sbjct: 412 VESSPVKSTPVESSPVESSPVESSPVKSTPVESSPVESSPVESSPVESSPVESSPVESTP 471

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  P
Sbjct: 472 VESSPVESTPVESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSP 531

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV   P
Sbjct: 532 VESSPVESTPVESSP 546

 Score =  117 bits (293), Expect = 4e-25
 Identities = 66/140 (47%), Positives = 68/140 (48%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE  P  + P+   PVE  PV   PVE  PV   PVE  PV   PVE  P
Sbjct: 422 VESSPVESSPVESSPVKSTPVESSPVESSPVESSPVESSPVESSPVESTPVESSPVESTP 481

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  P
Sbjct: 482 VESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVESSPVESTP 541

Query: 365 VYKPPVEK-----PPVYKPP 409
           V   PVE      PPV   P
Sbjct: 542 VESSPVESSIHIDPPVESSP 561

 Score =  117 bits (293), Expect = 4e-25
 Identities = 66/140 (47%), Positives = 68/140 (48%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE  P  + P+   PVE  PV   PVE  PV   PVE  PV   PVE  P
Sbjct: 432 VESSPVKSTPVESSPVESSPVESSPVESSPVESSPVESTPVESSPVESTPVESTPVESSP 491

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-- 358
           V   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE   
Sbjct: 492 VKSTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVESSPVESTPVESSPVESSI 551

Query: 359 ---PPVYKPPVEKPPVYKPP 409
              PPV   PVE  PV   P
Sbjct: 552 HIDPPVESSPVESTPVESSP 571

 Score =  117 bits (293), Expect = 4e-25
 Identities = 66/140 (47%), Positives = 68/140 (48%), Gaps = 5/140 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE  P  + P+   PVE  PV   PVE  PV   PVE  PV   PVE  P
Sbjct: 442 VESSPVESSPVESSPVESSPVESSPVESTPVESSPVESTPVESTPVESSPVKSTPVESSP 501

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----PPVYKPP 349
           V   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE      PPV   P
Sbjct: 502 VKSTPVESSPVKSTPVESSPVKSTPVESSPVESSPVESTPVESSPVESSIHIDPPVESSP 561

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           VE  PV   PVE  PV   P
Sbjct: 562 VESTPVESSPVESTPVESSP 581

 Score =  117 bits (292), Expect = 5e-25
 Identities = 64/135 (47%), Positives = 66/135 (48%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE  P  + P+   PVE  PV   PVE  PV   PVE  PV   PVE  P
Sbjct: 452 VESSPVESSPVESSPVESTPVESSPVESTPVESTPVESSPVKSTPVESSPVKSTPVESSP 511

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV   PVE  PV   PVE  PV   PVE      PPVE  PV   PVE  P
Sbjct: 512 VKSTPVESSPVKSTPVESSPVESSPVESTPVESSPVESSIHIDPPVESSPVESTPVESSP 571

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV   P
Sbjct: 572 VESTPVESSPVESSP 586

 Score =  115 bits (289), Expect = 1e-24
 Identities = 62/131 (47%), Positives = 65/131 (49%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           PV   PVE  P  + P+   PVE  PV   PV+  PV   PVE  PV   PVE  PV   
Sbjct: 406 PVKSTPVESSPVKSTPVESSPVESSPVESSPVKSTPVESSPVESSPVESSPVESSPVESS 465

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
           PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   
Sbjct: 466 PVESTPVESSPVESTPVESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVKST 525

Query: 377 PVEKPPVYKPP 409
           PVE  PV   P
Sbjct: 526 PVESSPVESSP 536

 Score =  111 bits (278), Expect = 2e-23
 Identities = 61/127 (48%), Positives = 63/127 (49%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           VE  PV   PVE  P  + P+   PVE  PV   PVE  PV   PVE  PV   PVE  P
Sbjct: 462 VESSPVESTPVESSPVESTPVESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSP 521

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV   PVE  PV   PVE      PPVE  PV   PVE  PV   PVE  P
Sbjct: 522 VKSTPVESSPVESSPVESTPVESSPVESSIHIDPPVESSPVESTPVESSPVESTPVESSP 581

Query: 365 VYKPPVE 385
           V   PVE
Sbjct: 582 VESSPVE 588

 Score =  111 bits (277), Expect = 3e-23
 Identities = 59/135 (43%), Positives = 67/135 (49%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V+  PV   PV+  P  + P+   PVE  PV   PVE  PV   PVE  PV   PVE  P
Sbjct: 407 VKSTPVESSPVKSTPVESSPVESSPVESSPVKSTPVESSPVESSPVESSPVESSPVESSP 466

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV   PVE  PV   PV+  PV   PV+  PV   PV+  PV   PV+  P
Sbjct: 467 VESTPVESSPVESTPVESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVKSTP 526

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV   P
Sbjct: 527 VESSPVESSPVESTP 541

 Score =  111 bits (277), Expect = 3e-23
 Identities = 59/131 (45%), Positives = 66/131 (50%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V+  PV   PVE  P  + P+   PVE  PV   PVE  PV   PVE  PV   PVE  P
Sbjct: 417 VKSTPVESSPVESSPVESSPVKSTPVESSPVESSPVESSPVESSPVESSPVESTPVESSP 476

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV   PV+  PV   PV+  PV   PV+  PV   PV+  PV   PVE  P
Sbjct: 477 VESTPVESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVESSP 536

Query: 365 VYKPPVEKPPV 397
           V   PVE  PV
Sbjct: 537 VESTPVESSPV 547

 Score =  108 bits (270), Expect = 2e-22
 Identities = 62/135 (45%), Positives = 66/135 (48%), Gaps = 3/135 (2%)
 Frame = +2

Query: 14  PPVYK--PPVEKP-PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           PPV    PPV    P  + P+   PV+  PV   PVE  PV   PV+  PV   PVE  P
Sbjct: 392 PPVSSSVPPVSSSTPVKSTPVESSPVKSTPVESSPVESSPVESSPVKSTPVESSPVESSP 451

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           V   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  P
Sbjct: 452 VESSPVESSPVESSPVESTPVESSPVESTPVESTPVESSPVKSTPVESSPVKSTPVESSP 511

Query: 365 VYKPPVEKPPVYKPP 409
           V   PVE  PV   P
Sbjct: 512 VKSTPVESSPVKSTP 526

 Score =  103 bits (257), Expect = 6e-21
 Identities = 63/139 (45%), Positives = 67/139 (48%), Gaps = 7/139 (5%)
 Frame = +2

Query: 14  PPVYK--PPVEK--PP--EYTPPIYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PPV    PPV    PP     PP+    PV+  PV   PV+  PV   PVE  PV   PV
Sbjct: 378 PPVSSSVPPVSSSVPPVSSSVPPVSSSTPVKSTPVESSPVKSTPVESSPVESSPVESSPV 437

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           +  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PV
Sbjct: 438 KSTPVESSPVESSPVESSPVESSPVESSPVESTPVESSPVESTPVESTPVESSPVKSTPV 497

Query: 353 EKPPVYKPPVEKPPVYKPP 409
           E  PV   PVE  PV   P
Sbjct: 498 ESSPVKSTPVESSPVKSTP 516

[107][TOP]
>UniRef100_A7RX60 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis
           RepID=A7RX60_NEMVE
          Length = 533

 Score =  118 bits (296), Expect = 2e-25
 Identities = 69/136 (50%), Positives = 81/136 (59%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG   TG L TG + TG L TG + TG L TG + TG L TG + 
Sbjct: 231 TGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYF 290

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + TG L  GG +
Sbjct: 291 TGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYF 350

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STGG +TG  ST
Sbjct: 351 TGALSTGGYFTGALST 366

 Score =  118 bits (296), Expect = 2e-25
 Identities = 69/136 (50%), Positives = 81/136 (59%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG   TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + 
Sbjct: 241 TGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYF 300

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG   TG L TG + TG L TG + TG L TGG+ TG L  GG +
Sbjct: 301 TGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYF 360

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG  ST
Sbjct: 361 TGALSTGVCFTGALST 376

 Score =  118 bits (296), Expect = 2e-25
 Identities = 68/136 (50%), Positives = 81/136 (59%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + 
Sbjct: 251 TGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYF 310

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG   TG L TG + TG L TG + TG L TGG+ TG L TGG+ TG L  G  +
Sbjct: 311 TGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCF 370

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG   T
Sbjct: 371 TGALSTGVYFTGALCT 386

 Score =  117 bits (292), Expect = 5e-25
 Identities = 68/136 (50%), Positives = 81/136 (59%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + 
Sbjct: 21  TGALSTGVYFTGALFTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYF 80

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG   TG L TG + TG L TG + TG L TG + TG L  G  +
Sbjct: 81  TGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYF 140

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STGG +TG  ST
Sbjct: 141 TGALSTGGYFTGALST 156

 Score =  117 bits (292), Expect = 5e-25
 Identities = 68/136 (50%), Positives = 81/136 (59%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + 
Sbjct: 31  TGALFTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYF 90

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG   TG L TG + TG L TG + TG L TG + TG L TG + TG L  GG +
Sbjct: 91  TGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYF 150

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG  ST
Sbjct: 151 TGALSTGVYFTGALST 166

 Score =  117 bits (292), Expect = 5e-25
 Identities = 68/136 (50%), Positives = 81/136 (59%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + 
Sbjct: 61  TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYF 120

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TGG+ TG L TG + TG L TG + TG L  G  +
Sbjct: 121 TGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCF 180

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG  ST
Sbjct: 181 TGALSTGVYFTGALST 196

 Score =  117 bits (292), Expect = 5e-25
 Identities = 68/136 (50%), Positives = 81/136 (59%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TGG+ TG L TG + 
Sbjct: 101 TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYF 160

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG   TG L TG + TG L TG + TG L TG + TG L  G  +
Sbjct: 161 TGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYF 220

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG  ST
Sbjct: 221 TGALSTGVYFTGALST 236

 Score =  117 bits (292), Expect = 5e-25
 Identities = 68/136 (50%), Positives = 81/136 (59%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TGG+ TG L TG + TG L TG + 
Sbjct: 111 TGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYF 170

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG   TG L TG + TG L TG + TG L TG + TG L TG + TG L  G  +
Sbjct: 171 TGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYF 230

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG  ST
Sbjct: 231 TGALSTGVYFTGALST 246

 Score =  116 bits (291), Expect = 7e-25
 Identities = 68/136 (50%), Positives = 80/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + TG L TG   
Sbjct: 261 TGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCF 320

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TGG+ TG L TGG+ TG L TG   TG L  G  +
Sbjct: 321 TGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYF 380

Query: 51  SGGFSTGGLYTGGFST 4
           +G   TG  +TG  ST
Sbjct: 381 TGALCTGVCFTGALST 396

 Score =  116 bits (291), Expect = 7e-25
 Identities = 68/136 (50%), Positives = 80/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG   TG L TG + 
Sbjct: 271 TGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYF 330

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TGG+ TG L TGG+ TG L TG   TG L TG + TG L  G  +
Sbjct: 331 TGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCF 390

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG   T
Sbjct: 391 TGALSTGVYFTGALCT 406

 Score =  115 bits (288), Expect = 2e-24
 Identities = 67/141 (47%), Positives = 81/141 (57%), Gaps = 5/141 (3%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGL-----YTGGFSTGGL* 247
           TG L TG + TG L TG + TG L+TG + TG L TG + TG L     +TG  STG   
Sbjct: 11  TGALSTGVYFTGALSTGVYFTGALFTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYF 70

Query: 246 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL* 67
           TG  STG  +TG  STG  +TG  STG  +TG  STG  +TG  STG   TG  STG   
Sbjct: 71  TGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYF 130

Query: 66  IGGVYSGGFSTGGLYTGGFST 4
            G + +G + TG L TGG+ T
Sbjct: 131 TGALCTGVYFTGALSTGGYFT 151

 Score =  115 bits (287), Expect = 2e-24
 Identities = 67/136 (49%), Positives = 80/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + TG L TG   
Sbjct: 41  TGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCF 100

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TGG+ TG L  G  +
Sbjct: 101 TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYF 160

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG   T
Sbjct: 161 TGALSTGVYFTGALCT 176

 Score =  115 bits (287), Expect = 2e-24
 Identities = 67/136 (49%), Positives = 80/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG   TG L TG + 
Sbjct: 51  TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYF 110

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG + TG L TGG+ TG L TG + TG L  G  +
Sbjct: 111 TGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYF 170

Query: 51  SGGFSTGGLYTGGFST 4
           +G   TG  +TG  ST
Sbjct: 171 TGALCTGVCFTGALST 186

 Score =  115 bits (287), Expect = 2e-24
 Identities = 68/136 (50%), Positives = 80/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG   TG L TG + TG L TG + TG L TG + TG L TG + TG L TGG+ 
Sbjct: 91  TGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYF 150

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + TG L  G  +
Sbjct: 151 TGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYF 210

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG  ST
Sbjct: 211 TGALSTGVYFTGALST 226

 Score =  115 bits (287), Expect = 2e-24
 Identities = 67/136 (49%), Positives = 80/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TGG+ TG L TG + TG L TG + TG L TG   
Sbjct: 121 TGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCF 180

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + TG L  G  +
Sbjct: 181 TGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYF 240

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG   T
Sbjct: 241 TGALSTGVCFTGALCT 256

 Score =  114 bits (286), Expect = 3e-24
 Identities = 68/136 (50%), Positives = 79/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + TG L TGG+ 
Sbjct: 291 TGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYF 350

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TGG+ TG L TG   TG L TG + TG L TG   TG L TG + TG L  G  +
Sbjct: 351 TGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYF 410

Query: 51  SGGFSTGGLYTGGFST 4
           +G   TG  +TG  ST
Sbjct: 411 TGALCTGVCFTGALST 426

 Score =  114 bits (286), Expect = 3e-24
 Identities = 68/136 (50%), Positives = 79/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG   TG L TG + TG L TG + TG L TGG+ TG L TGG+ 
Sbjct: 301 TGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYF 360

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG   TG L TG + TG L TG   TG L TG + TG L TG + TG L  G  +
Sbjct: 361 TGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCF 420

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG   T
Sbjct: 421 TGALSTGVYFTGALCT 436

 Score =  114 bits (286), Expect = 3e-24
 Identities = 68/136 (50%), Positives = 79/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TGG+ TG L TGG+ TG L TG   TG L TG + 
Sbjct: 321 TGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYF 380

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG   TG L TG + TG L TG + TG L TG   TG L TG + TG L  G  +
Sbjct: 381 TGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYF 440

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG   T
Sbjct: 441 TGALSTGVCFTGALCT 456

 Score =  113 bits (283), Expect = 6e-24
 Identities = 67/136 (49%), Positives = 80/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + 
Sbjct: 181 TGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYF 240

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG   TG L TG + TG L TG + TG L TG + TG L TG + TG L  G  +
Sbjct: 241 TGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYF 300

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG  ST
Sbjct: 301 TGALSTGVYFTGALST 316

 Score =  113 bits (282), Expect = 8e-24
 Identities = 67/136 (49%), Positives = 79/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + TG L TG + 
Sbjct: 71  TGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYF 130

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TGG+ TG L TG + TG L TG + TG L TG   TG L  G  +
Sbjct: 131 TGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYF 190

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG   T
Sbjct: 191 TGALSTGVYFTGALCT 206

 Score =  113 bits (282), Expect = 8e-24
 Identities = 67/136 (49%), Positives = 79/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TGG+ TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + 
Sbjct: 141 TGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYF 200

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG   TG L  G  +
Sbjct: 201 TGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYF 260

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG   T
Sbjct: 261 TGALSTGVYFTGALCT 276

 Score =  113 bits (282), Expect = 8e-24
 Identities = 67/136 (49%), Positives = 79/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + TG L TG + 
Sbjct: 221 TGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYF 280

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG + TG L TG   TG L TG + TG L  G  +
Sbjct: 281 TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYF 340

Query: 51  SGGFSTGGLYTGGFST 4
           +G   TGG +TG  ST
Sbjct: 341 TGALCTGGYFTGALST 356

 Score =  112 bits (281), Expect = 1e-23
 Identities = 67/136 (49%), Positives = 78/136 (57%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + 
Sbjct: 281 TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYF 340

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TGG+ TG L TGG+ TG L TG   TG L TG + TG L TG   TG L  G  +
Sbjct: 341 TGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYF 400

Query: 51  SGGFSTGGLYTGGFST 4
           +G   TG  +TG   T
Sbjct: 401 TGALCTGVYFTGALCT 416

 Score =  112 bits (281), Expect = 1e-23
 Identities = 68/136 (50%), Positives = 78/136 (57%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG   TG L TG + TG L TG + TG L TGG+ TG L TGG+ TG L TG   
Sbjct: 311 TGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCF 370

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG   TG L TG + TG L TG + TG L TG   TG L  G  +
Sbjct: 371 TGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYF 430

Query: 51  SGGFSTGGLYTGGFST 4
           +G   TG  +TG  ST
Sbjct: 431 TGALCTGVYFTGALST 446

 Score =  112 bits (281), Expect = 1e-23
 Identities = 67/136 (49%), Positives = 78/136 (57%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TGG+ TG L TGG+ TG L TG   TG L TG + TG L TG   
Sbjct: 331 TGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCF 390

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + TG L  G  +
Sbjct: 391 TGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCF 450

Query: 51  SGGFSTGGLYTGGFST 4
           +G   TG  +TG   T
Sbjct: 451 TGALCTGVYFTGALCT 466

 Score =  112 bits (280), Expect = 1e-23
 Identities = 64/132 (48%), Positives = 73/132 (55%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG  STG   TG  STG  +TG  STG   TG  STG  +TG  STG   TG  S
Sbjct: 46  TGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALS 105

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG  +TG  STG  +TG  STG  +TG   TG  +TG  STGG  TG  STG    G + 
Sbjct: 106 TGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALS 165

Query: 51  SGGFSTGGLYTG 16
           +G + TG L TG
Sbjct: 166 TGVYFTGALCTG 177

 Score =  111 bits (278), Expect = 2e-23
 Identities = 66/136 (48%), Positives = 79/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + 
Sbjct: 1   TGALCTGVYFTGALSTGVYFTGALSTGVYFTGALFTGVYFTGALCTGVYFTGALSTGVYF 60

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG + TG L TG   TG L TG + TG L  G  +
Sbjct: 61  TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYF 120

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG   T
Sbjct: 121 TGALSTGVYFTGALCT 136

 Score =  111 bits (278), Expect = 2e-23
 Identities = 64/136 (47%), Positives = 74/136 (54%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG   TG   TG  STG  +TG  STG   TG  STG  +TG  STG   TG  S
Sbjct: 36  TGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALS 95

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG  +TG  STG  +TG  STG  +TG  STG  +TG   TG   TG  STGG   G + 
Sbjct: 96  TGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALS 155

Query: 51  SGGFSTGGLYTGGFST 4
           +G + TG L TG + T
Sbjct: 156 TGVYFTGALSTGVYFT 171

 Score =  111 bits (278), Expect = 2e-23
 Identities = 64/136 (47%), Positives = 74/136 (54%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG  STG   TG  STG  +TG  STG   TG  STG  +TG  STG   TG  S
Sbjct: 66  TGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALS 125

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG  +TG   TG  +TG  STGG +TG  STG  +TG  STG   TG   TG    G + 
Sbjct: 126 TGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALS 185

Query: 51  SGGFSTGGLYTGGFST 4
           +G + TG L TG + T
Sbjct: 186 TGVYFTGALSTGVYFT 201

 Score =  111 bits (278), Expect = 2e-23
 Identities = 64/136 (47%), Positives = 74/136 (54%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG  STG   TG  STG  +TG  STG   TG  STG  +TG  STG   TG   
Sbjct: 76  TGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALC 135

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG  +TG  STGG +TG  STG  +TG  STG  +TG   TG   TG  STG    G + 
Sbjct: 136 TGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALS 195

Query: 51  SGGFSTGGLYTGGFST 4
           +G + TG L TG + T
Sbjct: 196 TGVYFTGALCTGVYFT 211

 Score =  111 bits (278), Expect = 2e-23
 Identities = 64/136 (47%), Positives = 74/136 (54%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG  STGG  TG  STG  +TG  STG   TG   TG  +TG  STG   TG  S
Sbjct: 136 TGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALS 195

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG  +TG   TG  +TG  STG  +TG  STG  +TG  STG   TG  STG    G + 
Sbjct: 196 TGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALC 255

Query: 51  SGGFSTGGLYTGGFST 4
           +G + TG L TG + T
Sbjct: 256 TGVYFTGALSTGVYFT 271

 Score =  111 bits (278), Expect = 2e-23
 Identities = 67/136 (49%), Positives = 79/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG   TG L TG + TG L TG + TG L TG + TG L TG + 
Sbjct: 161 TGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYF 220

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + TG L  G  +
Sbjct: 221 TGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYF 280

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG  ST
Sbjct: 281 TGALSTGVYFTGALST 296

 Score =  111 bits (278), Expect = 2e-23
 Identities = 67/136 (49%), Positives = 79/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG   TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + 
Sbjct: 171 TGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYF 230

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG   TG L TG + TG L TG + TG L TG + TG L  G  +
Sbjct: 231 TGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYF 290

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG  ST
Sbjct: 291 TGALSTGVYFTGALST 306

 Score =  111 bits (278), Expect = 2e-23
 Identities = 66/136 (48%), Positives = 79/136 (58%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + TG L TG   
Sbjct: 191 TGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCF 250

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + TG L  G  +
Sbjct: 251 TGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYF 310

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG   T
Sbjct: 311 TGALSTGVCFTGALCT 326

 Score =  111 bits (277), Expect = 3e-23
 Identities = 63/136 (46%), Positives = 73/136 (53%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG  STG   TG  STG  +TG   TG   TG  STG  +TG   TG   TG  S
Sbjct: 226 TGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALS 285

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG  +TG  STG  +TG  STG  +TG  STG  +TG   TG   TG   TG    G + 
Sbjct: 286 TGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALC 345

Query: 51  SGGFSTGGLYTGGFST 4
           +GG+ TG L TGG+ T
Sbjct: 346 TGGYFTGALSTGGYFT 361

 Score =  111 bits (277), Expect = 3e-23
 Identities = 63/136 (46%), Positives = 73/136 (53%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG  STG   TG  STG  +TG  STG   TG  STG  +TG   TG   TG   
Sbjct: 276 TGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALC 335

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG  +TG   TGG +TG  STGG +TG  STG  +TG  STG   TG   TG    G + 
Sbjct: 336 TGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALS 395

Query: 51  SGGFSTGGLYTGGFST 4
           +G + TG L TG + T
Sbjct: 396 TGVYFTGALCTGVYFT 411

 Score =  110 bits (276), Expect = 4e-23
 Identities = 65/141 (46%), Positives = 75/141 (53%), Gaps = 5/141 (3%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TGG  TG  STG   TG  STG  +TG   TG   TG  STG  +TG  STG   TG   
Sbjct: 146 TGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYFTGALC 205

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFS-----TGGL*TGGFSTGGL* 67
           TG  +TG  STG  +TG  STG  +TG  STG  +TG  S     TG L TG + TG L 
Sbjct: 206 TGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALS 265

Query: 66  IGGVYSGGFSTGGLYTGGFST 4
            G  ++G   TG  +TG  ST
Sbjct: 266 TGVYFTGALCTGVYFTGALST 286

 Score =  110 bits (276), Expect = 4e-23
 Identities = 67/136 (49%), Positives = 77/136 (56%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TGG+ TG L TGG+ TG L TG   TG L TG + TG L TG   TG L TG + 
Sbjct: 341 TGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYF 400

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG   TG L TG + TG L TG + TG L TG   TG L  G  +
Sbjct: 401 TGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYF 460

Query: 51  SGGFSTGGLYTGGFST 4
           +G   TG  +TG   T
Sbjct: 461 TGALCTGVYFTGALCT 476

 Score =  110 bits (275), Expect = 5e-23
 Identities = 64/141 (45%), Positives = 74/141 (52%), Gaps = 5/141 (3%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TGG  TG  STGG  TG  STG  +TG  STG   TG   TG  +TG  STG   TG   
Sbjct: 346 TGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALC 405

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFS-----TGGL*TGGFSTGGL* 67
           TG  +TG   TG  +TG  STG  +TG   TG  +TG  S     TG L TG + TG L 
Sbjct: 406 TGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYFTGALC 465

Query: 66  IGGVYSGGFSTGGLYTGGFST 4
            G  ++G   TG  +TG  ST
Sbjct: 466 TGVYFTGALCTGVYFTGALST 486

 Score =  109 bits (273), Expect = 8e-23
 Identities = 63/136 (46%), Positives = 73/136 (53%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG  STG   TG  STG  +TG  STG   TG   TG  +TG  STG   TG   
Sbjct: 216 TGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALC 275

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG  +TG  STG  +TG  STG  +TG  STG  +TG  STG   TG   TG    G + 
Sbjct: 276 TGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALC 335

Query: 51  SGGFSTGGLYTGGFST 4
           +G + TG L TGG+ T
Sbjct: 336 TGVYFTGALCTGGYFT 351

 Score =  109 bits (273), Expect = 8e-23
 Identities = 67/136 (49%), Positives = 78/136 (57%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG   TG L TG + TG L TG + TG L TG   TG L TG + 
Sbjct: 371 TGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYF 430

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG   TG L TG + TG L TG + TG L TG + TG L  G  +
Sbjct: 431 TGALCTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGVYFTGALSTGVYF 490

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG  ST
Sbjct: 491 TGALSTGVCFTGALST 506

 Score =  109 bits (273), Expect = 8e-23
 Identities = 67/136 (49%), Positives = 78/136 (57%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG   TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + 
Sbjct: 381 TGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYF 440

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG   TG L TG + TG L TG + TG L TG + TG L TG + TG L  G  +
Sbjct: 441 TGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVCF 500

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG  ST
Sbjct: 501 TGALSTGVYFTGALST 516

 Score =  109 bits (273), Expect = 8e-23
 Identities = 67/136 (49%), Positives = 78/136 (57%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + TG L TG   
Sbjct: 391 TGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCF 450

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG + TG L TG + TG L TG   TG L  G  +
Sbjct: 451 TGALCTGVYFTGALCTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYF 510

Query: 51  SGGFSTGGLYTGGFST 4
           +G  STG  +TG  ST
Sbjct: 511 TGALSTGVCFTGALST 526

 Score =  109 bits (272), Expect = 1e-22
 Identities = 62/136 (45%), Positives = 72/136 (52%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG   TGG  TG  STGG +TG  STG   TG  STG  +TG   TG   TG  S
Sbjct: 336 TGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALS 395

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG  +TG   TG  +TG   TG  +TG  STG  +TG   TG   TG  STG    G + 
Sbjct: 396 TGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALC 455

Query: 51  SGGFSTGGLYTGGFST 4
           +G + TG L TG + T
Sbjct: 456 TGVYFTGALCTGVYFT 471

 Score =  108 bits (271), Expect = 1e-22
 Identities = 64/141 (45%), Positives = 74/141 (52%), Gaps = 5/141 (3%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG   TG   TG  STGG +TG  STG   TG  STG  +TG   TG   TG  S
Sbjct: 126 TGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALS 185

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFS-----TGGL*TGGFSTGGL* 67
           TG  +TG  STG  +TG   TG  +TG  STG  +TG  S     TG L TG + TG L 
Sbjct: 186 TGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALS 245

Query: 66  IGGVYSGGFSTGGLYTGGFST 4
            G  ++G   TG  +TG  ST
Sbjct: 246 TGVCFTGALCTGVYFTGALST 266

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/132 (46%), Positives = 70/132 (53%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG  STG   TG   TG  +TG  STG   TG   TG  +TG  STG   TG  S
Sbjct: 236 TGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALS 295

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG  +TG  STG  +TG  STG  +TG   TG  +TG   TG   TG   TGG   G + 
Sbjct: 296 TGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALS 355

Query: 51  SGGFSTGGLYTG 16
           +GG+ TG L TG
Sbjct: 356 TGGYFTGALSTG 367

 Score =  107 bits (268), Expect = 3e-22
 Identities = 64/141 (45%), Positives = 74/141 (52%), Gaps = 5/141 (3%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TGG  TG  STG   TG  STG  +TG   TG   TG  STG  +TG   TG   TG   
Sbjct: 356 TGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALC 415

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFS-----TGGLYTGGFSTGGL*TGGFSTGGL* 67
           TG  +TG  STG  +TG   TG  +TG  S     TG L TG + TG L TG + TG L 
Sbjct: 416 TGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALC 475

Query: 66  IGGVYSGGFSTGGLYTGGFST 4
            G  ++G  STG  +TG  ST
Sbjct: 476 TGVYFTGALSTGVYFTGALST 496

 Score =  107 bits (267), Expect = 4e-22
 Identities = 61/136 (44%), Positives = 71/136 (52%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG  STG   TG   TG  +TG   TG   TG   TGG +TG  STGG  TG  S
Sbjct: 306 TGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALS 365

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG  +TG  STG  +TG   TG  +TG  STG  +TG   TG   TG   TG    G + 
Sbjct: 366 TGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALS 425

Query: 51  SGGFSTGGLYTGGFST 4
           +G + TG L TG + T
Sbjct: 426 TGVYFTGALCTGVYFT 441

 Score =  106 bits (264), Expect = 9e-22
 Identities = 65/132 (49%), Positives = 76/132 (57%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG L TG + TG L TG   TG L TG + TG L TG + TG L TG   TG L TG + 
Sbjct: 401 TGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYF 460

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG L TG + TG L TG + TG L TG + TG L TG   TG L TG + TG L  G  +
Sbjct: 461 TGALCTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVCF 520

Query: 51  SGGFSTGGLYTG 16
           +G  STG  +TG
Sbjct: 521 TGALSTGVYFTG 532

 Score =  104 bits (259), Expect = 3e-21
 Identities = 62/136 (45%), Positives = 71/136 (52%)
 Frame = -1

Query: 411 TGGL*TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFS 232
           TG   TG   TG   TG  STG  +TG  STG   TG  STG  +TG  STG   TG   
Sbjct: 196 TGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALC 255

Query: 231 TGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*IGGVY 52
           TG  +TG  STG  +TG   TG  +TG  STG  +TG  STG   TG  STG    G + 
Sbjct: 256 TGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALS 315

Query: 51  SGGFSTGGLYTGGFST 4
           +G   TG L TG + T
Sbjct: 316 TGVCFTGALCTGVYFT 331

[108][TOP]
>UniRef100_UPI00004D7A1C UPI00004D7A1C related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00004D7A1C
          Length = 213

 Score =  118 bits (296), Expect = 2e-25
 Identities = 55/137 (40%), Positives = 70/137 (51%), Gaps = 4/137 (2%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           KPP+   P  KPP Y P +Y    + P+  PP+   P  KPP Y P + + P+  PP+  
Sbjct: 44  KPPICTVPAAKPPSYCPHLYCASSQAPLILPPICTVPAAKPPSYCPHLNQAPLILPPICT 103

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
            P  KPP   PP+   P  K P Y PP  KPP+   P  KPP+   P  KPP+   P  K
Sbjct: 104 VPASKPPSYSPPICTVPAAKAPSYCPPTAKPPICTVPAAKPPICTVPAAKPPICTVPAAK 163

Query: 359 PPVYKPPVEKPPVYKPP 409
           PP+   P  KPP+Y  P
Sbjct: 164 PPICTVPAAKPPLYCAP 180

 Score =  108 bits (271), Expect = 1e-22
 Identities = 58/150 (38%), Positives = 69/150 (46%), Gaps = 19/150 (12%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P  KPP+   P   PPI   P  KPP+   P  KPP+   P  KPP+   P  KPP Y P
Sbjct: 1   PAAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPSYCP 60

Query: 197 ---------PVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPV---- 322
                    P+  PP+   P  KPP Y P     P+  PP+   P  KPP Y PP+    
Sbjct: 61  HLYCASSQAPLILPPICTVPAAKPPSYCPHLNQAPLILPPICTVPASKPPSYSPPICTVP 120

Query: 323 -EKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
             K P Y PP  KPP+   P  KPP+   P
Sbjct: 121 AAKAPSYCPPTAKPPICTVPAAKPPICTVP 150

 Score =  103 bits (257), Expect = 6e-21
 Identities = 50/137 (36%), Positives = 63/137 (45%), Gaps = 5/137 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPV-----EKPPVYKPPVEK 178
           PP+   P  KPP Y P + + P+  PP+   P  KPP Y PP+      K P Y PP  K
Sbjct: 74  PPICTVPAAKPPSYCPHLNQAPLILPPICTVPASKPPSYSPPICTVPAAKAPSYCPPTAK 133

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP+   P  KPP+   P  KPP+   P  KPP+   P  KPP+Y  P + P     P   
Sbjct: 134 PPICTVPAAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPLYCAPSKAPASVPVPAAA 193

Query: 359 PPVYKPPVEKPPVYKPP 409
            P    P +  P    P
Sbjct: 194 MPRNPSPSQPRPAPSSP 210

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 42/125 (33%), Positives = 54/125 (43%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           + + P+  PP+   P   PP Y      PP+   P  K P Y PP  KPP+   P  KPP
Sbjct: 91  LNQAPLILPPICTVPASKPPSY-----SPPICTVPAAKAPSYCPPTAKPPICTVPAAKPP 145

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           +   P  KPP+   P  KPP+   P  KPP+Y  P + P     P    P    P +  P
Sbjct: 146 ICTVPAAKPPICTVPAAKPPICTVPAAKPPLYCAPSKAPASVPVPAAAMPRNPSPSQPRP 205

Query: 365 VYKPP 379
               P
Sbjct: 206 APSSP 210

[109][TOP]
>UniRef100_Q8H9E0 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Solanum
           tuberosum RepID=Q8H9E0_SOLTU
          Length = 217

 Score =  118 bits (296), Expect = 2e-25
 Identities = 69/139 (49%), Positives = 71/139 (51%), Gaps = 7/139 (5%)
 Frame = +2

Query: 14  PPVYK-----PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PPVYK     PPV K     PP+YK     PPVYK     PPVYK     PPVYK     
Sbjct: 65  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 124

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPV 352
           PPVYK     PPVYK     PPVYK     PPV  YK P   PPVYK     PPVYK   
Sbjct: 125 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKS 184

Query: 353 EKPPVYKPPVEKPPVYKPP 409
             PPVYK     PPV+K P
Sbjct: 185 PPPPVYKYKSPPPPVHKSP 203

 Score =  117 bits (293), Expect = 4e-25
 Identities = 69/139 (49%), Positives = 70/139 (50%), Gaps = 9/139 (6%)
 Frame = +2

Query: 14  PPVYK-------PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PPVYK       PPV K     PP+YK     PPVYK     PPVYK     PPVYK   
Sbjct: 53  PPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS 112

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKP 346
             PPVYK     PPVYK     PPVYK     PPVYK     PPV  YK P   PPVYK 
Sbjct: 113 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKY 172

Query: 347 PVEKPPVYKPPVEKPPVYK 403
               PPVYK     PPVYK
Sbjct: 173 KSPPPPVYKYKSPPPPVYK 191

 Score =  116 bits (291), Expect = 7e-25
 Identities = 70/139 (50%), Positives = 71/139 (51%), Gaps = 9/139 (6%)
 Frame = +2

Query: 14  PPVYK-----PPVEK--PPEYTPPIYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKP 166
           PPVYK     PPV K   P   PP+YK     PPVYK   P   PPVYK     PPVYK 
Sbjct: 21  PPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKY 80

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
               PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK 
Sbjct: 81  KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKY 140

Query: 347 PVEKPPVYKPPVEKPPVYK 403
               PPVYK     PPVYK
Sbjct: 141 KSPPPPVYKYKSPPPPVYK 159

 Score =  116 bits (291), Expect = 7e-25
 Identities = 70/139 (50%), Positives = 71/139 (51%), Gaps = 9/139 (6%)
 Frame = +2

Query: 14  PPVYK-----PPVEK--PPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PPVYK     PPV K   P   PP+YK     PPVYK     PPVYK     PPVYK   
Sbjct: 43  PPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS 102

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKP 346
             PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPV  YK 
Sbjct: 103 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS 162

Query: 347 PVEKPPVYKPPVEKPPVYK 403
           P   PPVYK     PPVYK
Sbjct: 163 PPPPPPVYKYKSPPPPVYK 181

 Score =  116 bits (290), Expect = 9e-25
 Identities = 70/141 (49%), Positives = 71/141 (50%), Gaps = 11/141 (7%)
 Frame = +2

Query: 14  PPVYK-------PPVEKPPEYTPPIYK--PPVEKPPVYKPPVEKPPVYK--PPVEKPPVY 160
           PPVYK       PPV K     PP+YK   P   PPVYK     PPVYK   P   PPVY
Sbjct: 9   PPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVY 68

Query: 161 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
           K     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVY
Sbjct: 69  KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 128

Query: 341 KPPVEKPPVYKPPVEKPPVYK 403
           K     PPVYK     PPVYK
Sbjct: 129 KYKSPPPPVYKYKSPPPPVYK 149

 Score =  116 bits (290), Expect = 9e-25
 Identities = 70/141 (49%), Positives = 71/141 (50%), Gaps = 11/141 (7%)
 Frame = +2

Query: 14  PPVYK-------PPVEKPPEYTPPIYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
           PPVYK       PPV K     PP+YK   P   PPVYK     PPVYK     PPVYK 
Sbjct: 31  PPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKY 90

Query: 167 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
               PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK 
Sbjct: 91  KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKY 150

Query: 347 PVEKPPV--YKPPVEKPPVYK 403
               PPV  YK P   PPVYK
Sbjct: 151 KSPPPPVYKYKSPPPPPPVYK 171

 Score =  104 bits (260), Expect = 3e-21
 Identities = 64/137 (46%), Positives = 66/137 (48%), Gaps = 5/137 (3%)
 Frame = +2

Query: 14  PPVYK-----PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PPVYK     PPV K     PP+YK     PPVYK     PPVYK     PPVYK     
Sbjct: 85  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 144

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PPVYK     PPVYK        YK P   PPVYK     PPVYK     PPVYK     
Sbjct: 145 PPVYKYKSPPPPVYK--------YKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 196

Query: 359 PPVYKPPVEKPPVYKPP 409
           PPV+K P   P  Y  P
Sbjct: 197 PPVHKSPA--PYYYTSP 211

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 61/133 (45%), Positives = 63/133 (47%), Gaps = 5/133 (3%)
 Frame = +2

Query: 20  VYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 199
           VYK   + PP   PP+YK        YK P   PPVYK     PPVYK        YK P
Sbjct: 1   VYK--YKSPP---PPVYK--------YKSPPPPPPVYKYKSPPPPVYK--------YKSP 39

Query: 200 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPP 364
              PPVYK     PPVYK     PP   PPV K     PPVYK     PPVYK     PP
Sbjct: 40  PPPPPVYKYKSPPPPVYKYKSPPPP---PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 96

Query: 365 VYKPPVEKPPVYK 403
           VYK     PPVYK
Sbjct: 97  VYKYKSPPPPVYK 109

[110][TOP]
>UniRef100_B4G234 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4G234_MAIZE
          Length = 304

 Score =  118 bits (296), Expect = 2e-25
 Identities = 65/126 (51%), Positives = 75/126 (59%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           P ++PP  K P Y PP+  PP  K PV +PPV +PPV  PP  K PV +PPV +PPV  P
Sbjct: 80  PGHQPP--KSPSY-PPVVGPP--KGPVTRPPVMRPPVVGPP--KGPVTRPPVTRPPVVGP 132

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
           PV  PP+  PP   PPV  PPV  PP+  PP   PPV  PPV  PP+  PP   PPV  P
Sbjct: 133 PVTYPPITGPPTT-PPVVGPPVTYPPITGPPTT-PPVVGPPVTYPPITGPPATTPPVTGP 190

Query: 377 PVEKPP 394
           PV  PP
Sbjct: 191 PVTYPP 196

 Score =  117 bits (292), Expect = 5e-25
 Identities = 68/140 (48%), Positives = 78/140 (55%), Gaps = 9/140 (6%)
 Frame = +2

Query: 17  PVYKPPVEKPPE----YTPPIYKPPVEK--PPVYKPP---VEKPPVYKPPVEKPPVYKPP 169
           P  KP   KPP+    Y  P ++PP     PPV  PP   V +PPV +PPV  PP  K P
Sbjct: 61  PSPKPKNPKPPKGSTGYPAPGHQPPKSPSYPPVVGPPKGPVTRPPVMRPPVVGPP--KGP 118

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
           V +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 119 VTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPP 176

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
           +  PP   PPV  PPV  PP
Sbjct: 177 ITGPPATTPPVTGPPVTYPP 196

 Score =  104 bits (259), Expect = 4e-21
 Identities = 59/126 (46%), Positives = 66/126 (52%), Gaps = 4/126 (3%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           K PV +PPV +PP   PP  K PV +PPV +PPV  PPV  PP+  PP   PPV  PPV 
Sbjct: 98  KGPVTRPPVMRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVT 154

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP----VEKPPVYKPPVEK 358
            PP+  PP   PPV  PPV  PP+  PP   PPV  PPV  PP        P   PP   
Sbjct: 155 YPPITGPPT-TPPVVGPPVTYPPITGPPATTPPVTGPPVTYPPGGGGGSSTPCPPPPSPT 213

Query: 359 PPVYKP 376
           P    P
Sbjct: 214 PTPSSP 219

 Score =  102 bits (255), Expect = 1e-20
 Identities = 56/123 (45%), Positives = 65/123 (52%), Gaps = 4/123 (3%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           V +PPV +PPV  PP+   P+ +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 101 VTRPPVMRPPVVGPPK--GPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPP 157

Query: 185 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP----VYKPPVEKPPVYKPPV 352
           +  PP   PPV  PPV  PP+  PP   PPV  PPV  PP        P   PP   P  
Sbjct: 158 ITGPPT-TPPVVGPPVTYPPITGPPATTPPVTGPPVTYPPGGGGGSSTPCPPPPSPTPTP 216

Query: 353 EKP 361
             P
Sbjct: 217 SSP 219

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 62/133 (46%), Positives = 71/133 (53%), Gaps = 6/133 (4%)
 Frame = +2

Query: 26  KPPVEKP--PEYTPPIYKPPVEKPPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPV 187
           KP   KP  P  T P +  P  KP   KPP        P ++PP  K P Y PPV  PP 
Sbjct: 42  KPKAPKPSHPPKTKPSHPSPSPKPKNPKPPKGSTGYPAPGHQPP--KSPSY-PPVVGPP- 97

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 367
            K PV +PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+  PP   PPV  PPV
Sbjct: 98  -KGPVTRPPVMRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPV 153

Query: 368 YKPPVEKPPVYKP 406
             PP+  PP   P
Sbjct: 154 TYPPITGPPTTPP 166

[111][TOP]
>UniRef100_O24300 PtxA protein n=1 Tax=Pisum sativum RepID=O24300_PEA
          Length = 352

 Score =  118 bits (295), Expect = 2e-25
 Identities = 76/143 (53%), Positives = 84/143 (58%), Gaps = 10/143 (6%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPP-VEKPPVY-KPPVEKPP-VYKPPVEKP 181
           KPP +KPP+ KPP + PP  +P        KPP V KPP Y KPP   PP V KPP   P
Sbjct: 34  KPPTHKPPIVKPPVHKPPKPQPCPPPSSSPKPPHVPKPPHYPKPPAVHPPHVPKPPAVHP 93

Query: 182 P-VYKPPVEKPPVYKPP-VEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPP- 349
           P V KPPV  PP+  PP V KPPV KPPV KPP V KPPV   PV  P + KPP+  PP 
Sbjct: 94  PHVPKPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPV--VPVTPPYIPKPPIVFPPH 151

Query: 350 VEKPPVY---KPPVEKPPVYKPP 409
           V  PPV     P V KPP+  PP
Sbjct: 152 VPLPPVVPVTPPYVPKPPIVFPP 174

 Score =  114 bits (284), Expect = 4e-24
 Identities = 78/161 (48%), Positives = 87/161 (54%), Gaps = 26/161 (16%)
 Frame = +2

Query: 5   VEKPPVYKPP----------------VEKPPEYTPP--IYKPPVEKPPVYKPP-VEKPPV 127
           + KPPV+KPP                V KPP Y  P  ++ P V KPP   PP V KPPV
Sbjct: 42  IVKPPVHKPPKPQPCPPPSSSPKPPHVPKPPHYPKPPAVHPPHVPKPPAVHPPHVPKPPV 101

Query: 128 YKPPVEKPP-VYKPPVEKPPVYKPP-VEKPPVY---KPPVEKPPVYKPP-VEKPPVYKPP 289
             PP+  PP V KPPV KPPV KPP V KPPV     P + KPP+  PP V  PPV   P
Sbjct: 102 VHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPVVPVTPPYIPKPPIVFPPHVPLPPVV--P 159

Query: 290 VEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPP 409
           V  P V KPP+  PP V  PPV   PV  P V KPP+  PP
Sbjct: 160 VTPPYVPKPPIVFPPHVPLPPV--VPVTPPYVPKPPIVFPP 198

 Score =  111 bits (278), Expect = 2e-23
 Identities = 70/126 (55%), Positives = 75/126 (59%), Gaps = 7/126 (5%)
 Frame = +2

Query: 53  YTP-PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVY-KPPVEKPP-VY 220
           Y P P  KPP  KPP+ KPPV KPP  +P        KPP V KPP Y KPP   PP V 
Sbjct: 27  YCPYPSPKPPTHKPPIVKPPVHKPPKPQPCPPPSSSPKPPHVPKPPHYPKPPAVHPPHVP 86

Query: 221 KPPVEKPP-VYKPPVEKPPVYKPP-VEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKP 391
           KPP   PP V KPPV  PP+  PP V KPPV KPPV KPP V KPPV   PV  P + KP
Sbjct: 87  KPPAVHPPHVPKPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPV--VPVTPPYIPKP 144

Query: 392 PVYKPP 409
           P+  PP
Sbjct: 145 PIVFPP 150

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 75/181 (41%), Positives = 79/181 (43%), Gaps = 46/181 (25%)
 Frame = +2

Query: 5   VEKPPVYKPP-VEKPPEYTPPIYKPP-VEKPPVYKPPVEKPP-VYKPPV--------EKP 151
           V KPP   PP V KPP   PPI  PP V KPPV KPPV KPP V KPPV         KP
Sbjct: 85  VPKPPAVHPPHVPKPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPVVPVTPPYIPKP 144

Query: 152 PVYKPP--------------VEKPPVYKPP--------------VEKPPVYKPP-VEKPP 244
           P+  PP              V KPP+  PP              V KPP+  PP V  PP
Sbjct: 145 PIVFPPHVPLPPVVPVTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPKPPIVFPPHVPLPP 204

Query: 245 V------YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           V      Y P     PV  P V  PP+  PP    PV  PP E P    PP   P  Y P
Sbjct: 205 VVPVTPPYVPLPPVVPVTPPFVPTPPIITPPTPTVPVPSPPSETPCPPPPPTVVP--YPP 262

Query: 407 P 409
           P
Sbjct: 263 P 263

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 57/172 (33%), Positives = 64/172 (37%), Gaps = 65/172 (37%)
 Frame = +2

Query: 5   VEKPPVYKPPVEKPPEYT-PPIYKPPVEKPP-VYKPPV--------EKPPVYKPP----- 139
           V KPPV  PP+  PP    PP+ KPPV KPP V KPPV         KPP+  PP     
Sbjct: 96  VPKPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPVVPVTPPYIPKPPIVFPPHVPLP 155

Query: 140 ---------VEKPPVYKPP--------------VEKPPVYKPP----------------- 199
                    V KPP+  PP              V KPP+  PP                 
Sbjct: 156 PVVPVTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPL 215

Query: 200 ----------VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 325
                     V  PP+  PP    PV  PP E P    PP   P  Y PP +
Sbjct: 216 PPVVPVTPPFVPTPPIITPPTPTVPVPSPPSETPCPPPPPTVVP--YPPPAQ 265

[112][TOP]
>UniRef100_A5BQP2 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BQP2_VITVI
          Length = 1190

 Score =  117 bits (294), Expect = 3e-25
 Identities = 71/142 (50%), Positives = 89/142 (62%), Gaps = 11/142 (7%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-P 184
           P+YK P+  P     PIYK P+  P P+YK P+  P P+YK P+  P P+YK P+  P P
Sbjct: 318 PIYKKPLPPPV----PIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVP 373

Query: 185 VYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPP 349
           VYK P+  P PVYK P+  P PVYK P+  P P+YK P+  P P+YK P+  P PVYK P
Sbjct: 374 VYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKP 433

Query: 350 VEKP-PVYKPPVEKP-PVYKPP 409
           +  P PVYK P+  P PVYK P
Sbjct: 434 LPPPVPVYKKPLPPPVPVYKKP 455

 Score =  117 bits (292), Expect = 5e-25
 Identities = 73/146 (50%), Positives = 91/146 (62%), Gaps = 14/146 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP---IYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVE 175
           PP   PP+  PP+  PP   IYK P+  P PVYK P+  P PVYK P+  P PVYK P+ 
Sbjct: 257 PPFTFPPL--PPKVFPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLP 314

Query: 176 KP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PV 337
            P P+YK P+  P P+YK P+  P P+YK P+  P P+YK P+  P P+YK P+  P PV
Sbjct: 315 PPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPV 374

Query: 338 YKPPVEKP-PVYKPPVEKP-PVYKPP 409
           YK P+  P PVYK P+  P PVYK P
Sbjct: 375 YKKPLPPPVPVYKKPLPPPVPVYKKP 400

 Score =  114 bits (284), Expect = 4e-24
 Identities = 71/151 (47%), Positives = 90/151 (59%), Gaps = 19/151 (12%)
 Frame = +2

Query: 14  PPVYKPPVEKPP-------EYTPPIYKPPVEKPPV--YKPPVEKP-PVYKPPVEKP-PVY 160
           P +Y PP++ PP        +T P   P V  PPV  YK P+  P PVYK P+  P PVY
Sbjct: 239 PKIYLPPIKFPPLPPKVYPPFTFPPLPPKVFPPPVPIYKKPLPPPVPVYKKPLPPPVPVY 298

Query: 161 KPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVE 325
           K P+  P PVYK P+  P P+YK P+  P P+YK P+  P P+YK P+  P P+YK P+ 
Sbjct: 299 KKPLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLP 358

Query: 326 KP-PVYKPPVEKP-PVYKPPVEKP-PVYKPP 409
            P P+YK P+  P PVYK P+  P PVYK P
Sbjct: 359 PPVPIYKKPLPPPVPVYKKPLPPPVPVYKKP 389

 Score =  111 bits (277), Expect = 3e-23
 Identities = 70/142 (49%), Positives = 86/142 (60%), Gaps = 11/142 (7%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-P 184
           P+YK P+  P     PIYK P+  P PVYK P+  P PVYK P+  P PVYK P+  P P
Sbjct: 351 PIYKKPLPPPV----PIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVP 406

Query: 185 VYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPP 349
           +YK P+  P P+YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P PVYK P
Sbjct: 407 IYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKP 466

Query: 350 V--EKPPVYKPPVEKPPVYKPP 409
              E P +  PP+   P+YK P
Sbjct: 467 CPPEIPKILPPPI---PIYKKP 485

 Score =  101 bits (252), Expect = 2e-20
 Identities = 70/155 (45%), Positives = 90/155 (58%), Gaps = 24/155 (15%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-P 184
           PVYK P+  P     P+YK P+  P P+YK P+  P P+YK P+  P PVYK P+  P P
Sbjct: 384 PVYKKPLPPPV----PVYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVP 439

Query: 185 VYKPPVEKP-PVYKPPVEKP-PVYKPPV--EKPPVYKPPV---EKP-----PVYKP--PV 322
           VYK P+  P PVYK P+  P PVYK P   E P +  PP+   +KP     P+YKP  P+
Sbjct: 440 VYKKPLPPPVPVYKKPLPPPVPVYKKPCPPEIPKILPPPIPIYKKPLPPFVPIYKPIPPI 499

Query: 323 EK-----PPVYKPPVEKPPVYKPPVEK-PPVYKPP 409
            K     PP+YK P   PP+ + P+ K PPV+K P
Sbjct: 500 SKPLPPFPPIYKKP--WPPIPQVPLPKFPPVHKFP 532

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 63/170 (37%), Positives = 79/170 (46%), Gaps = 39/170 (22%)
 Frame = +2

Query: 17   PVYK----PPVEKPPEYTP-PIYKPPVEKP-PVYKPPVEKPPV------YKPPVEKP--- 151
            PV+K    PPV KPP   P P+ + P+  P PVY  P+   PV        P VEKP   
Sbjct: 949  PVHKKSLPPPVPKPPLPPPVPVSQEPLPPPSPVYNEPLPPSPVPVLKKPIPPIVEKPLPP 1008

Query: 152  --PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKP-PVYKPP 319
              P++K P   PPV   PV K P   PP    PVY  P+  P P +K P   P P+ + P
Sbjct: 1009 PVPIFKKPALPPPV---PVYKKPPLPPPPPPVPVYGEPLPPPVPAFKKPYPPPLPIVEKP 1065

Query: 320  VEKP-PVYK--PPVEK-----------PPVYKP------PVEKPPVYKPP 409
            +  P P++K  PP+ K           PP+Y P      P  KP V  PP
Sbjct: 1066 LPPPIPIHKPIPPISKPAPTPEVLPAPPPIYSPKPPILNPTPKPKVLPPP 1115

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 61/159 (38%), Positives = 76/159 (47%), Gaps = 29/159 (18%)
 Frame = +2

Query: 17   PVYKPPVEKP---------PEYTPPIYKPPVEK----PPVYKPPVEKP-PVYKPPVEKP- 151
            PVYK P+  P         P   PP+   PV K    PPV KPP+  P PV + P+  P 
Sbjct: 923  PVYKKPLPPPVPIYKKPPLPSLPPPV---PVHKKSLPPPVPKPPLPPPVPVSQEPLPPPS 979

Query: 152  PVYKPPVEKPPV------YKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEK 298
            PVY  P+   PV        P VEKP     P++K P   PPV   PV K P   PP   
Sbjct: 980  PVYNEPLPPSPVPVLKKPIPPIVEKPLPPPVPIFKKPALPPPV---PVYKKPPLPPPPPP 1036

Query: 299  PPVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKP 406
             PVY  P+  P P +K P   P P+ + P+  P P++KP
Sbjct: 1037 VPVYGEPLPPPVPAFKKPYPPPLPIVEKPLPPPIPIHKP 1075

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 66/183 (36%), Positives = 79/183 (43%), Gaps = 52/183 (28%)
 Frame = +2

Query: 17   PVYKPPVEKPPEYTPPIYK-------PPV---EKPPVYKPPVEKPPVYKPPVEKPPVYKP 166
            P   PPV  PP   PP+YK       PP      P VY  P  +P  Y+P     P+Y  
Sbjct: 848  PEADPPVSHPPP--PPVYKQQIPPSVPPYTAPSPPQVYDQPSPQPVYYEPHPPPVPIYHK 905

Query: 167  PVEKP------------PVYKPPVEKP-PVYK--------PPVE------KPPVYKPPVE 265
            P+  P            PVYK P+  P P+YK        PPV        PPV KPP+ 
Sbjct: 906  PLPPPVRVYGQPFPSPVPVYKKPLPPPVPIYKKPPLPSLPPPVPVHKKSLPPPVPKPPLP 965

Query: 266  KP-PVYKPPVEKP-PVYKPPVEKPPV------YKPPVEKP-----PVYKPPVEKP--PVY 400
             P PV + P+  P PVY  P+   PV        P VEKP     P++K P   P  PVY
Sbjct: 966  PPVPVSQEPLPPPSPVYNEPLPPSPVPVLKKPIPPIVEKPLPPPVPIFKKPALPPPVPVY 1025

Query: 401  KPP 409
            K P
Sbjct: 1026 KKP 1028

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 57/157 (36%), Positives = 75/157 (47%), Gaps = 25/157 (15%)
 Frame = +2

Query: 14   PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVY 190
            PP+ + P+  P     PI+K P   PPV   PV K P   PP    PVY  P+  P P +
Sbjct: 999  PPIVEKPLPPP----VPIFKKPALPPPV---PVYKKPPLPPPPPPVPVYGEPLPPPVPAF 1051

Query: 191  KPPVEKP-PVYKPPVEKP-PVYK--PPVEK-----------PPVY--KPPVEKP---PVY 310
            K P   P P+ + P+  P P++K  PP+ K           PP+Y  KPP+  P   P  
Sbjct: 1052 KKPYPPPLPIVEKPLPPPIPIHKPIPPISKPAPTPEVLPAPPPIYSPKPPILNPTPKPKV 1111

Query: 311  KPPVEKPPVYKPPVEKP-PVYKP---PVEKPPVYKPP 409
             PP +  P+ K P+  P P+ KP       PPVYK P
Sbjct: 1112 LPPPQPVPITKKPLPPPVPIQKPVPAAQNPPPVYKKP 1148

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 60/163 (36%), Positives = 76/163 (46%), Gaps = 28/163 (17%)
 Frame = +2

Query: 5    VEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKP 181
            VEKP     P+ K P   PP+   PV K P   PP    PVY  P+  P P +K P   P
Sbjct: 1002 VEKPLPPPVPIFKKPALPPPV---PVYKKPPLPPPPPPVPVYGEPLPPPVPAFKKPYPPP 1058

Query: 182  -PVYKPPVEKP-PVYKP--PVEKP-----------PVYKPPVEKPPVY----KPPVEKPP 304
             P+ + P+  P P++KP  P+ KP           P+Y P   KPP+     KP V  PP
Sbjct: 1059 LPIVEKPLPPPIPIHKPIPPISKPAPTPEVLPAPPPIYSP---KPPILNPTPKPKVLPPP 1115

Query: 305  VYKPPVEKP-----PVYKP---PVEKPPVYKPPVEKPPVYKPP 409
               P  +KP     P+ KP       PPVYK P+  PP+ K P
Sbjct: 1116 QPVPITKKPLPPPVPIQKPVPAAQNPPPVYKKPL--PPIPKAP 1156

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 61/159 (38%), Positives = 72/159 (45%), Gaps = 29/159 (18%)
 Frame = +2

Query: 17   PVYK-PPVEKPPEYTPPIYK------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---- 163
            P YK PP+   P +  P+ K       PV  P  Y  P   PPV  PP   PPVYK    
Sbjct: 811  PFYKYPPLPTLPHWPKPLPKFYLPPFSPVPTPITYPAPEADPPVSHPP--PPPVYKQQIP 868

Query: 164  ---PPV---EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKP-PVYKPP 319
               PP      P VY  P  +P  Y+P     P+Y  P+  P  VY  P   P PVYK P
Sbjct: 869  PSVPPYTAPSPPQVYDQPSPQPVYYEPHPPPVPIYHKPLPPPVRVYGQPFPSPVPVYKKP 928

Query: 320  VEKP-PVY-KPPVEK--PPV------YKPPVEKPPVYKP 406
            +  P P+Y KPP+    PPV        PPV KPP+  P
Sbjct: 929  LPPPVPIYKKPPLPSLPPPVPVHKKSLPPPVPKPPLPPP 967

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 58/155 (37%), Positives = 79/155 (50%), Gaps = 24/155 (15%)
 Frame = +2

Query: 17   PVYKPPVEKPPEYTPPIYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKP--PVEKP 181
            PVYK P   PP    P+Y  P+  P P +K P   P P+ + P+  P P++KP  P+ KP
Sbjct: 1023 PVYKKPPLPPPPPPVPVYGEPLPPPVPAFKKPYPPPLPIVEKPLPPPIPIHKPIPPISKP 1082

Query: 182  -----------PVY--KPPVEKP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVY 310
                       P+Y  KPP+  P   P   PP +  P+ K P+  PPV   P++KP P  
Sbjct: 1083 APTPEVLPAPPPIYSPKPPILNPTPKPKVLPPPQPVPITKKPL-PPPV---PIQKPVPAA 1138

Query: 311  KPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPP 409
            + P   PPVYK P+  PP+ K P   + PP+ K P
Sbjct: 1139 QNP---PPVYKKPL--PPIPKAPALPKLPPLPKTP 1168

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 54/138 (39%), Positives = 69/138 (50%), Gaps = 23/138 (16%)
 Frame = +2

Query: 5    VEKP-----PVYKP--PVEKP---PEYTP---PIY--KPPVEKP---PVYKPPVEKPPVY 130
            VEKP     P++KP  P+ KP   PE  P   PIY  KPP+  P   P   PP +  P+ 
Sbjct: 1062 VEKPLPPPIPIHKPIPPISKPAPTPEVLPAPPPIYSPKPPILNPTPKPKVLPPPQPVPIT 1121

Query: 131  KPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVE-- 295
            K P+  PPV   P++KP P  + P   PPVYK P+  PP+ K P   + PP+ K P +  
Sbjct: 1122 KKPL-PPPV---PIQKPVPAAQNP---PPVYKKPL--PPIPKAPALPKLPPLPKTPPKYF 1172

Query: 296  KPPVYKPPVEKPPVYKPP 349
              P Y     KPP    P
Sbjct: 1173 YHPKYGLGNAKPPSSSHP 1190

[113][TOP]
>UniRef100_B4I114 GM12332 n=1 Tax=Drosophila sechellia RepID=B4I114_DROSE
          Length = 1214

 Score =  117 bits (294), Expect = 3e-25
 Identities = 47/112 (41%), Positives = 66/112 (58%)
 Frame = +2

Query: 56   TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 235
            TPP  +PP E PP Y PP  +PP  +PP  +PP  +PP  +PP ++PP  +PP  +PP  
Sbjct: 1074 TPPT-QPPTE-PPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTN 1131

Query: 236  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 391
            +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  + P  +PP   P
Sbjct: 1132 QPPTVQPPTVQPPTNQPPTVQPPTVQPPTHHPPTNEPPTNRSPTKRPPSPSP 1183

 Score =  117 bits (293), Expect = 4e-25
 Identities = 45/111 (40%), Positives = 64/111 (57%)
 Frame = +2

Query: 29   PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 208
            PP + P E  PP Y PP  +PP  +PP  +PP  +PP  +PP ++PP  +PP  +PP  +
Sbjct: 1075 PPTQPPTE--PPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQ 1132

Query: 209  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
            PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  + P  +PP   P
Sbjct: 1133 PPTVQPPTVQPPTNQPPTVQPPTVQPPTHHPPTNEPPTNRSPTKRPPSPSP 1183

 Score =  117 bits (292), Expect = 5e-25
 Identities = 45/110 (40%), Positives = 66/110 (60%)
 Frame = +2

Query: 17   PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
            P  +PP E PP Y PP  +PP  +PP ++PP  +PP  +PP  +PP  +PP  +PP  +P
Sbjct: 1075 PPTQPPTE-PPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQP 1133

Query: 197  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
            P  +PP  +PP  +PP  +PP  +PP + PP  +PP  + P ++PP   P
Sbjct: 1134 PTVQPPTVQPPTNQPPTVQPPTVQPPTHHPPTNEPPTNRSPTKRPPSPSP 1183

 Score =  115 bits (287), Expect = 2e-24
 Identities = 44/106 (41%), Positives = 63/106 (59%)
 Frame = +2

Query: 92   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 271
            P  +PP E PP Y PP  +PP  +PP  +PP  +PP  +PP ++PP  +PP  +PP  +P
Sbjct: 1075 PPTQPPTE-PPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQP 1133

Query: 272  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            P  +PP  +PP  +PP  +PP  +PP   PP  +PP  + P  +PP
Sbjct: 1134 PTVQPPTVQPPTNQPPTVQPPTVQPPTHHPPTNEPPTNRSPTKRPP 1179

 Score =  112 bits (280), Expect = 1e-23
 Identities = 41/102 (40%), Positives = 61/102 (59%)
 Frame = +2

Query: 11   KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
            +PP Y PP  +PP   PP ++PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 1082 EPPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQPPTVQPPTV 1141

Query: 191  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 316
            +PP  +PP  +PP  +PP + PP  +PP  + P ++PP   P
Sbjct: 1142 QPPTNQPPTVQPPTVQPPTHHPPTNEPPTNRSPTKRPPSPSP 1183

[114][TOP]
>UniRef100_P13983 Extensin n=1 Tax=Nicotiana tabacum RepID=EXTN_TOBAC
          Length = 620

 Score =  117 bits (294), Expect = 3e-25
 Identities = 65/145 (44%), Positives = 68/145 (46%), Gaps = 13/145 (8%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP--IYKPPVEK-----------PPVYKPPVEKPPVYKPPVEKPP 154
           PPVY PP   PP Y+PP   Y PP              PP Y+     PP Y PP+  PP
Sbjct: 350 PPVYSPP--PPPSYSPPPPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPP 407

Query: 155 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
            Y PP   PP Y PP   PP Y  P   PP Y PP   PP Y PP   PP Y PP   PP
Sbjct: 408 TYSPP---PPTYSPP---PPTYAQPPPLPPTYSPP---PPAYSPP--PPPTYSPP---PP 453

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKPP 409
            Y PP   PP Y  P   PP Y PP
Sbjct: 454 TYSPP---PPAYAQPPPPPPTYSPP 475

 Score =  117 bits (293), Expect = 4e-25
 Identities = 63/138 (45%), Positives = 67/138 (48%), Gaps = 6/138 (4%)
 Frame = +2

Query: 14  PPVYKPPVEK----PPEYTPP--IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 175
           PP Y PP       PP ++PP   Y+     PP Y PP+  PP Y PP   PP Y PP  
Sbjct: 365 PPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAPPTYSPP---PPTYSPP-- 419

Query: 176 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 355
            PP Y  P   PP Y PP   PP Y PP   PP Y PP   PP Y PP   PP Y  P  
Sbjct: 420 -PPTYAQPPPLPPTYSPP---PPAYSPP--PPPTYSPP---PPTYSPP---PPAYAQPPP 467

Query: 356 KPPVYKPPVEKPPVYKPP 409
            PP Y PP   PP Y PP
Sbjct: 468 PPPTYSPP---PPAYSPP 482

 Score =  117 bits (292), Expect = 5e-25
 Identities = 66/140 (47%), Positives = 69/140 (49%), Gaps = 8/140 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP---- 169
           PP Y PP   PP Y P    PIY PP   PPVY PP   PP Y PP   PP Y PP    
Sbjct: 327 PPTYSPP---PPTYLPLPSSPIYSPP---PPVYSPP--PPPSYSPP---PPTYLPPPPPS 375

Query: 170 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 349
              PP + PP   PP Y+     PP Y PP+  PP Y PP   PP Y PP   PP Y  P
Sbjct: 376 SPPPPSFSPP---PPTYEQSPPPPPAYSPPLPAPPTYSPP---PPTYSPP---PPTYAQP 426

Query: 350 VEKPPVYKPPVEKPPVYKPP 409
              PP Y PP   PP Y PP
Sbjct: 427 PPLPPTYSPP---PPAYSPP 443

 Score =  117 bits (292), Expect = 5e-25
 Identities = 64/137 (46%), Positives = 67/137 (48%), Gaps = 5/137 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP + PP   PP Y      PP Y PP+  PP Y PP   PP Y PP   PP Y  P   
Sbjct: 379 PPSFSPP---PPTYEQSPPPPPAYSPPLPAPPTYSPP---PPTYSPP---PPTYAQPPPL 429

Query: 179 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 358
           PP Y PP   PP Y PP   PP Y PP   PP Y PP   PP Y  P   PP Y PP   
Sbjct: 430 PPTYSPP---PPAYSPP--PPPTYSPP---PPTYSPP---PPAYAQPPPPPPTYSPP--- 475

Query: 359 PPVYKPPVEKPPVYKPP 409
           PP Y PP    P+Y PP
Sbjct: 476 PPAYSPP-PPSPIYSPP 491

 Score =  114 bits (284), Expect = 4e-24
 Identities = 61/136 (44%), Positives = 66/136 (48%), Gaps = 4/136 (2%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP Y PP+  PP Y+PP        PP Y PP   PP Y  P   PP Y PP   PP Y 
Sbjct: 396 PPAYSPPLPAPPTYSPP--------PPTYSPP---PPTYAQPPPLPPTYSPP---PPAYS 441

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 373
           PP   PP Y PP   PP Y PP   PP Y  P   PP Y PP   PP Y PP    P+Y 
Sbjct: 442 PP--PPPTYSPP---PPTYSPP---PPAYAQPPPPPPTYSPP---PPAYSPP-PPSPIYS 489

Query: 374 PPVEK----PPVYKPP 409
           PP  +    PP + PP
Sbjct: 490 PPPPQVQPLPPTFSPP 505

 Score =  106 bits (265), Expect = 7e-22
 Identities = 64/165 (38%), Positives = 70/165 (42%), Gaps = 33/165 (20%)
 Frame = +2

Query: 14  PPVYKPPVEK------PPEYTP-------PIYKPP---VEKPPVYKP------PVEKPPV 127
           PP Y PP         PP Y+P       P + PP      PP Y P      P+   P+
Sbjct: 286 PPTYSPPPPSPIYSPPPPAYSPSPPPTPTPTFSPPPPAYSPPPTYSPPPPTYLPLPSSPI 345

Query: 128 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-----------VEKPPVYKPPVEKPP 274
           Y PP   PPVY PP   PP Y PP   PP Y PP              PP Y+     PP
Sbjct: 346 YSPP---PPVYSPP--PPPSYSPP---PPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPP 397

Query: 275 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
            Y PP+  PP Y PP   PP Y PP   PP Y  P   PP Y PP
Sbjct: 398 AYSPPLPAPPTYSPP---PPTYSPP---PPTYAQPPPLPPTYSPP 436

 Score =  105 bits (262), Expect = 2e-21
 Identities = 63/150 (42%), Positives = 70/150 (46%), Gaps = 19/150 (12%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTP----PIYKPPVEKPPVY--KPPVEKPPVYKPP---VEKPPVYKP- 166
           P Y PP   PP Y+P    PIY PP   PP Y   PP    P + PP      PP Y P 
Sbjct: 280 PTYSPP---PPTYSPPPPSPIYSPP---PPAYSPSPPPTPTPTFSPPPPAYSPPPTYSPP 333

Query: 167 -----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP----VEKPPVYKPP 319
                P+   P+Y PP   PPVY PP   PP Y PP   PP Y PP       PP + PP
Sbjct: 334 PPTYLPLPSSPIYSPP---PPVYSPP--PPPSYSPP---PPTYLPPPPPSSPPPPSFSPP 385

Query: 320 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
              PP Y+     PP Y PP+  PP Y PP
Sbjct: 386 ---PPTYEQSPPPPPAYSPPLPAPPTYSPP 412

 Score =  103 bits (258), Expect = 5e-21
 Identities = 60/143 (41%), Positives = 67/143 (46%), Gaps = 11/143 (7%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT--PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PP Y PP   PP Y+  PP Y  P   PP Y PP   PP Y PP   PP Y PP   PP 
Sbjct: 406 PPTYSPP---PPTYSPPPPTYAQPPPLPPTYSPP---PPAYSPP--PPPTYSPP---PPT 454

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPPVE 355
           Y PP   PP Y  P   PP Y PP   PP Y PP    P+Y PP  +    PP + PP  
Sbjct: 455 YSPP---PPAYAQPPPPPPTYSPP---PPAYSPP-PPSPIYSPPPPQVQPLPPTFSPPPP 507

Query: 356 K-----PPVYKPPVEKPPVYKPP 409
           +     PP ++ P    P Y  P
Sbjct: 508 RRIHLPPPPHRQPRPPTPTYGQP 530

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 56/141 (39%), Positives = 64/141 (45%), Gaps = 9/141 (6%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           PP Y  P   PP Y+PP        PP Y PP   PP Y PP   PP Y PP   PP Y 
Sbjct: 420 PPTYAQPPPLPPTYSPP--------PPAYSPP--PPPTYSPP---PPTYSPP---PPAYA 463

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPPVEK-----PPVYKP 346
            P   PP Y PP   PP Y PP    P+Y PP  +    PP + PP  +     PP ++ 
Sbjct: 464 QPPPPPPTYSPP---PPAYSPP-PPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQ 519

Query: 347 PVEKPPVYKPPVEKPPVYKPP 409
           P    P Y  P   PP + PP
Sbjct: 520 PRPPTPTYGQP-PSPPTFSPP 539

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 59/141 (41%), Positives = 65/141 (46%), Gaps = 5/141 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           R  +PP Y PP        PP Y    +  P Y PP   PP Y PP   P +Y PP   P
Sbjct: 258 RQPQPPTYSPP--------PPAYAQSPQPSPTYSPP---PPTYSPPPPSP-IYSPP---P 302

Query: 182 PVY--KPPVEKPPVYKPP---VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
           P Y   PP    P + PP      PP Y PP   PP Y  P+   P+Y PP   PPVY P
Sbjct: 303 PAYSPSPPPTPTPTFSPPPPAYSPPPTYSPP---PPTYL-PLPSSPIYSPP---PPVYSP 355

Query: 347 PVEKPPVYKPPVEKPPVYKPP 409
           P   PP Y PP   PP Y PP
Sbjct: 356 P--PPPSYSPP---PPTYLPP 371

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 56/150 (37%), Positives = 68/150 (45%), Gaps = 18/150 (12%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPP---IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 184
           PP Y PP   PP Y+PP    Y PP   PP Y PP   PP Y  P   PP Y PP   PP
Sbjct: 430 PPTYSPP---PPAYSPPPPPTYSPP---PPTYSPP---PPAYAQPPPPPPTYSPP---PP 477

Query: 185 VYKPPVEKPPVYKPPVEK----PPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPV 337
            Y PP    P+Y PP  +    PP + PP  +     PP ++ P    P Y  P   PP 
Sbjct: 478 AYSPP-PPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQP-PSPPT 535

Query: 338 YKPPVEK------PPVYKPPVEKPPVYKPP 409
           + PP  +      PP ++P    P   +PP
Sbjct: 536 FSPPPPRQIHSPPPPHWQPRTPTPTYGQPP 565

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 51/152 (33%), Positives = 67/152 (44%), Gaps = 20/152 (13%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP----PIYKPPVEK----PPVYKPPVEK-----PPVYKPPVEKPP 154
           PP Y PP   PP Y+P    PIY PP  +    PP + PP  +     PP ++ P    P
Sbjct: 469 PPTYSPP---PPAYSPPPPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTP 525

Query: 155 VYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 328
            Y  P   PP + PP   PP  ++ PP   PP ++P    P   +PP   PP +  P  +
Sbjct: 526 TYGQP-PSPPTFSPP---PPRQIHSPP---PPHWQPRTPTPTYGQPP--SPPTFSAPPPR 576

Query: 329 -----PPVYKPPVEKPPVYKPPVEKPPVYKPP 409
                PP ++ P    P Y  P   P  Y PP
Sbjct: 577 QIHSPPPPHRQPRPPTPTYGQPPSPPTTYSPP 608

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 51/162 (31%), Positives = 65/162 (40%), Gaps = 26/162 (16%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPP--VEKPPVYKPPVE 175
           R + PP ++ P        PP        PP Y  P    P+Y P   V+ PP Y PP  
Sbjct: 159 RGQHPPSHRRPSPPSRHGHPP--------PPTYAQP-PPTPIYSPSPQVQPPPTYSPP-- 207

Query: 176 KPPVYKPPVEKPPV-----------YKPPVEK--PPVYKP-PVE----------KPPVYK 283
            PP +  P   PP            + PP  +  PP ++P P+           +PP Y 
Sbjct: 208 -PPTHVQPTPSPPSRGHQPQPPTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTYS 266

Query: 284 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           PP   PP Y    +  P Y PP   PP Y PP    P+Y PP
Sbjct: 267 PP---PPAYAQSPQPSPTYSPP---PPTYSPP-PPSPIYSPP 301

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 43/133 (32%), Positives = 58/133 (43%), Gaps = 4/133 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPV 187
           PP + PP  +     PP ++ P    P Y  P   PP + PP   PP  ++ PP   PP 
Sbjct: 499 PPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQP-PSPPTFSPP---PPRQIHSPP---PPH 551

Query: 188 YKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           ++P    P   +PP   PP +  P   PP  ++ P    PP ++ P    P Y  P   P
Sbjct: 552 WQPRTPTPTYGQPP--SPPTFSAP---PPRQIHSP----PPPHRQPRPPTPTYGQPPSPP 602

Query: 362 PVYKPPVEKPPVY 400
             Y PP   PP Y
Sbjct: 603 TTYSPP--SPPPY 613

[115][TOP]
>UniRef100_UPI000175F187 PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI000175F187
          Length = 557

 Score =  117 bits (293), Expect = 4e-25
 Identities = 56/111 (50%), Positives = 67/111 (60%)
 Frame = +2

Query: 74  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 253
           P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  
Sbjct: 136 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 195

Query: 254 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 196 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 246

 Score =  115 bits (288), Expect = 2e-24
 Identities = 56/121 (46%), Positives = 69/121 (57%)
 Frame = +2

Query: 44  PPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 223
           P    PP+  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  
Sbjct: 136 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 195

Query: 224 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
           P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+  +  
Sbjct: 196 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSTMPV 255

Query: 404 P 406
           P
Sbjct: 256 P 256

 Score =  114 bits (284), Expect = 4e-24
 Identities = 58/128 (45%), Positives = 71/128 (55%), Gaps = 2/128 (1%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 193
           P   +PPV  P    PP+  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  
Sbjct: 136 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 195

Query: 194 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP--PV 367
           P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+   PV
Sbjct: 196 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSTMPV 255

Query: 368 YKPPVEKP 391
              P+  P
Sbjct: 256 PVRPLALP 263

 Score =  106 bits (265), Expect = 7e-22
 Identities = 57/125 (45%), Positives = 70/125 (56%), Gaps = 7/125 (5%)
 Frame = +2

Query: 8   EKPPVYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           E+PPV  P  E+PP   P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 139 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 198

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP--PVYKP 346
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+   PV   
Sbjct: 199 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSTMPVPVR 258

Query: 347 PVEKP 361
           P+  P
Sbjct: 259 PLALP 263

 Score =  100 bits (250), Expect = 4e-20
 Identities = 62/163 (38%), Positives = 76/163 (46%), Gaps = 34/163 (20%)
 Frame = +2

Query: 20  VYKPPVEKPPEYTPPIYKPPV-----EKPPVYKPPVEKPPV------------------- 127
           V KPP  +P E    +   PV     + PPV  P  E+ P                    
Sbjct: 74  VRKPPFSEPLESLLELCDKPVSILVPQSPPVSAPVPEQAPSPDDTALTSKTTRRGRRRKR 133

Query: 128 -----YKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 277
                 +PPV     E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 134 MAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 193

Query: 278 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
             P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 194 SAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 236

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 46/115 (40%), Positives = 58/115 (50%)
 Frame = +2

Query: 47  PEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 226
           P   PP+   PV+  PV   PV+ PPV   PV+ PPV   P + PP    P + PP    
Sbjct: 373 PVQLPPVPPAPVQLLPVPPAPVQLPPVPPAPVQLPPVPPAPAQLPPA---PAQLPPA--- 426

Query: 227 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 391
           P + PP    P + PP    P + PPV   PV+ PPV   PV+ PPV   PV+ P
Sbjct: 427 PAQLPPA---PAQLPPA---PAQLPPVPPAPVQLPPVPPAPVQLPPVPSAPVQLP 475

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/115 (40%), Positives = 57/115 (49%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           PV  PPV   P    P+   PV+ PPV   PV+ PPV   P + PP    P + PP    
Sbjct: 373 PVQLPPVPPAPVQLLPVPPAPVQLPPVPPAPVQLPPVPPAPAQLPPA---PAQLPPA--- 426

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
           P + PP    P + PP    P + PPV   PV+ PPV   PV+ PPV   PV+ P
Sbjct: 427 PAQLPPA---PAQLPPA---PAQLPPVPPAPVQLPPVPPAPVQLPPVPSAPVQLP 475

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/111 (41%), Positives = 57/111 (51%)
 Frame = +2

Query: 77  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 256
           PV+ PPV   PV+  PV   PV+ PPV   PV+ PPV   P + PP    P + PP    
Sbjct: 373 PVQLPPVPPAPVQLLPVPPAPVQLPPVPPAPVQLPPVPPAPAQLPPA---PAQLPPA--- 426

Query: 257 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 409
           P + PP    P + PP    P + PPV   PV+ PPV   PV+ PPV   P
Sbjct: 427 PAQLPPA---PAQLPPA---PAQLPPVPPAPVQLPPVPPAPVQLPPVPSAP 471

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 36/113 (31%), Positives = 48/113 (42%)
 Frame = +1

Query: 73  APS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPSLQ 252
           AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P + 
Sbjct: 135 APAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVS 194

Query: 253 TSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAPS 411
               E   V  P  E P +     E   V AP+ E P + AP  E P + AP+
Sbjct: 195 APAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 247

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 34/114 (29%), Positives = 47/114 (41%)
 Frame = +1

Query: 67  LQAPS*ETTRLQTPGRKATGVQAPSGETTSVQTPSREASSVQTSC*ETPSVQAPS*EAPS 246
           + AP+ E   +  P  +   V AP+ E   V  P+ E   V     E P V AP+ E P 
Sbjct: 143 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 202

Query: 247 LQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS*ETPSLQAPGREAPSLQAP 408
           +     E   V  P  E P +     E   V AP+ E P + AP  E  ++  P
Sbjct: 203 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSTMPVP 256

[116][TOP]
>UniRef100_Q39599 Extensin n=1 Tax=Catharanthus roseus RepID=Q39599_CATRO
          Length = 225

 Score =  117 bits (293), Expect = 4e-25
 Identities = 72/145 (49%), Positives = 76/145 (52%), Gaps = 13/145 (8%)
 Frame = +2

Query: 14  PPVYKPPVE-KPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKP 181
           PP Y PP   K P   PP++K P   PP YK P   PPVYK P   P  YK   PP  KP
Sbjct: 21  PPHYSPPYHYKSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYKSPPPPPHKP 80

Query: 182 PVYKPPVEKPPVYK---PPVEKPPVYK-PPVEKPPVYKPPVEK----PPVYKPPVEKPPV 337
             YK P   PPVYK   PP  KP  YK PP   PP +KP   K    PPVYKPP     V
Sbjct: 81  YKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPY----V 136

Query: 338 YKPPVEKPPVYK-PPVEKPPVYKPP 409
           YK P   P V+K PP   PPVYK P
Sbjct: 137 YKSPPPPPSVHKYPPPSPPPVYKSP 161

 Score =  117 bits (293), Expect = 4e-25
 Identities = 76/159 (47%), Positives = 81/159 (50%), Gaps = 26/159 (16%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYK---PPVEKPPVYKPPVEKP 181
           K P   PPV K P   PP YK P   PPVYK P   P  YK   PP  KP  YK P   P
Sbjct: 31  KSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYKSPPPPPHKPYKYKSPPPPP 90

Query: 182 PVYK---PPVEKPPVYK-PPVEKPPVYK---------PPVEKPP-VYKPPVEKPPVYK-P 316
           PVYK   PP  KP  YK PP   PP +K         PPV KPP VYK P   P V+K P
Sbjct: 91  PVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVHKYP 150

Query: 317 PVEKPPVYK----PPVEKPPVYK----PPVEKPPVYKPP 409
           P   PPVYK    PP +KP  YK    PP+ K P+  PP
Sbjct: 151 PPSPPPVYKSPPSPPPKKPYKYKSPPPPPIHKSPLPSPP 189

 Score =  109 bits (272), Expect = 1e-22
 Identities = 75/154 (48%), Positives = 81/154 (52%), Gaps = 22/154 (14%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT---PPIYK-----PPVEKPPVYKPPVEKPPVYK---PPVEKPPVY 160
           PP YK P   PP Y    PP YK     PP  KP  YK P   PPVYK   PP  KP  Y
Sbjct: 47  PPFYKSPPPPPPVYKSPPPPPYKYKSPPPPPHKPYKYKSPPPPPPVYKSPPPPPHKPYKY 106

Query: 161 K-PPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYK-PPVEKPPVYK----PP 319
           K PP   PP +KP   K P   PPV KPP VYK P   P V+K PP   PPVYK    PP
Sbjct: 107 KSPPPPPPPPHKPYKYKSPP-PPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVYKSPPSPP 165

Query: 320 VEKPPVYK----PPVEKPPVYKPPVEKPPVYKPP 409
            +KP  YK    PP+ K P+  PP +KP  YK P
Sbjct: 166 PKKPYKYKSPPPPPIHKSPLPSPP-KKPYKYKYP 198

 Score =  105 bits (261), Expect = 2e-21
 Identities = 70/148 (47%), Positives = 77/148 (52%), Gaps = 16/148 (10%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKPPVYK---PPVEKPPVYK-PPVEKPPVYKPPVEKP 181
           PP YK     PP + P  YK P   PPVYK   PP  KP  YK PP   PP +KP   K 
Sbjct: 65  PPPYKYKSPPPPPHKPYKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKS 124

Query: 182 PVYKPPVEKPP-VYKPPVEKPPVYK-PPVEKPPVYK----PPVEKPPVYKPPVEKPPVYK 343
           P   PPV KPP VYK P   P V+K PP   PPVYK    PP +KP  YK P   PP++K
Sbjct: 125 PP-PPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVYKSPPSPPPKKPYKYKSP-PPPPIHK 182

Query: 344 PPVEKPP------VYKPPVEKPPVYKPP 409
            P+  PP       Y PP    PVYK P
Sbjct: 183 SPLPSPPKKPYKYKYPPPT---PVYKSP 207

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 59/138 (42%), Positives = 68/138 (49%), Gaps = 5/138 (3%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEK 178
           + + PP   PP  KP +Y  P   PP   PPVYKPP     VYK P   P V+K PP   
Sbjct: 105 KYKSPPPPPPPPHKPYKYKSP---PP---PPVYKPPY----VYKSPPPPPSVHKYPPPSP 154

Query: 179 PPVYK----PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 346
           PPVYK    PP +KP  YK P   PP   PP+ K P+  PP +KP  YK P   P    P
Sbjct: 155 PPVYKSPPSPPPKKPYKYKSP---PP---PPIHKSPLPSPP-KKPYKYKYPPPTPVYKSP 207

Query: 347 PVEKPPVYKPPVEKPPVY 400
           P     +Y  P   PP Y
Sbjct: 208 PPPHHYLYTSP--PPPPY 223

[117][TOP]
>UniRef100_Q1XBU0 Foot protein 1 n=1 Tax=Mytilus edulis RepID=Q1XBU0_MYTED
          Length = 565

 Score =  117 bits (293), Expect = 4e-25
 Identities = 60/144 (41%), Positives = 66/144 (45%), Gaps = 13/144 (9%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----------PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 160
           PPVYKP +  PP Y P           P YKP +  PP YK     PP YKP    PP Y
Sbjct: 124 PPVYKPKMTYPPTYKPKPSYPPTYKSKPTYKPKITCPPTYKAKPSYPPTYKPKKTYPPTY 183

Query: 161 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
           KP V  PP YKP    PP+YK      P YKP +  PP YK     PP YK     PP Y
Sbjct: 184 KPKVTYPPTYKPKPSYPPIYK----SKPTYKPKITYPPTYKAKPSYPPTYKAKPSYPPTY 239

Query: 341 --KPPVEKPPVYKPPVEKPPVYKP 406
             KP  +  P Y    +  P Y P
Sbjct: 240 KAKPTYKAKPTYPSTYKAKPTYPP 263

 Score =  112 bits (280), Expect = 1e-23
 Identities = 57/129 (44%), Positives = 62/129 (48%), Gaps = 2/129 (1%)
 Frame = +2

Query: 23  YKPPVEKPPEYTP--PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 196
           Y P  +K   Y P    Y      PPVYKP +  PP YKP    PP YK      P YKP
Sbjct: 100 YLPLAKKLSSYKPIKTTYNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYK----SKPTYKP 155

Query: 197 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 376
            +  PP YK     PP YKP    PP YKP V  PP YKP    PP+YK      P YKP
Sbjct: 156 KITCPPTYKAKPSYPPTYKPKKTYPPTYKPKVTYPPTYKPKPSYPPIYK----SKPTYKP 211

Query: 377 PVEKPPVYK 403
            +  PP YK
Sbjct: 212 KITYPPTYK 220

 Score =  112 bits (279), Expect = 2e-23
 Identities = 57/138 (41%), Positives = 61/138 (44%), Gaps = 7/138 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPV 172
           PP YKP +  PP Y      P  YK     PP YK     PP YK  P  +  P Y    
Sbjct: 390 PPTYKPKISYPPTYKAKPSYPSTYKAKSSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTY 449

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           +  P YK     PP YK     PP YKP    PP YK     P  YKP    PP YKP +
Sbjct: 450 KAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKL 509

Query: 353 EKPPVYKPPVEKPPVYKP 406
             PP YKP    PP YKP
Sbjct: 510 TYPPTYKPKPSYPPSYKP 527

 Score =  110 bits (276), Expect = 4e-23
 Identities = 60/140 (42%), Positives = 63/140 (45%), Gaps = 11/140 (7%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYT-----PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 181
           P YKP +  PP Y      PP YKP    PP YKP V  PP YKP    PP+YK      
Sbjct: 151 PTYKPKITCPPTYKAKPSYPPTYKPKKTYPPTYKPKVTYPPTYKPKPSYPPIYK----SK 206

Query: 182 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEK-----PPVYKPPVEKPPVYK 343
           P YKP +  PP YK     PP YK     PP YK  P  K     P  YK     PP YK
Sbjct: 207 PTYKPKITYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPPTYK 266

Query: 344 PPVEKPPVYKPPVEKPPVYK 403
                PP YK     PP YK
Sbjct: 267 AKPSYPPTYKAKPSYPPTYK 286

 Score =  110 bits (275), Expect = 5e-23
 Identities = 62/168 (36%), Positives = 68/168 (40%), Gaps = 37/168 (22%)
 Frame = +2

Query: 11  KPPVYK---------PPVEKPPEY----------------------------TPPIYKPP 79
           KPP Y+         P    PP Y                             PP+YKP 
Sbjct: 71  KPPTYQQLKKKVDYRPTKSYPPTYGSKTNYLPLAKKLSSYKPIKTTYNAKTNYPPVYKPK 130

Query: 80  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 259
           +  PP YKP    PP YK      P YKP +  PP YK     PP YKP    PP YKP 
Sbjct: 131 MTYPPTYKPKPSYPPTYK----SKPTYKPKITCPPTYKAKPSYPPTYKPKKTYPPTYKPK 186

Query: 260 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
           V  PP YKP    PP+YK      P YKP +  PP YK     PP YK
Sbjct: 187 VTYPPTYKPKPSYPPIYK----SKPTYKPKITYPPTYKAKPSYPPTYK 230

 Score =  107 bits (267), Expect = 4e-22
 Identities = 54/136 (39%), Positives = 57/136 (41%), Gaps = 7/136 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-------TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PP YK     PP Y         P Y    +  P YK     PP YK     PP YKP  
Sbjct: 420 PPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKP 479

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
             PP YK     P  YKP    PP YKP +  PP YKP    PP YKP +  P  YK   
Sbjct: 480 SYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKP 539

Query: 353 EKPPVYKPPVEKPPVY 400
             PP YK     PP Y
Sbjct: 540 SYPPTYKSKTSYPPTY 555

 Score =  107 bits (266), Expect = 5e-22
 Identities = 55/141 (39%), Positives = 61/141 (43%), Gaps = 7/141 (4%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEYT-----PPIYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY 160
           ++  PP YK     P  Y      PP YK     PP Y  KP  +  P Y    +  P Y
Sbjct: 396 KISYPPTYKAKPSYPSTYKAKSSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTY 455

Query: 161 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 340
           K     PP YK     PP YKP    PP YK     P  YKP    PP YKP +  PP Y
Sbjct: 456 KAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPTY 515

Query: 341 KPPVEKPPVYKPPVEKPPVYK 403
           KP    PP YKP +  P  YK
Sbjct: 516 KPKPSYPPSYKPKITYPSTYK 536

 Score =  104 bits (260), Expect = 3e-21
 Identities = 54/136 (39%), Positives = 58/136 (42%), Gaps = 7/136 (5%)
 Frame = +2

Query: 14  PPVYK--PPVEKPPEY-----TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PP YK  P  +  P Y       P YK     PP YK     PP YKP    PP YK   
Sbjct: 430 PPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKS 489

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
             P  YKP    PP YKP +  PP YKP    PP YKP +  P  YK     PP YK   
Sbjct: 490 SYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKT 549

Query: 353 EKPPVYKPPVEKPPVY 400
             PP Y   +  P  Y
Sbjct: 550 SYPPTYNKKISYPSQY 565

 Score =  101 bits (251), Expect = 3e-20
 Identities = 59/144 (40%), Positives = 66/144 (45%), Gaps = 14/144 (9%)
 Frame = +2

Query: 17  PVYKP-PVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYK------PPVEKPPVYKP--- 166
           PVYKP        Y PP Y+  ++K   Y+P    PP Y       P  +K   YKP   
Sbjct: 57  PVYKPVKTSYSAPYKPPTYQQ-LKKKVDYRPTKSYPPTYGSKTNYLPLAKKLSSYKPIKT 115

Query: 167 ----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 334
                   PPVYKP +  PP YKP    PP YK      P YKP +  PP YK     PP
Sbjct: 116 TYNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYK----SKPTYKPKITCPPTYKAKPSYPP 171

Query: 335 VYKPPVEKPPVYKPPVEKPPVYKP 406
            YKP    PP YKP V  PP YKP
Sbjct: 172 TYKPKKTYPPTYKPKVTYPPTYKP 195

 Score =  100 bits (248), Expect = 7e-20
 Identities = 58/147 (39%), Positives = 61/147 (41%), Gaps = 13/147 (8%)
 Frame = +2

Query: 2   RVEKPPVYKPPVEKPPEY-TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVE 175
           +V  PP YKP    PP Y + P YKP +  PP YK     PP YK     PP YK  P  
Sbjct: 186 KVTYPPTYKPKPSYPPIYKSKPTYKPKITYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTY 245

Query: 176 K-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK------PPVEKPPVYKPPV 322
           K     P  YK     PP YK     PP YK     PP YK           PP YK   
Sbjct: 246 KAKPTYPSTYKAKPTYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYIAKPSYPPTYKAKP 305

Query: 323 EKPPVYKPPVEKPPVYKPPVEKPPVYK 403
             PP YK     PP YK     PP YK
Sbjct: 306 SYPPTYKAKPSYPPTYKAKSSYPPTYK 332

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 61/157 (38%), Positives = 63/157 (40%), Gaps = 27/157 (17%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 178
           PP YKP    PP Y P     P YKP    PP+YK      P YKP +  PP YK     
Sbjct: 170 PPTYKPKKTYPPTYKPKVTYPPTYKPKPSYPPIYK----SKPTYKPKITYPPTYKAKPSY 225

Query: 179 PPVYKPPVEKPPVYK-PPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVE 325
           PP YK     PP YK  P  K     P  YK     PP YK     PP YK     PP  
Sbjct: 226 PPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPPTYKAKPSYPPTYKAKPSYPPTY 285

Query: 326 K-----------PPVYKPPVEKPPVYKPPVEKPPVYK 403
           K           PP YK     PP YK     PP YK
Sbjct: 286 KAKPTYIAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 322

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 59/165 (35%), Positives = 63/165 (38%), Gaps = 34/165 (20%)
 Frame = +2

Query: 14  PPVYK--PPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 187
           PP YK  P  +  P Y P  YK     P  YK     PP YKP +  PP YK     P  
Sbjct: 354 PPTYKAKPTYKAKPTY-PSTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYKAKPSYPST 412

Query: 188 YKPPVEKPPVYK------PPVEKPPVYK---------------------PPVEK-----P 271
           YK     PP YK      P  +  P YK                     PP  K     P
Sbjct: 413 YKAKSSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTYPPTYKAKPSYP 472

Query: 272 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           P YKP    PP YK     P  YKP    PP YKP +  PP YKP
Sbjct: 473 PTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPTYKP 517

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 50/137 (36%), Positives = 54/137 (39%), Gaps = 7/137 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPV 172
           PP YK     PP Y      PP YK     PP YK  P  +  P Y    +  P Y P  
Sbjct: 298 PPTYKAKPSYPPTYKAKPSYPPTYKAKSSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTY 357

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
           +  P YK     P  YK     P  YK     PP YKP +  PP YK     P  YK   
Sbjct: 358 KAKPTYKAKPTYPSTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYKAKPSYPSTYKAKS 417

Query: 353 EKPPVYKPPVEKPPVYK 403
             PP YK     PP YK
Sbjct: 418 SYPPTYKAKPSYPPTYK 434

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 51/140 (36%), Positives = 54/140 (38%), Gaps = 8/140 (5%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           P  YK     PP Y   P YK     P  YK     P  YK     PP YKP +  PP Y
Sbjct: 344 PSTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTY 403

Query: 191 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           K     P  YK     PP YK     PP YK  P  +  P Y    +  P YK     PP
Sbjct: 404 KAKPSYPSTYKAKSSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTYPP 463

Query: 365 VYK-----PPVEKPPVYKPP 409
            YK     PP  KP    PP
Sbjct: 464 TYKAKPSYPPTYKPKPSYPP 483

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 48/134 (35%), Positives = 52/134 (38%), Gaps = 3/134 (2%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           PP YK     PP Y   P Y P  +  P Y      PP YK     PP YK     PP Y
Sbjct: 262 PPTYKAKPSYPPTYKAKPSYPPTYKAKPTYIAKPSYPPTYKAKPSYPPTYKAKPSYPPTY 321

Query: 191 KPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 364
           K     PP YK  P  +  P Y    +  P Y P  +  P YK     P  YK     P 
Sbjct: 322 KAKSSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPS 381

Query: 365 VYKPPVEKPPVYKP 406
            YK     PP YKP
Sbjct: 382 TYKAKPSYPPTYKP 395

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 56/153 (36%), Positives = 57/153 (37%), Gaps = 23/153 (15%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----------PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 160
           PP YK     PP Y            PP YK     PP YK     PP YK     PP Y
Sbjct: 272 PPTYKAKPSYPPTYKAKPTYIAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKSSYPPTY 331

Query: 161 KP-PVEK-----PPVYKPPVEKPPVYK-PPVEK-----PPVYKPPVEKPPVYKPPVEKPP 304
           K  P  K     P  YK     PP YK  P  K     P  YK     P  YK     PP
Sbjct: 332 KAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPSTYKAKPSYPP 391

Query: 305 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
            YKP +  PP YK     P  YK     PP YK
Sbjct: 392 TYKPKISYPPTYKAKPSYPSTYKAKSSYPPTYK 424

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 49/138 (35%), Positives = 54/138 (39%), Gaps = 9/138 (6%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYT-----PPIYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 172
           PP YK     PP Y      PP YK  P  +  P Y    +  P Y P  +  P YK   
Sbjct: 308 PPTYKAKPSYPPTYKAKSSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKP 367

Query: 173 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 352
             P  YK     P  YK     PP YKP +  PP YK     P  YK     PP YK   
Sbjct: 368 TYPSTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYKAKPSYPSTYKAKSSYPPTYKAKP 427

Query: 353 EKPPVY--KPPVEKPPVY 400
             PP Y  KP  +  P Y
Sbjct: 428 SYPPTYKAKPTYKAKPTY 445

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 52/149 (34%), Positives = 55/149 (36%), Gaps = 19/149 (12%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEY-TPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVE 175
           PP YK     PP Y   P YK     P  YK     PP YK     PP YK     PP  
Sbjct: 226 PPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPPTYKAKPSYPPTYKAKPSYPPTY 285

Query: 176 K-----------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKP 316
           K           PP YK     PP YK     PP YK     PP Y  KP  +  P Y  
Sbjct: 286 KAKPTYIAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKSSYPPTYKAKPTYKAKPTYPS 345

Query: 317 PVEKPPVYKPPVEKPPVYKPPVEKPPVYK 403
             +  P Y P  +  P YK     P  YK
Sbjct: 346 TYKAKPSYPPTYKAKPTYKAKPTYPSTYK 374

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 28/70 (40%), Positives = 30/70 (42%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           KP    PP  KP    PP YKP    PP YKP +  P  YK     PP YK     PP Y
Sbjct: 496 KPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTSYPPTY 555

Query: 191 KPPVEKPPVY 220
              +  P  Y
Sbjct: 556 NKKISYPSQY 565

[118][TOP]
>UniRef100_Q9M7N8 Proline-rich protein 4 n=1 Tax=Arabidopsis thaliana
           RepID=Q9M7N8_ARATH
          Length = 448

 Score =  117 bits (292), Expect = 5e-25
 Identities = 93/224 (41%), Positives = 110/224 (49%), Gaps = 92/224 (41%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKP-----PVYKPPVEKP-----PVYKPP-------- 139
           PP Y PPVE PP    P+Y+PP +K      PVY PP +K      PVYKPP        
Sbjct: 183 PPKYSPPVEVPPPV--PVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPP 240

Query: 140 ------------VEKPP---VYKPP--VEKPP---VYKPP--VEKPP---VYKPP----- 229
                       +E PP   VYKPP  +E PP   VYKPP  +E PP   V+KPP     
Sbjct: 241 IPKKPCPPKPPKIEHPPPVPVYKPPPKIEHPPPVPVYKPPPKIEHPPPVPVHKPPKKPCP 300

Query: 230 ---VEKPPV--YKPPVEKP-----------PVYKPP---------VEKP---PVYKPP-- 319
              V+ PPV  +KPP +KP           PV+KPP         +E P   PVYKPP  
Sbjct: 301 PKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPK 360

Query: 320 VEKPPVYKPP-VEKP-----PVYKPPVEKP--------PVYKPP 409
           +E PP+Y PP V+KP     P+YKPPV  P        PVYKPP
Sbjct: 361 IEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVPVYKPP 404

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 70/184 (38%), Positives = 89/184 (48%), Gaps = 49/184 (26%)
 Frame = +2

Query: 2   RVEKPP---VYKPP--VEKPPEYTPPIYKPP--------VEKPPV--YKPPVEKP----- 121
           ++E PP   VYKPP  +E PP    P++KPP        V+ PPV  +KPP +KP     
Sbjct: 267 KIEHPPPVPVYKPPPKIEHPPPV--PVHKPPKKPCPPKKVDPPPVPVHKPPTKKPCPPKK 324

Query: 122 ------PVYKPP---------VEKPP---VYKPP-------VEKPPVYKPPVEKP-PVYK 223
                 PV+KPP         +E PP   VYKPP       +  PP+ K P   P P+YK
Sbjct: 325 VDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYK 384

Query: 224 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPV-EKPPVYK-PPVEKPPVYKPPVEKPP 394
           PPV  P   KP     PVYKPPV   P    PP+ + PP+ K PP+    ++ P   K P
Sbjct: 385 PPVVIPK--KPCPPPVPVYKPPVVVIPKKPCPPLPQLPPLPKFPPLPPKYIHHPKFGKWP 442

Query: 395 VYKP 406
              P
Sbjct: 443 PLPP 446

[119][TOP]
>UniRef100_B9GHP4 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GHP4_POPTR
          Length = 223

 Score =  117 bits (292), Expect = 5e-25
 Identities = 71/136 (52%), Positives = 73/136 (53%), Gaps = 5/136 (3%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTP--PIYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPP 184
           PP  K P   PP  TP  P+YKPP   PPV  PP   PPV  P PV+ P    PPV KPP
Sbjct: 23  PPEVKSPTPAPPVVTPSTPLYKPPTPAPPVKTPP-PAPPVNPPTPVKPPTTPAPPVYKPP 81

Query: 185 VYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 361
              PPV  P   KPP    PPVYKPP   PPV  PP   PPV  P    PPVYKPP   P
Sbjct: 82  SPAPPVNPPTPVKPPTTPAPPVYKPPSPAPPV-NPPTPVPPVKPPTAPAPPVYKPPSPAP 140

Query: 362 -PVYKPPVEKPPVYKP 406
            PV  PPV KPP   P
Sbjct: 141 TPV--PPV-KPPTTGP 153

 Score =  110 bits (274), Expect = 6e-23
 Identities = 64/135 (47%), Positives = 67/135 (49%), Gaps = 2/135 (1%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190
           K  V+   V       PP  K P   PPV  P     P+YKPP   PPV  PP   PPV 
Sbjct: 7   KQAVFSKSVVPASTPAPPEVKSPTPAPPVVTPST---PLYKPPTPAPPVKTPP-PAPPVN 62

Query: 191 KP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPP 364
            P PV+ P    PPV KPP   PPV  P   KPP    PPVYKPP   PPV  PP   PP
Sbjct: 63  PPTPVKPPTTPAPPVYKPPSPAPPVNPPTPVKPPTTPAPPVYKPPSPAPPV-NPPTPVPP 121

Query: 365 VYKPPVEKPPVYKPP 409
           V  P    PPVYKPP
Sbjct: 122 VKPPTAPAPPVYKPP 136

 Score =  102 bits (255), Expect = 1e-20
 Identities = 62/122 (50%), Positives = 63/122 (51%), Gaps = 10/122 (8%)
 Frame = +2

Query: 17  PVYKPPVEKPPEYTPPIYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-----YKPPVEK 178
           P+YKPP   PP  TPP   PPV  P   KPP    PPVYKPP   PPV      KPP   
Sbjct: 41  PLYKPPTPAPPVKTPPP-APPVNPPTPVKPPTTPAPPVYKPPSPAPPVNPPTPVKPPTTP 99

Query: 179 -PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKP 346
            PPVYKPP   PPV  PP   PPV  P    PPVYKPP   P   P  KPP   P    P
Sbjct: 100 APPVYKPPSPAPPV-NPPTPVPPVKPPTAPAPPVYKPPSPAPTPVPPVKPPTTGP--MPP 156

Query: 347 PV 352
           PV
Sbjct: 157 PV 158

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 56/118 (47%), Positives = 58/118 (49%), Gaps = 14/118 (11%)
 Frame = +2

Query: 11  KPPVYKPPVEKPPEYTP-----PIYKPPVEKPPVYKPPVEKPPV-----YKPPVEK-PPV 157
           KPP   PPV+ PP   P     P+  P    PPVYKPP   PPV      KPP    PPV
Sbjct: 44  KPPTPAPPVKTPPPAPPVNPPTPVKPPTTPAPPVYKPPSPAPPVNPPTPVKPPTTPAPPV 103

Query: 158 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPV 322
           YKPP   PPV  PP   PPV  P    PPVYKPP   P   P  KPP   P    PPV
Sbjct: 104 YKPPSPAPPV-NPPTPVPPVKPPTAPAPPVYKPPSPAPTPVPPVKPPTTGP--MPPPV 158

[120][TOP]
>UniRef100_Q9T0I5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0I5_ARATH
          Length = 448

 Score =  116 bits (291), Expect = 7e-25
 Identities = 94/224 (41%), Positives = 109/224 (48%), Gaps = 92/224 (41%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKP-----PVYKPPVEKP-----PVYKPP--VEKPPV 157
           PP Y PPVE PP    P+Y+PP +K      PVY PP +K      PVYKPP  VE PP 
Sbjct: 183 PPKYSPPVEVPPPV--PVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPP 240

Query: 158 Y-------KPP-VEKPP---VYKPP--VEKPP---VYKPP--VEKPP------------- 244
                   KPP +E PP   VYKPP  +EKPP   VYKPP  +E PP             
Sbjct: 241 IPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCP 300

Query: 245 ----------VYKPPVEKP-----------PVYKPP---------VEKP---PVYKPP-- 319
                     V+KPP +KP           PV+KPP         +E P   PVYKPP  
Sbjct: 301 PKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPK 360

Query: 320 VEKPPVYKPP-VEKP-----PVYKPPVEKP--------PVYKPP 409
           +E PP+Y PP V+KP     P+YKPPV  P        PVYKPP
Sbjct: 361 IEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVPVYKPP 404

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 67/185 (36%), Positives = 85/185 (45%), Gaps = 50/185 (27%)
 Frame = +2

Query: 2   RVEKPP---VYKPP--VEKPPEYTP------------------PIYKPPVEKP------- 91
           ++EKPP   VYKPP  +E PP                      P++KPP +KP       
Sbjct: 267 KIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVD 326

Query: 92  ----PVYKPP---------VEKPP---VYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVY 220
               PV+KPP         +E PP   VYKPP   P +  PP+  PP+ K P   P P+Y
Sbjct: 327 PPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPP---PKIEHPPIYIPPIVKKPCPPPVPIY 383

Query: 221 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPV-EKPPVYK-PPVEKPPVYKPPVEKP 391
           KPPV  P   KP     PVYKPPV   P    PP+ + PP+ K PP+    ++ P   K 
Sbjct: 384 KPPVVIPK--KPCPPPVPVYKPPVVVIPKKPCPPLPQLPPLPKFPPLPPKYIHHPKFGKW 441

Query: 392 PVYKP 406
           P   P
Sbjct: 442 PPLPP 446

[121][TOP]
>UniRef100_B9DHX5 AT4G38770 protein (Fragment) n=1 Tax=Arabidopsis thaliana
           RepID=B9DHX5_ARATH
          Length = 277

 Score =  116 bits (291), Expect = 7e-25
 Identities = 94/224 (41%), Positives = 109/224 (48%), Gaps = 92/224 (41%)
 Frame = +2

Query: 14  PPVYKPPVEKPPEYTPPIYKPPVEKP-----PVYKPPVEKP-----PVYKPP--VEKPPV 157
           PP Y PPVE PP    P+Y+PP +K      PVY PP +K      PVYKPP  VE PP 
Sbjct: 12  PPKYSPPVEVPPPV--PVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPP 69

Query: 158 Y-------KPP-VEKPP---VYKPP--VEKPP---VYKPP--VEKPP------------- 244
                   KPP +E PP   VYKPP  +EKPP   VYKPP  +E PP             
Sbjct: 70  IPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCP 129

Query: 245 ----------VYKPPVEKP-----------PVYKPP---------VEKP---PVYKPP-- 319
                     V+KPP +KP           PV+KPP         +E P   PVYKPP  
Sbjct: 130 PKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPK 189

Query: 320 VEKPPVYKPP-VEKP-----PVYKPPVEKP--------PVYKPP 409
           +E PP+Y PP V+KP     P+YKPPV  P        PVYKPP
Sbjct: 190 IEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVPVYKPP 233

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 67/185 (36%), Positives = 85/185 (45%), Gaps = 50/185 (27%)
 Frame = +2

Query: 2   RVEKPP---VYKPP--VEKPPEYTP------------------PIYKPPVEKP------- 91
           ++EKPP   VYKPP  +E PP                      P++KPP +KP       
Sbjct: 96  KIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVD 155

Query: 92  ----PVYKPP---------VEKPP---VYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVY 220
               PV+KPP         +E PP   VYKPP   P +  PP+  PP+ K P   P P+Y
Sbjct: 156 PPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPP---PKIEHPPIYIPPIVKKPCPPPVPIY 212

Query: 221 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPV-EKPPVYK-PPVEKPPVYKPPVEKP 391
           KPPV  P   KP     PVYKPPV   P    PP+ + PP+ K PP+    ++ P   K 
Sbjct: 213 KPPVVIPK--KPCPPPVPVYKPPVVVIPKKPCPPLPQLPPLPKFPPLPPKYIHHPKFGKW 270

Query: 392 PVYKP 406
           P   P
Sbjct: 271 PPLPP 275

[122][TOP]
>UniRef100_Q1MTH2 Novel protein (Fragment) n=1 Tax=Danio rerio RepID=Q1MTH2_DANRE
          Length = 201

 Score =  115 bits (289), Expect = 1e-24
 Identities = 55/108 (50%), Positives = 66/108 (61%)
 Frame = +2

Query: 83  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 262
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 61  ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 120

Query: 263 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 406
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 121 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 168

 Score =  112 bits (281), Expect = 1e-23
 Identities = 53/106 (50%), Positives = 64/106 (60%)