AV426586 ( MWM069f08_r )

[UP]


[1][TOP]
>UniRef100_Q2YHP5 Proline-rich protein (Fragment) n=1 Tax=Phaseolus vulgaris
           RepID=Q2YHP5_PHAVU
          Length = 264

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 32  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 91

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 92  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 150

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 42  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 101

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 102 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 160

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 52  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 111

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 112 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 170

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 62  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 121

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 122 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 72  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 131

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 132 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 190

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 82  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 141

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 142 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 200

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 92  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 151

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 152 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 210

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 102 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 161

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 162 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 220

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 112 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 171

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 172 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 230

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 122 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 181

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 182 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 240

 Score =  269 bits (688), Expect = 6e-71
 Identities = 118/119 (99%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 132 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 191

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY+PP
Sbjct: 192 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYQPP 250

 Score =  257 bits (657), Expect = 2e-67
 Identities = 113/113 (100%), Positives = 113/113 (100%)
 Frame = +1

Query: 22  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 201
           KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY
Sbjct: 28  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 87

Query: 202 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 88  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 140

 Score =  254 bits (649), Expect = 2e-66
 Identities = 113/119 (94%), Positives = 114/119 (95%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 142 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 201

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY+PP  KPP  K P
Sbjct: 202 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYQPPYGKPPHPKYP 260

 Score =  215 bits (548), Expect = 1e-54
 Identities = 97/104 (93%), Positives = 98/104 (94%), Gaps = 5/104 (4%)
 Frame = +1

Query: 64  EKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 228
           +KPPV KP     PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV
Sbjct: 27  DKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 86

Query: 229 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 87  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 130

[2][TOP]
>UniRef100_P13993 Repetitive proline-rich cell wall protein 2 n=2 Tax=Glycine max
           RepID=PRP2_SOYBN
          Length = 230

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 65  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 124

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 125 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 183

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 75  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 134

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 135 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 193

 Score =  270 bits (691), Expect = 3e-71
 Identities = 118/119 (99%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 85  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 144

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPP
Sbjct: 145 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPP 203

 Score =  270 bits (691), Expect = 3e-71
 Identities = 118/119 (99%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 95  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 154

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP
Sbjct: 155 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPP 213

 Score =  268 bits (686), Expect = 1e-70
 Identities = 117/119 (98%), Positives = 118/119 (99%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVE PP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 35  EKPPVYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 94

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 95  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 153

 Score =  268 bits (686), Expect = 1e-70
 Identities = 117/119 (98%), Positives = 118/119 (99%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVE PP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 45  EKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 104

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 105 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 163

 Score =  268 bits (686), Expect = 1e-70
 Identities = 117/119 (98%), Positives = 118/119 (99%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E PP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 55  ENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 114

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 115 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 173

 Score =  265 bits (677), Expect = 1e-69
 Identities = 115/119 (96%), Positives = 116/119 (97%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E PPVYKPP EKPPVYKPPVEKPPVYKPPVE PP+YKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 25  ENPPVYKPPTEKPPVYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPV 84

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 85  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 143

 Score =  256 bits (654), Expect = 5e-67
 Identities = 113/119 (94%), Positives = 114/119 (95%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 105 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 164

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP  KPP  K P
Sbjct: 165 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPYGKPPYPKYP 223

[3][TOP]
>UniRef100_Q40375 Repetitive proline-rich cell wall protein 2 n=1 Tax=Medicago
           truncatula RepID=PRP2_MEDTR
          Length = 371

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 40  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 99

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 100 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 158

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 50  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 109

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 110 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 168

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 60  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 119

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 120 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 178

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 70  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 129

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 130 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 188

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 80  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 139

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 140 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 198

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 90  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 149

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 150 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 208

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 100 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 159

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 160 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 218

 Score =  271 bits (692), Expect = 2e-71
 Identities = 119/119 (100%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 110 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 169

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 170 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 228

 Score =  270 bits (691), Expect = 3e-71
 Identities = 118/119 (99%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 120 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 179

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPP
Sbjct: 180 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPP 238

 Score =  270 bits (691), Expect = 3e-71
 Identities = 118/119 (99%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 130 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 189

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP
Sbjct: 190 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPP 248

 Score =  270 bits (691), Expect = 3e-71
 Identities = 118/119 (99%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 140 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 199

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 200 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPP 258

 Score =  270 bits (690), Expect = 4e-71
 Identities = 117/119 (98%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 150 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 209

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPP
Sbjct: 210 EKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPP 268

 Score =  270 bits (690), Expect = 4e-71
 Identities = 117/119 (98%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 160 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 219

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP
Sbjct: 220 EKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPP 278

 Score =  270 bits (690), Expect = 4e-71
 Identities = 117/119 (98%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 170 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 229

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 230 EKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPP 288

 Score =  270 bits (690), Expect = 4e-71
 Identities = 117/119 (98%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPV
Sbjct: 180 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPV 239

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 240 EKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 298

 Score =  270 bits (690), Expect = 4e-71
 Identities = 117/119 (98%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPV
Sbjct: 190 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPV 249

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 250 EKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 308

 Score =  270 bits (690), Expect = 4e-71
 Identities = 117/119 (98%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 200 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPV 259

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 260 EKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 318

 Score =  267 bits (683), Expect = 2e-70
 Identities = 117/118 (99%), Positives = 118/118 (100%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE
Sbjct: 31  QPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 90

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 91  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 148

 Score =  267 bits (683), Expect = 2e-70
 Identities = 116/119 (97%), Positives = 118/119 (99%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPV
Sbjct: 210 EKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPV 269

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPP
Sbjct: 270 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPP 328

 Score =  267 bits (683), Expect = 2e-70
 Identities = 116/119 (97%), Positives = 118/119 (99%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPV
Sbjct: 220 EKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPV 279

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPVEKPPVYKPP
Sbjct: 280 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEKPPVYKPP 338

 Score =  261 bits (667), Expect = 2e-68
 Identities = 114/119 (95%), Positives = 116/119 (97%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 230 EKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPV 289

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPP
Sbjct: 290 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP 348

 Score =  259 bits (661), Expect = 8e-68
 Identities = 114/119 (95%), Positives = 115/119 (96%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 240 EKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 299

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPP
Sbjct: 300 EKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPP 358

 Score =  256 bits (654), Expect = 5e-67
 Identities = 113/119 (94%), Positives = 114/119 (95%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 250 EKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 309

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVY PP
Sbjct: 310 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYGPP 368

 Score =  253 bits (646), Expect = 5e-66
 Identities = 111/113 (98%), Positives = 112/113 (99%)
 Frame = +1

Query: 22  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 201
           KPPV +PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY
Sbjct: 26  KPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 85

Query: 202 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 86  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 138

 Score =  217 bits (553), Expect = 3e-55
 Identities = 97/104 (93%), Positives = 99/104 (95%), Gaps = 5/104 (4%)
 Frame = +1

Query: 64  EKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 228
           +KPPVY+P     PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV
Sbjct: 25  DKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 84

Query: 229 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 85  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 128

[4][TOP]
>UniRef100_Q43414 Proline rich protein (Fragment) n=1 Tax=Cicer arietinum
           RepID=Q43414_CICAR
          Length = 227

 Score =  270 bits (690), Expect = 4e-71
 Identities = 117/119 (98%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPP+EKPPVYKPPVEKPP+YKPPVEKPPVYKPPV
Sbjct: 18  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPV 77

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 78  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 136

 Score =  270 bits (689), Expect = 5e-71
 Identities = 116/119 (97%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPP+EKPPVYKPPVEKPPVYKPPVEKPPVYKPP+EKPPVYKPPVEKPP+YKPPV
Sbjct: 8   EKPPVYKPPIEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPV 67

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 68  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 126

 Score =  270 bits (689), Expect = 5e-71
 Identities = 116/119 (97%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPP+EKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 28  EKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPV 87

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPP
Sbjct: 88  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPP 146

 Score =  270 bits (689), Expect = 5e-71
 Identities = 116/119 (97%), Positives = 119/119 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPP+EKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 38  EKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 97

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP
Sbjct: 98  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPP 156

 Score =  267 bits (683), Expect = 2e-70
 Identities = 115/119 (96%), Positives = 118/119 (99%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 48  EKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 107

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP+EKPPVY PP
Sbjct: 108 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPP 166

 Score =  267 bits (683), Expect = 2e-70
 Identities = 115/119 (96%), Positives = 118/119 (99%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 58  EKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 117

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP+EKPPVY PPVEKPPVYKPP
Sbjct: 118 EKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPPVYKPP 176

 Score =  266 bits (679), Expect = 7e-70
 Identities = 114/119 (95%), Positives = 118/119 (99%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 68  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 127

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPP+YKPPVEKPPVYKPP+EKPPVY PPVEKPPVYKPP+E+PPVYKPP
Sbjct: 128 EKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPPVYKPPIEEPPVYKPP 186

 Score =  263 bits (672), Expect = 4e-69
 Identities = 113/116 (97%), Positives = 116/116 (100%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PVYKPPVEKPPVYKPP+EKPPVYKPPVEKPPVYKPPVEKPPVYKPP+EKPPVYKPPVEKP
Sbjct: 1   PVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKP 60

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 61  PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 116

 Score =  263 bits (672), Expect = 4e-69
 Identities = 113/119 (94%), Positives = 117/119 (98%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 78  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 137

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPP+YKPPVEKPPVYKPP+EKPPVY PPVEKPPVYKPP+E+PPVYKPPVEKPPVY PP
Sbjct: 138 EKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPPVYKPPIEEPPVYKPPVEKPPVYGPP 196

 Score =  251 bits (642), Expect = 1e-65
 Identities = 111/126 (88%), Positives = 115/126 (91%), Gaps = 7/126 (5%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPV
Sbjct: 88  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPV 147

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY---- 351
           EKPPVYKPP+EKPPVY PPVEKPPVYKPP+E+PPVYKPPVEKPPVY PP EKPP Y    
Sbjct: 148 EKPPVYKPPIEKPPVYTPPVEKPPVYKPPIEEPPVYKPPVEKPPVYGPPYEKPPHYPGYP 207

Query: 352 ---KPP 360
              KPP
Sbjct: 208 PYEKPP 213

[5][TOP]
>UniRef100_Q9SC42 Proline-rich protein n=1 Tax=Pisum sativum RepID=Q9SC42_PEA
          Length = 214

 Score =  260 bits (665), Expect = 3e-68
 Identities = 112/119 (94%), Positives = 114/119 (95%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPV+KPPVYKPPVEKPPVYKPPVEKPP YKPPVEKPPVYKPPV
Sbjct: 59  EKPPVYKPPVEKPPVYKPPVKKPPVYKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPV 118

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPP YKPPVE+PPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP YKPPVEKPP YKPP
Sbjct: 119 EKPPTYKPPVERPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVEKPPAYKPP 177

 Score =  260 bits (665), Expect = 3e-68
 Identities = 112/119 (94%), Positives = 114/119 (95%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPV+KPPVYKPPVEKPPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP YKPPV
Sbjct: 69  EKPPVYKPPVKKPPVYKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPV 128

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+PPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP YKPPVEKPP YKPPVEKPPVYKPP
Sbjct: 129 ERPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVEKPPAYKPPVEKPPVYKPP 187

 Score =  260 bits (664), Expect = 4e-68
 Identities = 112/118 (94%), Positives = 114/118 (96%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPVEKPPVYKPPVEKPPVYKPPV+KPPVYKPPVEKPPVYKPPVEKPP YKPPVE
Sbjct: 50  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVKKPPVYKPPVEKPPVYKPPVEKPPTYKPPVE 109

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPVEKPP YKPPVE+PPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP YKPP
Sbjct: 110 KPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPP 167

 Score =  255 bits (652), Expect = 9e-67
 Identities = 111/118 (94%), Positives = 113/118 (95%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV KPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV+KPPVYKPPVEKPPVYKPPVE
Sbjct: 40  KPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVKKPPVYKPPVEKPPVYKPPVE 99

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPP YKPPVEKPPVYKPPVEKPP YKPPVE+PPVYKPPVEKPP YKPPVEKPPVYKPP
Sbjct: 100 KPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPPTYKPPVEKPPVYKPP 157

 Score =  253 bits (647), Expect = 4e-66
 Identities = 111/124 (89%), Positives = 115/124 (92%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           EKPPVY+PPVE PP+YKPPVEKPPVYKP     PVEKPPVYKPPVEKPPVYKPPV+KPPV
Sbjct: 24  EKPPVYRPPVETPPIYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVKKPPV 83

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           YKPPVEKPPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP YKPPVE+PPVYKPPVEKPP 
Sbjct: 84  YKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPPT 143

Query: 349 YKPP 360
           YKPP
Sbjct: 144 YKPP 147

 Score =  239 bits (611), Expect = 5e-62
 Identities = 103/110 (93%), Positives = 105/110 (95%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           +KPPVYKPPVEKPPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP YKPPVE+PPVYKPPV
Sbjct: 79  KKPPVYKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPPVYKPPV 138

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 333
           EKPP YKPPVEKPPVYKPPVEKPP YKPPVEKPP YKPPVEKPPVYKPPV
Sbjct: 139 EKPPTYKPPVEKPPVYKPPVEKPPTYKPPVEKPPAYKPPVEKPPVYKPPV 188

[6][TOP]
>UniRef100_Q9MAW3 TrPRP2 n=1 Tax=Trifolium repens RepID=Q9MAW3_TRIRP
          Length = 343

 Score =  250 bits (639), Expect = 3e-65
 Identities = 110/118 (93%), Positives = 112/118 (94%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPP+YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPV 
Sbjct: 216 KPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVV 275

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY+PP
Sbjct: 276 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYEPP 333

 Score =  249 bits (636), Expect = 7e-65
 Identities = 113/123 (91%), Positives = 113/123 (91%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE
Sbjct: 41  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 100

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPVY 351
           KPPVYKPPV KPPVYKPPV KPPVYKPPV K     PPVYKPPV KPPVYKPPV KPPVY
Sbjct: 101 KPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVY 160

Query: 352 KPP 360
           KPP
Sbjct: 161 KPP 163

 Score =  246 bits (628), Expect = 6e-64
 Identities = 110/119 (92%), Positives = 110/119 (92%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 50  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 109

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPVYKPPV KPPVYKPPV KPPV  PPV KPPVYKPPV KPPV KPPV KPPVYKPP
Sbjct: 110 VKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPP 168

 Score =  246 bits (628), Expect = 6e-64
 Identities = 109/118 (92%), Positives = 110/118 (93%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV KPPV KPPVYKPPV KPP+YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV 
Sbjct: 206 KPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVY 265

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 266 KPPVYKPPVVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 323

 Score =  245 bits (626), Expect = 1e-63
 Identities = 108/117 (92%), Positives = 109/117 (93%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVY PP+ KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK
Sbjct: 32  PPVYTPPIVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 91

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV  PPV KPPVYKPP
Sbjct: 92  PPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPP 148

 Score =  243 bits (621), Expect = 4e-63
 Identities = 109/119 (91%), Positives = 109/119 (91%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV
Sbjct: 60  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPV 119

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPVYKPPV KPPV  PPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPP
Sbjct: 120 VKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP 178

 Score =  243 bits (621), Expect = 4e-63
 Identities = 108/118 (91%), Positives = 109/118 (92%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPV KPPV KPPVYKPPV KPP+YKPPV KPPVYKPPVEKPPVYKPPV 
Sbjct: 196 KPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVY 255

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 256 KPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 313

 Score =  241 bits (614), Expect = 2e-62
 Identities = 108/119 (90%), Positives = 108/119 (90%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV
Sbjct: 70  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPV 129

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV  PPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPPVYKPP
Sbjct: 130 YKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPP 188

 Score =  241 bits (614), Expect = 2e-62
 Identities = 107/118 (90%), Positives = 108/118 (91%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP+YKPPV KPPVYKPPVE
Sbjct: 186 KPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVE 245

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 246 KPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPPVEKPPVYKPP 303

 Score =  235 bits (599), Expect = 1e-60
 Identities = 106/119 (89%), Positives = 106/119 (89%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV  PPV
Sbjct: 80  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPV 139

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPP
Sbjct: 140 YKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPP 198

 Score =  235 bits (599), Expect = 1e-60
 Identities = 105/118 (88%), Positives = 106/118 (89%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV KPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP+YKPPV 
Sbjct: 176 KPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVV 235

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPP
Sbjct: 236 KPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPP 293

 Score =  233 bits (595), Expect = 4e-60
 Identities = 103/113 (91%), Positives = 104/113 (92%)
 Frame = +1

Query: 22  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 201
           KPPV  PPVY PP+ KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY
Sbjct: 26  KPPVYTPPVYTPPIVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 85

Query: 202 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV  PP
Sbjct: 86  KPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPP 138

 Score =  232 bits (592), Expect = 8e-60
 Identities = 105/119 (88%), Positives = 105/119 (88%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV  PPV KPPVYKPPV
Sbjct: 90  EKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPV 149

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV KPPV KPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPP
Sbjct: 150 YKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPP 208

 Score =  230 bits (587), Expect = 3e-59
 Identities = 103/117 (88%), Positives = 104/117 (88%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPV KPPV KPPVYKPPV K
Sbjct: 137 PPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVK 196

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPVYKPPV KPPV KPPV KPPVYKPPV KPP+YKPPV KPPVYKPPVEKPPVYKPP
Sbjct: 197 PPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPP 253

 Score =  229 bits (585), Expect = 6e-59
 Identities = 104/119 (87%), Positives = 104/119 (87%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV  PPV KPPVYKPPV KPPV KPPV
Sbjct: 100 EKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPV 159

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPP
Sbjct: 160 YKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP 218

 Score =  229 bits (585), Expect = 6e-59
 Identities = 106/123 (86%), Positives = 106/123 (86%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV 
Sbjct: 161 KPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVY 220

Query: 187 KPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           KPPV     YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPV KPPVY
Sbjct: 221 KPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVY 280

Query: 352 KPP 360
           KPP
Sbjct: 281 KPP 283

 Score =  229 bits (584), Expect = 7e-59
 Identities = 103/118 (87%), Positives = 104/118 (88%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPVYKPPV KPPV KPPV KPPV KPPV KPPVYKPPV KPPVYKPPV 
Sbjct: 146 KPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVY 205

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPV KPPV KPPVYKPPV KPP+YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPP
Sbjct: 206 KPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPP 263

 Score =  229 bits (584), Expect = 7e-59
 Identities = 103/118 (87%), Positives = 104/118 (88%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPV KPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPPV KPPV 
Sbjct: 156 KPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVY 215

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPP+YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPP
Sbjct: 216 KPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPP 273

 Score =  227 bits (579), Expect = 3e-58
 Identities = 102/118 (86%), Positives = 103/118 (87%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV  PPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPV KPPV 
Sbjct: 126 KPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVY 185

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP+YKPPV KPPVYKPP
Sbjct: 186 KPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPP 243

 Score =  224 bits (572), Expect = 2e-57
 Identities = 102/118 (86%), Positives = 102/118 (86%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPVYKPPV KPPV  PPV KPPVYKPPV KPPV KPPV KPPVYKPPV 
Sbjct: 111 KPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVV 170

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPPV KPP
Sbjct: 171 KPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPP 228

 Score =  224 bits (571), Expect = 2e-57
 Identities = 101/118 (85%), Positives = 102/118 (86%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV KPPV KPPVYKPPV  PPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV 
Sbjct: 116 KPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVY 175

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPV KPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP+YKPP
Sbjct: 176 KPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPP 233

 Score =  209 bits (533), Expect = 6e-53
 Identities = 95/104 (91%), Positives = 95/104 (91%), Gaps = 5/104 (4%)
 Frame = +1

Query: 64  EKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 228
           EKPPVY PPV      KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV
Sbjct: 25  EKPPVYTPPVYTPPIVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 84

Query: 229 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           YKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPP
Sbjct: 85  YKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPP 128

 Score =  192 bits (487), Expect = 1e-47
 Identities = 87/98 (88%), Positives = 88/98 (89%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 245 EKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 304

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 297
           EKPPVYKPPVEKPPVYKPPVEKPPVY+PP    P Y P
Sbjct: 305 EKPPVYKPPVEKPPVYKPPVEKPPVYEPP--HHPKYPP 340

[7][TOP]
>UniRef100_Q40358 Repetitive proline-rich cell wall protein n=1 Tax=Medicago sativa
           RepID=PRP_MEDSA
          Length = 236

 Score =  246 bits (629), Expect = 4e-64
 Identities = 110/118 (93%), Positives = 110/118 (93%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV 
Sbjct: 56  KPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVV 115

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPP
Sbjct: 116 KPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPP 173

 Score =  246 bits (629), Expect = 4e-64
 Identities = 110/118 (93%), Positives = 110/118 (93%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVE
Sbjct: 86  KPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVE 145

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPP
Sbjct: 146 KPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPP 203

 Score =  246 bits (627), Expect = 7e-64
 Identities = 110/119 (92%), Positives = 110/119 (92%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV
Sbjct: 65  EKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPV 124

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV KPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPP
Sbjct: 125 YKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPP 183

 Score =  245 bits (625), Expect = 1e-63
 Identities = 112/124 (90%), Positives = 112/124 (90%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           EKPPVYKPPVEKPPVYKP     PVEKPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPV
Sbjct: 40  EKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPV 99

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           YKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPVEKPPV
Sbjct: 100 YKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPV 159

Query: 349 YKPP 360
           YKPP
Sbjct: 160 YKPP 163

 Score =  244 bits (622), Expect = 3e-63
 Identities = 109/118 (92%), Positives = 109/118 (92%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV 
Sbjct: 76  KPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVY 135

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPVYKPP
Sbjct: 136 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPP 193

 Score =  242 bits (618), Expect = 8e-63
 Identities = 109/119 (91%), Positives = 109/119 (91%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPV
Sbjct: 95  EKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPV 154

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPP
Sbjct: 155 EKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP 213

 Score =  241 bits (616), Expect = 1e-62
 Identities = 110/123 (89%), Positives = 111/123 (90%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVY 171
           +PPVYKPPVEKPPVYKPPVEKPPVYKP     PVEKPPVYKPPV KPPVYKPPV KPPVY
Sbjct: 31  QPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVY 90

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           KPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVY
Sbjct: 91  KPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVY 150

Query: 352 KPP 360
           KPP
Sbjct: 151 KPP 153

 Score =  240 bits (613), Expect = 3e-62
 Identities = 108/118 (91%), Positives = 108/118 (91%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV 
Sbjct: 106 KPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVY 165

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPP
Sbjct: 166 KPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPP 223

 Score =  240 bits (613), Expect = 3e-62
 Identities = 108/118 (91%), Positives = 108/118 (91%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV 
Sbjct: 116 KPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVV 175

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVY PP
Sbjct: 176 KPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYGPP 233

 Score =  233 bits (595), Expect = 4e-60
 Identities = 105/119 (88%), Positives = 107/119 (89%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           +KPPVY+PPV KPPV KPPV KPPV KPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV
Sbjct: 25  DKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPV 84

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPP
Sbjct: 85  YKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPP 143

 Score =  184 bits (467), Expect = 3e-45
 Identities = 82/89 (92%), Positives = 82/89 (92%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV
Sbjct: 145 EKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPV 204

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPP 270
            KPPV KPPV KPPVYKPPVEKPPVY PP
Sbjct: 205 YKPPVEKPPVYKPPVYKPPVEKPPVYGPP 233

[8][TOP]
>UniRef100_Q40376 Nodulin n=1 Tax=Medicago truncatula RepID=Q40376_MEDTR
          Length = 549

 Score =  242 bits (617), Expect = 1e-62
 Identities = 106/119 (89%), Positives = 116/119 (97%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPP++KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPV
Sbjct: 320 EKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPV 379

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKPPVEKPPV+KPP
Sbjct: 380 EKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPP 438

 Score =  240 bits (613), Expect = 3e-62
 Identities = 106/119 (89%), Positives = 115/119 (96%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP V
Sbjct: 310 EKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHV 369

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKPP
Sbjct: 370 EKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPP 428

 Score =  239 bits (610), Expect = 7e-62
 Identities = 105/118 (88%), Positives = 115/118 (97%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPV
Sbjct: 330 EKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPV 389

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           EKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKPPVEKPPV+KPPVEKPP++KP
Sbjct: 390 EKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEKPPLHKP 447

 Score =  237 bits (604), Expect = 3e-61
 Identities = 105/118 (88%), Positives = 114/118 (96%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP V
Sbjct: 95  EKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSV 154

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           EKPPVYKPPVEKPP++KP VEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP
Sbjct: 155 EKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKP 212

 Score =  236 bits (603), Expect = 5e-61
 Identities = 105/119 (88%), Positives = 114/119 (95%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPV
Sbjct: 300 EKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPV 359

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPP
Sbjct: 360 EKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPP 418

 Score =  236 bits (602), Expect = 6e-61
 Identities = 106/124 (85%), Positives = 116/124 (93%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           EKPPV+KPPVEKPPV     YKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV
Sbjct: 285 EKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPV 344

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           +KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV
Sbjct: 345 HKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPV 404

Query: 349 YKPP 360
           +KPP
Sbjct: 405 HKPP 408

 Score =  235 bits (600), Expect = 1e-60
 Identities = 104/119 (87%), Positives = 113/119 (94%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPV
Sbjct: 340 EKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPV 399

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPV+KPPVEK PVYKPPVEKPPVYKPPVEKPPV+KPPVEKPP++KP VEKP  YKPP
Sbjct: 400 EKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEKPPLHKPQVEKPTEYKPP 458

 Score =  234 bits (598), Expect = 2e-60
 Identities = 103/119 (86%), Positives = 112/119 (94%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPP+YKPPVEKPP YKPPVE  PVYKP VEKPPV+KPPVEKPPV+KPPVEKPPV+KPPV
Sbjct: 65  EKPPIYKPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPV 124

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKPPVEKPP++KP VEKPPV+KPP
Sbjct: 125 EKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPP 183

 Score =  234 bits (598), Expect = 2e-60
 Identities = 105/119 (88%), Positives = 113/119 (94%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKPPV
Sbjct: 105 EKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPV 164

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPP++KP VEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPP
Sbjct: 165 EKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPP 223

 Score =  234 bits (598), Expect = 2e-60
 Identities = 105/119 (88%), Positives = 113/119 (94%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKPPVEKPP++KP V
Sbjct: 115 EKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLV 174

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPP
Sbjct: 175 EKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPP 233

 Score =  234 bits (598), Expect = 2e-60
 Identities = 105/119 (88%), Positives = 113/119 (94%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKPPVEKPP++KP VEKPPV+KPPV
Sbjct: 125 EKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPPV 184

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPPVEKPPV+KPP
Sbjct: 185 EKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPP 243

 Score =  233 bits (593), Expect = 7e-60
 Identities = 103/119 (86%), Positives = 112/119 (94%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPV
Sbjct: 350 EKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPV 409

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EK PVYKPPVEKPPVYKPPVEKPPV+KPPVEKPP++KP VEKP  YKPP+EK PVYKPP
Sbjct: 410 EKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEKPPLHKPQVEKPTEYKPPIEKFPVYKPP 468

 Score =  232 bits (591), Expect = 1e-59
 Identities = 104/124 (83%), Positives = 115/124 (92%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           EK P++KPPVEKPPV+KPPVEKPPV     YKPPVEKPPVYKP VEKPP++KPPVEKPPV
Sbjct: 275 EKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPV 334

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           +KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV
Sbjct: 335 HKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPV 394

Query: 349 YKPP 360
           +KPP
Sbjct: 395 HKPP 398

 Score =  231 bits (590), Expect = 1e-59
 Identities = 101/119 (84%), Positives = 110/119 (92%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KP VEKPP + PP+EKPP+YKPPVEKPP YKPPVE  PVYKP VEKPPV+KPPV
Sbjct: 45  EKPPVHKPLVEKPPTHHPPIEKPPIYKPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPPV 104

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKPP
Sbjct: 105 EKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPP 163

 Score =  231 bits (590), Expect = 1e-59
 Identities = 100/118 (84%), Positives = 110/118 (93%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPP + PP+EKPP+YKPPVEKPP YKPPVE  PVYKP VEKPPV+KPPVEKPPV+KPPV
Sbjct: 55  EKPPTHHPPIEKPPIYKPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPPVEKPPVHKPPV 114

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           EKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKPPVEKPP++KP
Sbjct: 115 EKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKP 172

 Score =  231 bits (590), Expect = 1e-59
 Identities = 102/119 (85%), Positives = 112/119 (94%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPV
Sbjct: 360 EKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPV 419

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPVEKPPV+KPPVEKPP++KP VEKP  YKPP+EK PVYKPPVEKP V+KPP
Sbjct: 420 EKPPVYKPPVEKPPVHKPPVEKPPLHKPQVEKPTEYKPPIEKFPVYKPPVEKPQVHKPP 478

 Score =  231 bits (589), Expect = 2e-59
 Identities = 104/119 (87%), Positives = 112/119 (94%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPP++KP VEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP V
Sbjct: 155 EKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHV 214

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPV KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKP VEKPP++KPP
Sbjct: 215 EKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPP 273

 Score =  231 bits (588), Expect = 2e-59
 Identities = 103/119 (86%), Positives = 112/119 (94%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PVYKP VEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPV
Sbjct: 85  EHHPVYKPSVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPV 144

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EK PVYKP VEKPPVYKPPVEKPP++KP VEKPPV+KPPVEKPPV+KPPVEK PVYKPP
Sbjct: 145 EKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPP 203

 Score =  231 bits (588), Expect = 2e-59
 Identities = 103/124 (83%), Positives = 115/124 (92%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPPV 168
           EKPP++KPPVEK P++KPPVEKPPV+KPPVEKPPV     YKPPVEKPPVYKP VEKPP+
Sbjct: 265 EKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPL 324

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           +KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV
Sbjct: 325 HKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPV 384

Query: 349 YKPP 360
           +KPP
Sbjct: 385 HKPP 388

 Score =  230 bits (586), Expect = 4e-59
 Identities = 104/118 (88%), Positives = 111/118 (94%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KPPVEK PVYKP VEKPPVYKPPVEKPP++KP VEKPPV+KPPVEKPPV+KPPV
Sbjct: 135 EKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPV 194

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           EK PVYKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP
Sbjct: 195 EKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKP 252

 Score =  230 bits (586), Expect = 4e-59
 Identities = 103/119 (86%), Positives = 112/119 (94%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPPV
Sbjct: 175 EKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPV 234

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPV+KPPVEK PVYKP VEKPPVYKP VEKPP++KPPVEK P++KPPVEKPPV+KPP
Sbjct: 235 EKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPP 293

 Score =  230 bits (586), Expect = 4e-59
 Identities = 101/119 (84%), Positives = 112/119 (94%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKPPV
Sbjct: 370 EKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPV 429

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPV+KPPVEKPP++KP VEKP  YKPP+EK PVYKPPVEKP V+KPPVEKPPV+K P
Sbjct: 430 EKPPVHKPPVEKPPLHKPQVEKPTEYKPPIEKFPVYKPPVEKPQVHKPPVEKPPVHKSP 488

 Score =  229 bits (583), Expect = 9e-59
 Identities = 103/124 (83%), Positives = 114/124 (91%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPV 168
           EKPPVYKP VEKPP++KPPVEK P++KPPVEKPPV+KPPVEKPPV     YKPPVEKPPV
Sbjct: 255 EKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPV 314

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           YKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP+
Sbjct: 315 YKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPL 374

Query: 349 YKPP 360
           +KPP
Sbjct: 375 HKPP 378

 Score =  228 bits (582), Expect = 1e-58
 Identities = 104/118 (88%), Positives = 110/118 (93%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EK PVYKP VEKPPVYKPPVEKPP++KP VEKPPV+KPPVEKPPV+KPPVEK PVYKPPV
Sbjct: 145 EKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPV 204

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           EKPPVYKP VEKPPV KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKP
Sbjct: 205 EKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKP 262

 Score =  228 bits (582), Expect = 1e-58
 Identities = 104/129 (80%), Positives = 113/129 (87%), Gaps = 10/129 (7%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKPPVEKPPV+KPPV
Sbjct: 380 EKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPPV 439

Query: 184 EKPPV----------YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 333
           EKPP+          YKPP+EK PVYKPPVEKP V+KPPVEKPPV+K PV+K PVYKPP 
Sbjct: 440 EKPPLHKPQVEKPTEYKPPIEKFPVYKPPVEKPQVHKPPVEKPPVHKSPVKKLPVYKPPA 499

Query: 334 EKPPVYKPP 360
           EKPPVYKPP
Sbjct: 500 EKPPVYKPP 508

 Score =  228 bits (581), Expect = 2e-58
 Identities = 103/124 (83%), Positives = 114/124 (91%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKP VEKPP++KPPVEK P++KPPV
Sbjct: 225 EKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPV 284

Query: 184 EKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           EKPPV+KPPVEKP     PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV
Sbjct: 285 EKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPV 344

Query: 349 YKPP 360
           +KPP
Sbjct: 345 HKPP 348

 Score =  226 bits (577), Expect = 5e-58
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKP VEKPP++KPPV
Sbjct: 215 EKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPV 274

Query: 184 EKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           EK P++KPPVEKPPV+KPPVEKP     PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV
Sbjct: 275 EKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPV 334

Query: 349 YKPP 360
           +KPP
Sbjct: 335 HKPP 338

 Score =  226 bits (576), Expect = 6e-58
 Identities = 103/124 (83%), Positives = 113/124 (91%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KPPVEK PVYKP VEKPPVYKP VEKPP++KPPVEK P++KPPVEKPPV+KPPV
Sbjct: 235 EKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPV 294

Query: 184 EKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           EKP     PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEK PV
Sbjct: 295 EKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPV 354

Query: 349 YKPP 360
           YKPP
Sbjct: 355 YKPP 358

 Score =  226 bits (576), Expect = 6e-58
 Identities = 100/119 (84%), Positives = 109/119 (91%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPV+KPPVEKPP++KP VEKP  YKPP+EK PVYKPPVEKP V+KPPV
Sbjct: 420 EKPPVYKPPVEKPPVHKPPVEKPPLHKPQVEKPTEYKPPIEKFPVYKPPVEKPQVHKPPV 479

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPV+K PV+K PVYKPP EKPPVYKPPVE PPV+KP VEKPPVYKPPVEKPPV+KPP
Sbjct: 480 EKPPVHKSPVKKLPVYKPPAEKPPVYKPPVENPPVHKPLVEKPPVYKPPVEKPPVHKPP 538

 Score =  226 bits (575), Expect = 8e-58
 Identities = 104/124 (83%), Positives = 112/124 (90%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPPVEKPPV+KPPV
Sbjct: 185 EKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPV 244

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PV 348
           EK PVYKP VEKPPVYKP VEKPP++KPPVEK P++KPPVEKPPV+KPPVEKP     PV
Sbjct: 245 EKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPV 304

Query: 349 YKPP 360
           YKPP
Sbjct: 305 YKPP 308

 Score =  225 bits (574), Expect = 1e-57
 Identities = 97/119 (81%), Positives = 107/119 (89%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPP YKPPVE P  YKP +EKPPV+KP VEKPP + PP+EKPP+YKPPVEKPP YKPPV
Sbjct: 25  EKPPEYKPPVENPQFYKPHIEKPPVHKPLVEKPPTHHPPIEKPPIYKPPVEKPPAYKPPV 84

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PVYKP VEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPP
Sbjct: 85  EHHPVYKPSVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPP 143

 Score =  225 bits (574), Expect = 1e-57
 Identities = 103/123 (83%), Positives = 112/123 (91%), Gaps = 5/123 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV----- 168
           EK PVYKP VEKPPVYKP VEKPP++KPPVEK P++KPPVEKPPV+KPPVEKPPV     
Sbjct: 245 EKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPV 304

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           YKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPV
Sbjct: 305 YKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPV 364

Query: 349 YKP 357
           YKP
Sbjct: 365 YKP 367

 Score =  225 bits (573), Expect = 1e-57
 Identities = 101/119 (84%), Positives = 111/119 (93%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPP++KP VEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPPV
Sbjct: 165 EKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPV 224

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKP VEKPP++KPPVEK P++KPP
Sbjct: 225 EKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPP 283

 Score =  225 bits (573), Expect = 1e-57
 Identities = 104/123 (84%), Positives = 111/123 (90%), Gaps = 5/123 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EK PVYKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP V
Sbjct: 195 EKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHV 254

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPV 348
           EKPPVYKP VEKPP++KPPVEK P++KPPVEKPPV+KPPVEKP     PVYKPPVEKPPV
Sbjct: 255 EKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPV 314

Query: 349 YKP 357
           YKP
Sbjct: 315 YKP 317

 Score =  225 bits (573), Expect = 1e-57
 Identities = 103/124 (83%), Positives = 112/124 (90%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKP VEKPPV KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKP V
Sbjct: 205 EKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLV 264

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPV 348
           EKPP++KPPVEK P++KPPVEKPPV+KPPVEKP     PVYKPPVEKPPVYKP VEKPP+
Sbjct: 265 EKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPL 324

Query: 349 YKPP 360
           +KPP
Sbjct: 325 HKPP 328

 Score =  185 bits (470), Expect = 1e-45
 Identities = 81/100 (81%), Positives = 89/100 (89%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKP  YKPP+EK PVYKPPVEKP V+KPPVEKPPV+K PV+K PVYKPP EKPPVYKPPV
Sbjct: 450 EKPTEYKPPIEKFPVYKPPVEKPQVHKPPVEKPPVHKSPVKKLPVYKPPAEKPPVYKPPV 509

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 303
           E PPV+KP VEKPPVYKPPVEKPPV+KPP EKPP+Y PP+
Sbjct: 510 ENPPVHKPLVEKPPVYKPPVEKPPVHKPPFEKPPIYTPPL 549

[9][TOP]
>UniRef100_Q43564 Repetitive proline-rich cell wall protein 1 n=1 Tax=Medicago
           truncatula RepID=PRP1_MEDTR
          Length = 206

 Score =  242 bits (617), Expect = 1e-62
 Identities = 110/123 (89%), Positives = 111/123 (90%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY-----KPPVEKPPVY 171
           +PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVY     KPPV KPPVY
Sbjct: 31  QPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVY 90

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           KPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPV KPPVY
Sbjct: 91  KPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVY 150

Query: 352 KPP 360
           KPP
Sbjct: 151 KPP 153

 Score =  239 bits (611), Expect = 5e-62
 Identities = 110/124 (88%), Positives = 110/124 (88%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY-----KPPVEKPPVYKPPVEKPPV 168
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVY     KPPV KPPVYKPPV KPPV
Sbjct: 40  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPV 99

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           YKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPV
Sbjct: 100 YKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPV 159

Query: 349 YKPP 360
            KPP
Sbjct: 160 VKPP 163

 Score =  237 bits (604), Expect = 3e-61
 Identities = 109/124 (87%), Positives = 109/124 (87%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVY-----KPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           EKPPVYKPPVEKPPVYKPPV KPPVY     KPPV KPPVYKPPV KPPVYKPPVEKPPV
Sbjct: 50  EKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPV 109

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           YKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPPV KPPV
Sbjct: 110 YKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPV 169

Query: 349 YKPP 360
           YKPP
Sbjct: 170 YKPP 173

 Score =  235 bits (599), Expect = 1e-60
 Identities = 108/123 (87%), Positives = 108/123 (87%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV 
Sbjct: 66  KPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVY 125

Query: 187 KPPVYKPPVEKPPVY-----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           KPPVYKPPVEKPPVY     KPPV KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVY
Sbjct: 126 KPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVY 185

Query: 352 KPP 360
           KPP
Sbjct: 186 KPP 188

 Score =  235 bits (599), Expect = 1e-60
 Identities = 106/118 (89%), Positives = 106/118 (89%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPV 
Sbjct: 86  KPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVV 145

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPV KPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVY PP
Sbjct: 146 KPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYGPP 203

 Score =  232 bits (591), Expect = 1e-59
 Identities = 105/118 (88%), Positives = 105/118 (88%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPVE
Sbjct: 76  KPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVE 135

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPV KPPV KPPVYKPP
Sbjct: 136 KPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 193

 Score =  230 bits (587), Expect = 3e-59
 Identities = 105/118 (88%), Positives = 106/118 (89%), Gaps = 5/118 (4%)
 Frame = +1

Query: 22  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY-----KPPVE 186
           KPPV +PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVY     KPPV 
Sbjct: 26  KPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVY 85

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPP
Sbjct: 86  KPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPP 143

 Score =  195 bits (496), Expect = 1e-48
 Identities = 92/109 (84%), Positives = 92/109 (84%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPV KPPVY     KPPVYKPPV
Sbjct: 105 EKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVY-----KPPVYKPPV 159

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 330
            KPPVYKPPV KPPVYKPPVEKPPVY     KPPVYKPPVEKPPVY PP
Sbjct: 160 VKPPVYKPPVYKPPVYKPPVEKPPVY-----KPPVYKPPVEKPPVYGPP 203

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 38/44 (86%), Positives = 39/44 (88%), Gaps = 5/44 (11%)
 Frame = +1

Query: 244 EKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVY+P     PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP
Sbjct: 25  EKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 68

[10][TOP]
>UniRef100_P08012 Repetitive proline-rich cell wall protein 1 n=1 Tax=Glycine max
           RepID=PRP1_SOYBN
          Length = 256

 Score =  239 bits (610), Expect = 7e-62
 Identities = 105/118 (88%), Positives = 108/118 (91%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPP+EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV 
Sbjct: 105 KPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVY 164

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPP+ KPPVYKPP+EKPPVYKPP
Sbjct: 165 KPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPP 222

 Score =  239 bits (609), Expect = 9e-62
 Identities = 106/119 (89%), Positives = 108/119 (90%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPV KPPV KPPV KPPVYKPP+ KPPVYKPPVEKPPVYKPPV KPPVYKPPV
Sbjct: 49  EKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPV 108

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPP+ KPPV KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPP
Sbjct: 109 YKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPP 167

 Score =  239 bits (609), Expect = 9e-62
 Identities = 106/119 (89%), Positives = 108/119 (90%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPV KPP+YKPPV KPPV KPPV KPPVYKPPV KPPVYKPP+EKPPVYKPPV
Sbjct: 64  EKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPV 123

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPP
Sbjct: 124 YKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPP 182

 Score =  239 bits (609), Expect = 9e-62
 Identities = 106/119 (89%), Positives = 108/119 (90%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPV KPPVYKPPV KPP+ KPPV KPPVYKPPV KPPVYKPPV KPPVYKPPV
Sbjct: 89  EKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPV 148

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPP+YKPP
Sbjct: 149 EKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPP 207

 Score =  239 bits (609), Expect = 9e-62
 Identities = 106/119 (89%), Positives = 108/119 (90%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV
Sbjct: 114 EKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPV 173

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPV KPPVYKPPV KPPV KPP+ KPPVYKPP+EKPPVYKPPV KPPVYKPP
Sbjct: 174 EKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPPVYKPPVYKPP 232

 Score =  238 bits (606), Expect = 2e-61
 Identities = 105/117 (89%), Positives = 107/117 (91%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPP+ KPPVYKPPVEKPPVYKPPV K
Sbjct: 41  PPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYK 100

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPVYKPPV KPP+ KPPV KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPP
Sbjct: 101 PPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPP 157

 Score =  238 bits (606), Expect = 2e-61
 Identities = 104/118 (88%), Positives = 108/118 (91%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV 
Sbjct: 130 KPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVY 189

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPVEKPP+YKPPV KPP+ KPPV KPPVYKPPV KPPVYKPPV+KPP+YKPP
Sbjct: 190 KPPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVKKPPIYKPP 247

 Score =  237 bits (605), Expect = 3e-61
 Identities = 108/123 (87%), Positives = 109/123 (88%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVY 171
           KPPVYKPP+ KPPVYKPPVEKPPVYKPPV KPPVYKPPV     EKPPVYKPPV KPPVY
Sbjct: 70  KPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVY 129

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           KPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVY
Sbjct: 130 KPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVY 189

Query: 352 KPP 360
           KPP
Sbjct: 190 KPP 192

 Score =  237 bits (605), Expect = 3e-61
 Identities = 106/118 (89%), Positives = 107/118 (90%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP+ KPPV KPPVYKPPV KPPVYKPPV 
Sbjct: 80  KPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVY 139

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPP
Sbjct: 140 KPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 197

 Score =  237 bits (604), Expect = 3e-61
 Identities = 105/118 (88%), Positives = 107/118 (90%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPVEKPPVYKPPV KPP+YKPPV KPPV KPPV KPPVYKPPV KPPVYKPP+E
Sbjct: 55  KPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIE 114

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPP
Sbjct: 115 KPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 172

 Score =  237 bits (604), Expect = 3e-61
 Identities = 105/118 (88%), Positives = 107/118 (90%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPVYKPP+EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV 
Sbjct: 95  KPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVY 154

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPP+ KPPVYKPP
Sbjct: 155 KPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPPVYKPP 212

 Score =  237 bits (604), Expect = 3e-61
 Identities = 105/118 (88%), Positives = 107/118 (90%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPPV 
Sbjct: 120 KPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVY 179

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPVYKPPVEKPP+YKPPV KPP+ KPPV KPPVYKPPV KPPVYKPP
Sbjct: 180 KPPVYKPPVYKPPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPP 237

 Score =  236 bits (602), Expect = 6e-61
 Identities = 104/119 (87%), Positives = 107/119 (89%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPP+YKPPV  PPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPP+ KPPVYKPPV
Sbjct: 29  EKPPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPV 88

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EKPPVYKPPV KPPVYKPPV KPP+ KPPV KPPVYKPPV KPPVYKPPV KPPVYKPP
Sbjct: 89  EKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPP 147

 Score =  233 bits (595), Expect = 4e-60
 Identities = 104/118 (88%), Positives = 106/118 (89%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV 
Sbjct: 125 KPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVY 184

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPVYKPPV KPPV KPP+ KPPVYKPP+EKPPVYKPPV KPPVYKPPV KPPV KPP
Sbjct: 185 KPPVYKPPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVKKPP 242

 Score =  221 bits (562), Expect = 3e-56
 Identities = 97/113 (85%), Positives = 101/113 (89%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVE
Sbjct: 140 KPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVE 199

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           KPP+YKPPV KPP+ KPPV KPPVYKPPV KPPVYKPPV+KPP+YKPP  K P
Sbjct: 200 KPPIYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVKKPPIYKPPYPKYP 252

 Score =  200 bits (509), Expect = 4e-50
 Identities = 88/104 (84%), Positives = 92/104 (88%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPP+YKPPV
Sbjct: 149 EKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPPV 208

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
            KPP+ KPPV KPPVYKPPV KPPVYKPPV+KPP+YKPP  K P
Sbjct: 209 YKPPIEKPPVYKPPVYKPPVYKPPVYKPPVKKPPIYKPPYPKYP 252

[11][TOP]
>UniRef100_C6TGK1 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TGK1_SOYBN
          Length = 161

 Score =  237 bits (604), Expect = 3e-61
 Identities = 105/124 (84%), Positives = 110/124 (88%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           EKPP+YKPPV  PPVYKPPVEKPPVYKP     PVEKPPVYKPPV KPP+YKPPV KPPV
Sbjct: 29  EKPPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPV 88

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            KPPV KPPVYKPPV KPPVYKPP+EKPPVYKPPV KPPVYKPPV KPPVYKPPV+KPP+
Sbjct: 89  EKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVKKPPI 148

Query: 349 YKPP 360
           YKPP
Sbjct: 149 YKPP 152

 Score =  221 bits (562), Expect = 3e-56
 Identities = 97/113 (85%), Positives = 101/113 (89%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV KPPV KPPVYKPPVEKPPVYKPPV KPP+YKPPV KPPV KPPV KPPVYKPPV 
Sbjct: 45  KPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVY 104

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           KPPVYKPP+EKPPVYKPPV KPPVYKPPV KPPVYKPPV+KPP+YKPP  K P
Sbjct: 105 KPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVKKPPIYKPPYPKYP 157

 Score =  184 bits (467), Expect = 3e-45
 Identities = 80/94 (85%), Positives = 84/94 (89%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPV KPP+YKPPV KPPV KPPV KPPVYKPPV KPPVYKPP+EKPPVYKPPV
Sbjct: 64  EKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPV 123

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 285
            KPPVYKPPV KPPVYKPPV+KPP+YKPP  K P
Sbjct: 124 YKPPVYKPPVYKPPVYKPPVKKPPIYKPPYPKYP 157

[12][TOP]
>UniRef100_Q2PET4 Putative uncharacterized protein n=1 Tax=Trifolium pratense
           RepID=Q2PET4_TRIPR
          Length = 478

 Score =  213 bits (542), Expect = 5e-54
 Identities = 86/106 (81%), Positives = 96/106 (90%)
 Frame = +1

Query: 28  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 207
           PVE PPVYKPPVEKPPVYKPPVEKPP+YKPP+E PP+YKPP EKPP+YKPP EKPPVYKP
Sbjct: 359 PVETPPVYKPPVEKPPVYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKP 418

Query: 208 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           P+E+PP YKPP E PP+YKPP EKPP+YKPP EKPP+YKPP E+PP
Sbjct: 419 PIEEPPFYKPPFENPPIYKPPYEKPPLYKPPFEKPPLYKPPFEEPP 464

 Score =  209 bits (532), Expect = 8e-53
 Identities = 86/113 (76%), Positives = 98/113 (86%), Gaps = 2/113 (1%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E PPVYKPPVEKPPVYKPPVEKPP+YKPP+E PP+YKPP EKPP+YKPP EKPPVYKPP+
Sbjct: 361 ETPPVYKPPVEKPPVYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKPPI 420

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVE 336
           E+PP YKPP E PP+YKPP EKPP+YKPP EKPP+YKPP E+PP +   PP +
Sbjct: 421 EEPPFYKPPFENPPIYKPPYEKPPLYKPPFEKPPLYKPPFEEPPHHPKYPPAD 473

 Score =  206 bits (523), Expect = 9e-52
 Identities = 83/101 (82%), Positives = 92/101 (91%)
 Frame = +1

Query: 58  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 237
           PVE PPVYKPPVEKPPVYKPPVEKPP+YKPP+E PP+YKPP EKPP+YKPP EKPPVYKP
Sbjct: 359 PVETPPVYKPPVEKPPVYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKP 418

Query: 238 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P+E+PP YKPP E PP+YKPP EKPP+YKPP EKPP+YKPP
Sbjct: 419 PIEEPPFYKPPFENPPIYKPPYEKPPLYKPPFEKPPLYKPP 459

[13][TOP]
>UniRef100_A9PE91 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PE91_POPTR
          Length = 182

 Score =  197 bits (501), Expect = 3e-49
 Identities = 94/124 (75%), Positives = 104/124 (83%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           + KPPVYKPP +EKPPVYKPP    PVYKPP+EKPPVYKPP    PVYKPP+EKPPVYKP
Sbjct: 48  EHKPPVYKPPKIEKPPVYKPP----PVYKPPIEKPPVYKPP----PVYKPPIEKPPVYKP 99

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP-VEKPPVYKPP-VEKPPV 348
           P    PVYKPP+EKPPVYKPP+EKPPVYKPP +EKPPVYKPP +EKPPVYKPP +EKPP 
Sbjct: 100 P----PVYKPPIEKPPVYKPPIEKPPVYKPPKIEKPPVYKPPKIEKPPVYKPPKIEKPPP 155

Query: 349 YKPP 360
           +  P
Sbjct: 156 FHKP 159

 Score =  191 bits (485), Expect = 2e-47
 Identities = 98/127 (77%), Positives = 105/127 (82%), Gaps = 9/127 (7%)
 Frame = +1

Query: 7   KPPVY--KPPVEKPP-VYKP-PVEKPPVYKPP-VEKPPVYK-PPVEKPPVYKPPVEK-PP 165
           KPP Y  KPP  KPP V KP P  KPPVYKPP +EKPPVYK PPV KPP+ KPPV K PP
Sbjct: 26  KPPKYEPKPPYFKPPKVEKPFPEHKPPVYKPPKIEKPPVYKPPPVYKPPIEKPPVYKPPP 85

Query: 166 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP-VEK 339
           VYKPP+EKPPVYKP    PPVYKPP+EKPPVYKPP+EKPPVYKPP +EKPPVYKPP +EK
Sbjct: 86  VYKPPIEKPPVYKP----PPVYKPPIEKPPVYKPPIEKPPVYKPPKIEKPPVYKPPKIEK 141

Query: 340 PPVYKPP 360
           PPVYKPP
Sbjct: 142 PPVYKPP 148

 Score =  144 bits (364), Expect = 2e-33
 Identities = 73/113 (64%), Positives = 82/113 (72%), Gaps = 17/113 (15%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPP------VEKPPVYKP------PVEKPPVYKPPVEKPPVYKPP- 150
           PPVYKPP+EKPPVYKPP      +EKPPVYKP      P+EKPPVYKPP+EKPPVYKPP 
Sbjct: 68  PPVYKPPIEKPPVYKPPPVYKPPIEKPPVYKPPPVYKPPIEKPPVYKPPIEKPPVYKPPK 127

Query: 151 VEKPPVYKPP-VEKPPVYKPP-VEKPPVYKPPVEKPPVY--KPPVEKPPVYKP 297
           +EKPPVYKPP +EKPPVYKPP +EKPP +  P+     Y   PPVE     KP
Sbjct: 128 IEKPPVYKPPKIEKPPVYKPPKIEKPPPFHKPLPPYGHYPGHPPVENAEYIKP 180

[14][TOP]
>UniRef100_O24443 Cell wall type 2 proline rich protein PvPRP2-37 (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=O24443_PHAVU
          Length = 81

 Score =  183 bits (464), Expect = 6e-45
 Identities = 80/81 (98%), Positives = 80/81 (98%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPVY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 187 KPPVYKPPVEKPPVYKPPVEK 249
           KPPVYKPPVEKPPVYKPPVEK
Sbjct: 61  KPPVYKPPVEKPPVYKPPVEK 81

 Score =  183 bits (464), Expect = 6e-45
 Identities = 80/81 (98%), Positives = 80/81 (98%)
 Frame = +1

Query: 37  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 216
           KPPVY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 217 KPPVYKPPVEKPPVYKPPVEK 279
           KPPVYKPPVEKPPVYKPPVEK
Sbjct: 61  KPPVYKPPVEKPPVYKPPVEK 81

 Score =  183 bits (464), Expect = 6e-45
 Identities = 80/81 (98%), Positives = 80/81 (98%)
 Frame = +1

Query: 67  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 246
           KPPVY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 247 KPPVYKPPVEKPPVYKPPVEK 309
           KPPVYKPPVEKPPVYKPPVEK
Sbjct: 61  KPPVYKPPVEKPPVYKPPVEK 81

 Score =  183 bits (464), Expect = 6e-45
 Identities = 80/81 (98%), Positives = 80/81 (98%)
 Frame = +1

Query: 97  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 276
           KPPVY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 277 KPPVYKPPVEKPPVYKPPVEK 339
           KPPVYKPPVEKPPVYKPPVEK
Sbjct: 61  KPPVYKPPVEKPPVYKPPVEK 81

 Score =  177 bits (450), Expect = 2e-43
 Identities = 77/78 (98%), Positives = 77/78 (98%)
 Frame = +1

Query: 127 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 306
           KPPVY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 307 KPPVYKPPVEKPPVYKPP 360
           KPPVYKPPVEKPPVYKPP
Sbjct: 61  KPPVYKPPVEKPPVYKPP 78

 Score =  164 bits (416), Expect = 2e-39
 Identities = 72/72 (100%), Positives = 72/72 (100%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV
Sbjct: 10  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 69

Query: 184 EKPPVYKPPVEK 219
           EKPPVYKPPVEK
Sbjct: 70  EKPPVYKPPVEK 81

[15][TOP]
>UniRef100_Q39686 Proline-rich protein n=1 Tax=Daucus carota RepID=Q39686_DAUCA
          Length = 235

 Score =  174 bits (441), Expect = 3e-42
 Identities = 82/144 (56%), Positives = 99/144 (68%), Gaps = 27/144 (18%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP++KPPV  PPV+KPP+ KPPVY  PV KPP++KPPV  PPV+KPP+ KPPVY PPV K
Sbjct: 24  PPIHKPPVYTPPVHKPPIHKPPVYTSPVHKPPIHKPPVYTPPVHKPPIHKPPVYTPPVHK 83

Query: 190 PP-VYKPPVE-------------KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKP---- 312
           PP  YKPPVE             KPPVYKPPV+KP P +KPPV KPP++KPPV       
Sbjct: 84  PPSEYKPPVEATNSVTEDHYPIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVT 143

Query: 313 -------PVYKP-PVEKPPVYKPP 360
                  P++KP P+ +PPV+KPP
Sbjct: 144 DDHYPAHPIHKPQPIHRPPVHKPP 167

 Score =  162 bits (411), Expect = 8e-39
 Identities = 84/148 (56%), Positives = 100/148 (67%), Gaps = 30/148 (20%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVE--------- 156
           KPPVY  PV KPP++KPPV  PPV+KPP+ KPPVY PPV KPP  YKPPVE         
Sbjct: 43  KPPVYTSPVHKPPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPPSEYKPPVEATNSVTEDH 102

Query: 157 ----KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKP-----------PVYKP-PVEKPP 285
               KPPVYKPPV+KP P +KPPV KPP++KPPV              P++KP P+ +PP
Sbjct: 103 YPIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPP 162

Query: 286 VYKPPVE-KPPVYKPPVE-KP-PVYKPP 360
           V+KPP E KPPV++P  E KP PVY+PP
Sbjct: 163 VHKPPTEHKPPVHEPATEHKPSPVYQPP 190

 Score =  148 bits (373), Expect = 2e-34
 Identities = 81/145 (55%), Positives = 98/145 (67%), Gaps = 27/145 (18%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKP--------PVEKPPVYKPPVEK 159
           KPPVY PPV KPP++KPPV  PPV+KPP E KPPV           P+ KPPVYKPPV+K
Sbjct: 58  KPPVYTPPVHKPPIHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHYPIHKPPVYKPPVQK 117

Query: 160 P-PVYKPPVEKPPVYKPPVEKP-----------PVYKP-PVEKPPVYKPPVE-KPPVYKP 297
           P P +KPPV KPP++KPPV              P++KP P+ +PPV+KPP E KPPV++P
Sbjct: 118 PAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPVHKPPTEHKPPVHEP 177

Query: 298 PVE-KP-PVYKPP-VEKP-PVYKPP 360
             E KP PVY+PP  EKP P +KPP
Sbjct: 178 ATEHKPSPVYQPPKTEKPVPEHKPP 202

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 58/119 (48%), Positives = 73/119 (61%), Gaps = 7/119 (5%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKP-PVEKPPVYKPPVE-KPPVY 171
           Q+  P +KPPV KPP++KPPV   P V        P++KP P+ +PPV+KPP E KPPV+
Sbjct: 116 QKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPVHKPPTEHKPPVH 175

Query: 172 KPPVE-KP-PVYKPP-VEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
           +P  E KP PVY+PP  EKP P +KPP   P V +PP    P   PP    P + PPVE
Sbjct: 176 EPATEHKPSPVYQPPKTEKPVPEHKPPHLPPIVVRPPPTHKP--NPPYGHHPGH-PPVE 231

[16][TOP]
>UniRef100_P93237 Proline-rich protein PRP2 n=1 Tax=Lupinus luteus RepID=P93237_LUPLU
          Length = 894

 Score =  169 bits (427), Expect = 1e-40
 Identities = 86/138 (62%), Positives = 101/138 (73%), Gaps = 19/138 (13%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPV------------Y 141
           EKPPVY+PP EKPP V+ PP EKPP+ Y PP EKPPV++PP EKPP+            Y
Sbjct: 549 EKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEY 608

Query: 142 KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEK 309
            PP EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPPVY+PP EK PPV+ PP EK
Sbjct: 609 HPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEK 668

Query: 310 PPV-YKPPVEKPPVYKPP 360
           PP+ Y PP+EKPPV++PP
Sbjct: 669 PPIEYPPPLEKPPVHEPP 686

 Score =  167 bits (423), Expect = 3e-40
 Identities = 83/127 (65%), Positives = 99/127 (77%), Gaps = 8/127 (6%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV- 168
           EKPP+ Y PP EKPPV++PP EKPP V+ PP +KPP+ Y PP EKPP+ Y PP EKPP+ 
Sbjct: 570 EKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIE 629

Query: 169 YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK 339
           Y PP EKPP+ Y PP EKPPVY+PP EK PPV+ PP EKPP+ Y PP+EKPPV++PP EK
Sbjct: 630 YPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEK 689

Query: 340 PPVYKPP 360
           PP  +PP
Sbjct: 690 PPPVQPP 696

 Score =  166 bits (420), Expect = 7e-40
 Identities = 85/138 (61%), Positives = 100/138 (72%), Gaps = 19/138 (13%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV- 168
           EKPPV++PP EKPP V+ PP +KPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPP+ 
Sbjct: 581 EKPPVHEPPYEKPPLVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIE 640

Query: 169 YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP--------- 315
           Y PP EKPPVY+PP EK PPV+ PP EKPP+ Y PP+EKPPV++PP EKPP         
Sbjct: 641 YPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDK 700

Query: 316 ---VYKPPVEKPPVYKPP 360
               Y PP EKPPVY+PP
Sbjct: 701 PPIEYPPPHEKPPVYEPP 718

 Score =  163 bits (412), Expect = 6e-39
 Identities = 83/127 (65%), Positives = 96/127 (75%), Gaps = 8/127 (6%)
 Frame = +1

Query: 4   EKPPVYKP-PVEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP-VY 171
           EKPP+  P P EKPPVY+PP EKPP V+ PP EKPP+ Y PP EKPPV++PP EKPP V+
Sbjct: 538 EKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVH 597

Query: 172 KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK 339
            PP +KPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPPVY+PP EK
Sbjct: 598 PPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEK 657

Query: 340 PPVYKPP 360
           PP   PP
Sbjct: 658 PPPVHPP 664

 Score =  162 bits (409), Expect = 1e-38
 Identities = 84/128 (65%), Positives = 98/128 (76%), Gaps = 9/128 (7%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV- 168
           EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPPVY+PP EK PPV+ PP EKPP+ 
Sbjct: 613 EKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIE 672

Query: 169 YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEK 339
           Y PP+EKPPV++PP EK PPV  PP +KPP+ Y PP EKPPVY+PP E+ PPV+ P  EK
Sbjct: 673 YPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEK 732

Query: 340 PP-VYKPP 360
           PP VY PP
Sbjct: 733 PPFVYPPP 740

 Score =  161 bits (408), Expect = 2e-38
 Identities = 82/127 (64%), Positives = 98/127 (77%), Gaps = 8/127 (6%)
 Frame = +1

Query: 4    EKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVY 171
            EKPP+ Y PP EKPP+ Y PP EKPPVY+PP EK PPV+ PP EKPP+ Y PP+EKPPV+
Sbjct: 624  EKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVH 683

Query: 172  KPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEK 339
            +PP EK PPV  PP +KPP+ Y PP EKPPVY+PP E+ PPV+ P  EKPP VY PP EK
Sbjct: 684  EPPYEKPPPVQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEK 743

Query: 340  PPVYKPP 360
             P+++PP
Sbjct: 744  SPMHEPP 750

 Score =  160 bits (405), Expect = 4e-38
 Identities = 82/127 (64%), Positives = 98/127 (77%), Gaps = 8/127 (6%)
 Frame = +1

Query: 4    EKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVY 171
            EKPP+ Y PP EKPPVY+PP EK PPV+ PP EKPP+ Y PP+EKPPV++PP EK PPV 
Sbjct: 635  EKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQ 694

Query: 172  KPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK- 339
             PP +KPP+ Y PP EKPPVY+PP E+ PPV+ P  EKPP VY PP EK P+++PP EK 
Sbjct: 695  PPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKA 754

Query: 340  PPVYKPP 360
            PPV+ PP
Sbjct: 755  PPVHLPP 761

 Score =  160 bits (405), Expect = 4e-38
 Identities = 82/127 (64%), Positives = 98/127 (77%), Gaps = 8/127 (6%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-Y 171
            EKPPVY+PP EKPP V+ PP EKPP+ Y PP+EKPPV++PP EK PPV  PP +KPP+ Y
Sbjct: 646  EKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEY 705

Query: 172  KPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKP 342
             PP EKPPVY+PP E+ PPV+ P  EKPP VY PP EK P+++PP EK PPV+ PP EKP
Sbjct: 706  PPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKP 765

Query: 343  PV-YKPP 360
            P+ Y PP
Sbjct: 766  PIEYAPP 772

 Score =  158 bits (399), Expect = 2e-37
 Identities = 81/132 (61%), Positives = 95/132 (71%), Gaps = 13/132 (9%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVY 171
           EKPP+ Y PP EKP + Y PP EK PVY+PP EK PPV+ PP EKPP+ Y PP EKPPV+
Sbjct: 366 EKPPIEYPPPHEKPSIEYPPPHEKSPVYEPPYEKSPPVHPPPDEKPPIEYPPPHEKPPVH 425

Query: 172 KPPVEKPP-------VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYK 324
           +PP +KPP        Y PP EKPPVY+PP EK PPV+ PP EKPP V+ PP EKPP+++
Sbjct: 426 EPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYEKSPPVHPPPHEKPPIVHPPPHEKPPLFE 485

Query: 325 PPVEKPPVYKPP 360
           PP EKPP   PP
Sbjct: 486 PPFEKPPPVHPP 497

 Score =  157 bits (398), Expect = 3e-37
 Identities = 82/133 (61%), Positives = 95/133 (71%), Gaps = 14/133 (10%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPV 168
           EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKP + Y PP EK PVY+PP EK PPV
Sbjct: 344 EKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPSIEYPPPHEKSPVYEPPYEKSPPV 403

Query: 169 YKPPVEKPPV-YKPPVEKPPVYKPPVEKPP-------VYKPPVEKPPVYKPPVEK-PPVY 321
           + PP EKPP+ Y PP EKPPV++PP +KPP        Y PP EKPPVY+PP EK PPV+
Sbjct: 404 HPPPDEKPPIEYPPPHEKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYEKSPPVH 463

Query: 322 KPPVEKPPVYKPP 360
            PP EKPP+  PP
Sbjct: 464 PPPHEKPPIVHPP 476

 Score =  157 bits (398), Expect = 3e-37
 Identities = 82/133 (61%), Positives = 97/133 (72%), Gaps = 14/133 (10%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV- 168
           EKPP+ Y PP EKPP+ Y PP EKP + Y PP EK PVY+PP EK PPV+ PP EKPP+ 
Sbjct: 355 EKPPIEYPPPHEKPPIEYPPPHEKPSIEYPPPHEKSPVYEPPYEKSPPVHPPPDEKPPIE 414

Query: 169 YKPPVEKPPVYKPPVEKPP-------VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VY 321
           Y PP EKPPV++PP +KPP        Y PP EKPPVY+PP EK PPV+ PP EKPP V+
Sbjct: 415 YPPPHEKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYEKSPPVHPPPHEKPPIVH 474

Query: 322 KPPVEKPPVYKPP 360
            PP EKPP+++PP
Sbjct: 475 PPPHEKPPLFEPP 487

 Score =  157 bits (398), Expect = 3e-37
 Identities = 81/132 (61%), Positives = 96/132 (72%), Gaps = 13/132 (9%)
 Frame = +1

Query: 4   EKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP-------VYKPPVE 156
           EK PVY+PP EK PPV+ PP EKPP+ Y PP EKPPV++PP +KPP        Y PP E
Sbjct: 388 EKSPVYEPPYEKSPPVHPPPDEKPPIEYPPPHEKPPVHEPPYKKPPPHDKPPIEYPPPHE 447

Query: 157 KPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKP 327
           KPPVY+PP EK PPV+ PP EKPP V+ PP EKPP+++PP EK PPV+ PPV  PP  KP
Sbjct: 448 KPPVYEPPYEKSPPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEKP 507

Query: 328 PVEKPPVY-KPP 360
           P+E PP + KPP
Sbjct: 508 PIEYPPPHTKPP 519

 Score =  156 bits (395), Expect = 6e-37
 Identities = 79/127 (62%), Positives = 96/127 (75%), Gaps = 7/127 (5%)
 Frame = +1

Query: 1    QEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVY 171
            ++ PPV+ PP EKPP+ Y PP+EKPPV++PP EK PPV  PP +KPP+ Y PP EKPPVY
Sbjct: 656  EKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEKPPVY 715

Query: 172  KPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEK 339
            +PP E+ PPV+ P  EKPP VY PP EK P+++PP EK PPV+ PP EKPP+ Y PP EK
Sbjct: 716  EPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEK 775

Query: 340  PPVYKPP 360
            PPV  PP
Sbjct: 776  PPVEYPP 782

 Score =  155 bits (393), Expect = 1e-36
 Identities = 76/137 (55%), Positives = 95/137 (69%), Gaps = 17/137 (12%)
 Frame = +1

Query: 1   QEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP------------VY 141
           ++ PPVY+PP EK PPV++PP E PP+  PP EKPP+++ P EKPP             Y
Sbjct: 216 EKPPPVYEPPYEKSPPVHQPPYETPPIENPPHEKPPIHESPYEKPPPVHPPPHDKPSIEY 275

Query: 142 KPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKP 312
            PP EKPPVY+PP +K PPV+ PP EKPP+ Y PP EKPPV++PP EK PP + PP +KP
Sbjct: 276 PPPHEKPPVYEPPYDKPPPVHPPPHEKPPIEYPPPHEKPPVHEPPYEKPPPEHSPPHDKP 335

Query: 313 PV-YKPPVEKPPVYKPP 360
           P+ Y PP EKPP+  PP
Sbjct: 336 PIEYHPPHEKPPIEYPP 352

 Score =  155 bits (392), Expect = 1e-36
 Identities = 83/144 (57%), Positives = 96/144 (66%), Gaps = 25/144 (17%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPV------------YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV- 138
           EKPPV++PP EKPP             Y PP EKPP+ Y PP EKPP+ Y PP EKPP+ 
Sbjct: 312 EKPPVHEPPYEKPPPEHSPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIE 371

Query: 139 YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK 309
           Y PP EKP + Y PP EK PVY+PP EK PPV+ PP EKPP+ Y PP EKPPV++PP +K
Sbjct: 372 YPPPHEKPSIEYPPPHEKSPVYEPPYEKSPPVHPPPDEKPPIEYPPPHEKPPVHEPPYKK 431

Query: 310 PP-------VYKPPVEKPPVYKPP 360
           PP        Y PP EKPPVY+PP
Sbjct: 432 PPPHDKPPIEYPPPHEKPPVYEPP 455

 Score =  154 bits (389), Expect = 3e-36
 Identities = 78/133 (58%), Positives = 96/133 (72%), Gaps = 13/133 (9%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP-------VYKPPVEKPPVYKPPVE 156
           ++ PPV+ PP EKPP+ Y PP EKPPV++PP +KPP        Y PP EKPPVY+PP E
Sbjct: 398 EKSPPVHPPPDEKPPIEYPPPHEKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYE 457

Query: 157 K-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVY-K 324
           K PPV+ PP EKPP V+ PP EKPP+++PP EK PPV+ PPV  PP  KPP+E PP + K
Sbjct: 458 KSPPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEKPPIEYPPPHTK 517

Query: 325 PPVEKPPVY-KPP 360
           PP+E PP + KPP
Sbjct: 518 PPIEYPPPHVKPP 530

 Score =  153 bits (387), Expect = 5e-36
 Identities = 81/138 (58%), Positives = 97/138 (70%), Gaps = 19/138 (13%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPV-------YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVE 156
           EKPPV++PP +KPP        Y PP EKPPVY+PP EK PPV+ PP EKPP V+ PP E
Sbjct: 420 EKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYEKSPPVHPPPHEKPPIVHPPPHE 479

Query: 157 KPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVY-KPPVE------KPPV-YKPPVEK 309
           KPP+++PP EK PPV+ PPV  PP  KPP+E PP + KPP+E      KPP+ Y PP EK
Sbjct: 480 KPPLFEPPFEKPPPVHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHVKPPIQYPPPHEK 539

Query: 310 PPV-YKPPVEKPPVYKPP 360
           PP+ Y  P EKPPVY+PP
Sbjct: 540 PPIEYPLPHEKPPVYEPP 557

 Score =  153 bits (387), Expect = 5e-36
 Identities = 79/133 (59%), Positives = 97/133 (72%), Gaps = 13/133 (9%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVY- 171
           ++ PPV+ PP EKPP V+ PP EKPP+++PP EK PPV+ PPV  PP  KPP+E PP + 
Sbjct: 457 EKSPPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEKPPIEYPPPHT 516

Query: 172 KPPVE------KPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-Y 321
           KPP+E      KPP+ Y PP EKPP+ Y  P EKPPVY+PP EK PPV+ PP EKPP+ Y
Sbjct: 517 KPPIEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEY 576

Query: 322 KPPVEKPPVYKPP 360
            PP EKPPV++PP
Sbjct: 577 SPPHEKPPVHEPP 589

 Score =  151 bits (382), Expect = 2e-35
 Identities = 80/126 (63%), Positives = 94/126 (74%), Gaps = 8/126 (6%)
 Frame = +1

Query: 4    EKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVY 171
            EKPP+ Y PP+EKPPV++PP EK PPV  PP +KPP+ Y PP EKPPVY+PP E+ PPV+
Sbjct: 667  EKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVH 726

Query: 172  KPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEK 339
             P  EKPP VY PP EK P+++PP EK PPV+ PP EKPP+ Y PP EKPPV Y PP  K
Sbjct: 727  PPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVK 786

Query: 340  PPVYKP 357
            PPV  P
Sbjct: 787  PPVEYP 792

 Score =  149 bits (377), Expect = 7e-35
 Identities = 81/132 (61%), Positives = 93/132 (70%), Gaps = 13/132 (9%)
 Frame = +1

Query: 4    EKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVY 171
            +KPP+ Y PP EKPPVY+PP E+ PPV+ P  EKPP VY PP EK P+++PP EK PPV+
Sbjct: 699  DKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVH 758

Query: 172  KPPVEKPPV-YKPPVEKPPV------YKPPVEKP-PVYKPPV-EKPPVYKPPVEKPPVYK 324
             PP EKPP+ Y PP EKPPV       KPPVE P P  KPP  EKPP+  PP EKPPVY+
Sbjct: 759  LPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYE 818

Query: 325  PPVEKPPVYKPP 360
            PP EKPP   PP
Sbjct: 819  PPYEKPPSVCPP 830

 Score =  147 bits (372), Expect = 3e-34
 Identities = 79/132 (59%), Positives = 93/132 (70%), Gaps = 13/132 (9%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKPPVYKPPVEK------PPVYKPPVEKPPVY-KPPVEKPPVYKPPV-E 156
           EKP + Y PP EK PVY+PP EK      PP  KPP+E PP + KPPV +PP  KPP  +
Sbjct: 377 EKPSIEYPPPHEKSPVYEPPYEKSPPVHPPPDEKPPIEYPPPHEKPPVHEPPYKKPPPHD 436

Query: 157 KPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYK 324
           KPP+ Y PP EKPPVY+PP EK PPV+ PP EKPP V+ PP EKPP+++PP EK PPV+ 
Sbjct: 437 KPPIEYPPPHEKPPVYEPPYEKSPPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHP 496

Query: 325 PPVEKPPVYKPP 360
           PPV  PP  KPP
Sbjct: 497 PPVHPPPHEKPP 508

 Score =  145 bits (367), Expect = 1e-33
 Identities = 78/161 (48%), Positives = 96/161 (59%), Gaps = 42/161 (26%)
 Frame = +1

Query: 4   EKP-PVYKPPVEKPPVYKPPVEK--PPVYKPPVEK------------------------P 102
           EKP PVY+PP EKPP+  PP  +  PP+Y+ P EK                        P
Sbjct: 160 EKPSPVYEPPYEKPPILHPPPHEKPPPLYESPSEKPPHVHPPPPHKKPPIGYPPSYEKPP 219

Query: 103 PVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP------------VYKPPV 243
           PVY+PP EK PPV++PP E PP+  PP EKPP+++ P EKPP             Y PP 
Sbjct: 220 PVYEPPYEKSPPVHQPPYETPPIENPPHEKPPIHESPYEKPPPVHPPPHDKPSIEYPPPH 279

Query: 244 EKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPP 360
           EKPPVY+PP +K PPV+ PP EKPP+ Y PP EKPPV++PP
Sbjct: 280 EKPPVYEPPYDKPPPVHPPPHEKPPIEYPPPHEKPPVHEPP 320

 Score =  145 bits (366), Expect = 1e-33
 Identities = 76/140 (54%), Positives = 94/140 (67%), Gaps = 21/140 (15%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKP-PVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPP-VYKPPVEK--- 159
           EKPP+ Y PP EKP PVY+PP EKPP+  PP  +  PP+Y+ P EKPP V+ PP  K   
Sbjct: 149 EKPPIDYPPPHEKPSPVYEPPYEKPPILHPPPHEKPPPLYESPSEKPPHVHPPPPHKKPP 208

Query: 160 ----------PPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPV 303
                     PPVY+PP EK PPV++PP E PP+  PP EKPP+++ P EK PPV+ PP 
Sbjct: 209 IGYPPSYEKPPPVYEPPYEKSPPVHQPPYETPPIENPPHEKPPIHESPYEKPPPVHPPPH 268

Query: 304 EKPPV-YKPPVEKPPVYKPP 360
           +KP + Y PP EKPPVY+PP
Sbjct: 269 DKPSIEYPPPHEKPPVYEPP 288

 Score =  136 bits (343), Expect = 6e-31
 Identities = 72/142 (50%), Positives = 92/142 (64%), Gaps = 22/142 (15%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKP-P 165
           ++ PP+Y  P EKPP+  PP   + PP+Y+PP EK PP++ PP EKPP+ Y PP EKP P
Sbjct: 105 EKSPPLYPSPHEKPPIECPPPHDKLPPIYEPPNEKPPPLHPPPHEKPPIDYPPPHEKPSP 164

Query: 166 VYKPPVEKPPVYKPPVEK--PPVYKPPVEKPP-VYKPPVEK-------------PPVYKP 297
           VY+PP EKPP+  PP  +  PP+Y+ P EKPP V+ PP  K             PPVY+P
Sbjct: 165 VYEPPYEKPPILHPPPHEKPPPLYESPSEKPPHVHPPPPHKKPPIGYPPSYEKPPPVYEP 224

Query: 298 PVEK-PPVYKPPVEKPPVYKPP 360
           P EK PPV++PP E PP+  PP
Sbjct: 225 PYEKSPPVHQPPYETPPIENPP 246

 Score =  133 bits (334), Expect = 7e-30
 Identities = 74/130 (56%), Positives = 88/130 (67%), Gaps = 11/130 (8%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPP--VEKPPVY-KPPVEK-PPVYKPPVEKP-PVYKPPVEK-PP 165
           E PPVY PP EKP +  PP   EKPP + KPP EK PP Y PP E+P P + P  EK PP
Sbjct: 50  EPPPVYHPPREKPSIENPPPSYEKPPPHEKPPHEKSPPEYSPPHEEPTPEFPPSHEKSPP 109

Query: 166 VYKPPVEKPPVYKPPV--EKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKP-PVYKPP 330
           +Y  P EKPP+  PP   + PP+Y+PP EK PP++ PP EKPP+ Y PP EKP PVY+PP
Sbjct: 110 LYPSPHEKPPIECPPPHDKLPPIYEPPNEKPPPLHPPPHEKPPIDYPPPHEKPSPVYEPP 169

Query: 331 VEKPPVYKPP 360
            EKPP+  PP
Sbjct: 170 YEKPPILHPP 179

 Score =  133 bits (334), Expect = 7e-30
 Identities = 76/132 (57%), Positives = 86/132 (65%), Gaps = 13/132 (9%)
 Frame = +1

Query: 4    EKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV- 168
            EKPP VY PP EK P+++PP EK PPV+ PP EKPP+ Y PP EKPPV Y PP  KPPV 
Sbjct: 731  EKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVE 790

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPP-------VYK 324
            Y  P EKPP +    EKPP+  PP EKPPVY+PP EKPP V  PP EKPP       +Y 
Sbjct: 791  YPSPAEKPPTH----EKPPIEFPPHEKPPVYEPPYEKPPSVCPPPHEKPPHHEKRSALYP 846

Query: 325  PPVEKPPVYKPP 360
            P   KPP +  P
Sbjct: 847  PHHRKPPNHHKP 858

 Score =  129 bits (324), Expect = 1e-28
 Identities = 72/130 (55%), Positives = 88/130 (67%), Gaps = 11/130 (8%)
 Frame = +1

Query: 4   EKPPVY-KPPVEK-PPVYKPPVEKP-PVYKPPVEK-PPVYKPPVEKPPVYKPPV--EKPP 165
           EKPP + KPP EK PP Y PP E+P P + P  EK PP+Y  P EKPP+  PP   + PP
Sbjct: 72  EKPPPHEKPPHEKSPPEYSPPHEEPTPEFPPSHEKSPPLYPSPHEKPPIECPPPHDKLPP 131

Query: 166 VYKPPVEK-PPVYKPPVEKPPV-YKPPVEKP-PVYKPPVEKPPVYKPPVEK--PPVYKPP 330
           +Y+PP EK PP++ PP EKPP+ Y PP EKP PVY+PP EKPP+  PP  +  PP+Y+ P
Sbjct: 132 IYEPPNEKPPPLHPPPHEKPPIDYPPPHEKPSPVYEPPYEKPPILHPPPHEKPPPLYESP 191

Query: 331 VEKPPVYKPP 360
            EKPP   PP
Sbjct: 192 SEKPPHVHPP 201

 Score =  121 bits (304), Expect = 2e-26
 Identities = 72/130 (55%), Positives = 86/130 (66%), Gaps = 13/130 (10%)
 Frame = +1

Query: 4    EKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV------YKPPVEKP-PVYKPPV- 153
            EK P+++PP EK PPV+ PP EKPP+ Y PP EKPPV       KPPVE P P  KPP  
Sbjct: 742  EKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTH 801

Query: 154  EKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKP 327
            EKPP+  PP EKPPVY+PP EKPP V  PP EKPP ++   ++  +Y P   KPP  +KP
Sbjct: 802  EKPPIEFPPHEKPPVYEPPYEKPPSVCPPPHEKPPHHE---KRSALYPPHHRKPPNHHKP 858

Query: 328  -PVEKPPVYK 354
             P +KPP YK
Sbjct: 859  LPYKKPPFYK 868

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 58/134 (43%), Positives = 71/134 (52%), Gaps = 29/134 (21%)
 Frame = +1

Query: 46  VYKPPV---EKPPVYKPPVEKPPVYKPPVEK--PPVYKPP-VEKPPVYKPPVEKPPV--- 198
           V  PPV    K P Y+PP    P+++PP  +  PPVY+PP V  PP  KP +E PP    
Sbjct: 16  VITPPVLANYKQPTYEPPT---PIFEPPPFETLPPVYEPPPVYHPPREKPSIENPPPSYE 72

Query: 199 -----YKPPVEK-PPVYKPPVEK------------PPVYKPPVEKPPVYKPPV--EKPPV 318
                 KPP EK PP Y PP E+            PP+Y  P EKPP+  PP   + PP+
Sbjct: 73  KPPPHEKPPHEKSPPEYSPPHEEPTPEFPPSHEKSPPLYPSPHEKPPIECPPPHDKLPPI 132

Query: 319 YKPPVEKPPVYKPP 360
           Y+PP EKPP   PP
Sbjct: 133 YEPPNEKPPPLHPP 146

[17][TOP]
>UniRef100_A9VE05 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9VE05_MONBE
          Length = 1536

 Score =  169 bits (427), Expect = 1e-40
 Identities = 70/118 (59%), Positives = 84/118 (71%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  
Sbjct: 1244 KPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAA 1303

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP
Sbjct: 1304 KPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPP 1361

 Score =  166 bits (420), Expect = 7e-40
 Identities = 69/117 (58%), Positives = 83/117 (70%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  
Sbjct: 1254 KPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAA 1313

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP  KPPV +P
Sbjct: 1314 KPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEP 1370

 Score =  156 bits (395), Expect = 6e-37
 Identities = 66/119 (55%), Positives = 79/119 (66%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E P        KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP 
Sbjct: 1233 EAPTADSSAAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPA 1292

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             KPP+ +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP
Sbjct: 1293 AKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPP 1351

 Score =  144 bits (364), Expect = 2e-33
 Identities = 62/118 (52%), Positives = 74/118 (62%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KP       E P        KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  
Sbjct: 1224 KPKTEPVDAEAPTADSSAAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAA 1283

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP
Sbjct: 1284 KPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPP 1341

 Score =  135 bits (339), Expect = 2e-30
 Identities = 64/123 (52%), Positives = 75/123 (60%), Gaps = 7/123 (5%)
 Frame = +1

Query: 13   PVYKPPVEKPP--VYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVY 171
            PV KP  E P   V KP  E      P  +     KPPV +PP  KPPV +PP  KPPV 
Sbjct: 1209 PVAKPRPEAPASEVAKPKTEPVDAEAPTADSSAAAKPPVVEPPAAKPPVVEPPAAKPPVV 1268

Query: 172  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
            +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP  KPPV 
Sbjct: 1269 EPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVV 1328

Query: 352  KPP 360
            +PP
Sbjct: 1329 EPP 1331

[18][TOP]
>UniRef100_UPI0001983482 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983482
          Length = 329

 Score =  167 bits (423), Expect = 3e-40
 Identities = 93/131 (70%), Positives = 108/131 (82%), Gaps = 11/131 (8%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV 168
           ++ PP +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP 
Sbjct: 53  EKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPP 112

Query: 169 -YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPP 330
            +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPP
Sbjct: 113 EHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPP 172

Query: 331 VEK-PPVYKPP 360
           VEK PP++KPP
Sbjct: 173 VEKPPPLHKPP 183

 Score =  166 bits (420), Expect = 7e-40
 Identities = 93/131 (70%), Positives = 107/131 (81%), Gaps = 11/131 (8%)
 Frame = +1

Query: 1   QEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PP 165
           ++ PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP
Sbjct: 31  EKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPP 90

Query: 166 VYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPP 330
            +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPP
Sbjct: 91  EHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPP 150

Query: 331 VEK-PPVYKPP 360
           VEK PP +KPP
Sbjct: 151 VEKPPPEHKPP 161

 Score =  164 bits (416), Expect = 2e-39
 Identities = 90/125 (72%), Positives = 104/125 (83%), Gaps = 10/125 (8%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PP 165
           ++ PP +KPPVEKPP  +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP
Sbjct: 119 EKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPP 178

Query: 166 VYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPP 330
           ++KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPP
Sbjct: 179 LHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPP 238

Query: 331 VEKPP 345
           VEKPP
Sbjct: 239 VEKPP 243

 Score =  163 bits (413), Expect = 5e-39
 Identities = 94/136 (69%), Positives = 106/136 (77%), Gaps = 16/136 (11%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV 168
           ++ PP +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP 
Sbjct: 42  EKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPP 101

Query: 169 -YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKP------P 315
            +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKP      P
Sbjct: 102 EHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPP 161

Query: 316 VYKPPVE-KPPVYKPP 360
           V KPP E KPPV KPP
Sbjct: 162 VEKPPPEHKPPVEKPP 177

 Score =  156 bits (394), Expect = 8e-37
 Identities = 89/123 (72%), Positives = 100/123 (81%), Gaps = 11/123 (8%)
 Frame = +1

Query: 25  PPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK 189
           PP EKPP  +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK
Sbjct: 28  PPFEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEK 87

Query: 190 -PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVY 351
            PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +
Sbjct: 88  PPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEH 147

Query: 352 KPP 360
           KPP
Sbjct: 148 KPP 150

 Score =  137 bits (346), Expect = 3e-31
 Identities = 82/124 (66%), Positives = 94/124 (75%), Gaps = 9/124 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PP 165
           ++ PP +KPPVEKPP  +KPPVEK PP++KPPVEK PP +KPPVEK PP +KPPVEK PP
Sbjct: 152 EKPPPEHKPPVEKPPPEHKPPVEKPPPLHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPP 211

Query: 166 VYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPV- 333
            +KPPVEK PP +KPPVEK PP +KPPVEKPP      EKP P +KPP    PV KPP  
Sbjct: 212 EHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPP--PEHKEKPLPEHKPPT---PVGKPPKG 266

Query: 334 EKPP 345
           EKPP
Sbjct: 267 EKPP 270

 Score =  127 bits (318), Expect = 5e-28
 Identities = 81/134 (60%), Positives = 92/134 (68%), Gaps = 14/134 (10%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPP-VYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PP 165
           ++ PP +KPPVEKPP ++KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP
Sbjct: 163 EKPPPEHKPPVEKPPPLHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPP 222

Query: 166 VYKPPVEK-PPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPV-EKPP-----VY 321
            +KPPVEK PP +KPPVEKPP      EKP P +KPP    PV KPP  EKPP       
Sbjct: 223 EHKPPVEKPPPEHKPPVEKPP--PEHKEKPLPEHKPPT---PVGKPPKGEKPPHCGHNPG 277

Query: 322 KPPVEK-PPVYKPP 360
            PP E     YKPP
Sbjct: 278 HPPAENAEDSYKPP 291

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 65/131 (49%), Positives = 74/131 (56%), Gaps = 11/131 (8%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVY 171
           ++ PP +KPPVEKPP  +KPPVEK PP +KPPVEKPP      EKP P +KPP    PV 
Sbjct: 207 EKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPP--PEHKEKPLPEHKPPT---PVG 261

Query: 172 KPPV-EKPP-----VYKPPVEK-PPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKP 327
           KPP  EKPP        PP E     YKPP + KPP    P EK P     +  PP +KP
Sbjct: 262 KPPKGEKPPHCGHNPGHPPAENAEDSYKPPRKIKPP--STPAEKQPGPGKKLPTPP-HKP 318

Query: 328 PVEKPPVYKPP 360
           P  KPP    P
Sbjct: 319 P-HKPPTPTHP 328

[19][TOP]
>UniRef100_Q06841 Early nodulin-75 (Fragment) n=1 Tax=Lupinus luteus RepID=NO75_LUPLU
          Length = 434

 Score =  167 bits (422), Expect = 4e-40
 Identities = 83/127 (65%), Positives = 99/127 (77%), Gaps = 8/127 (6%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV- 168
           EKPP+ Y PP EKPPV++PP EKPP V+ PP +KPP+ Y PP EKPP+ Y PP EKPP+ 
Sbjct: 112 EKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIE 171

Query: 169 YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK 339
           Y PP EKPP+ Y PP EKPPVY+PP EK PPV+ PP EKPP+ Y PP+EKPPV++PP EK
Sbjct: 172 YPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEK 231

Query: 340 PPVYKPP 360
           PP  +PP
Sbjct: 232 PPPAQPP 238

 Score =  166 bits (421), Expect = 6e-40
 Identities = 85/138 (61%), Positives = 100/138 (72%), Gaps = 19/138 (13%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPV------------YKPPVEKPPVYKPPVEKPP-VYKPPVEKPPV-Y 141
           EKPPVY+PP EKPP             Y PP EKPPV++PP EKPP V+ PP +KPP+ Y
Sbjct: 91  EKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEY 150

Query: 142 KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEK 309
            PP EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPPVY+PP EK PPV+ PP EK
Sbjct: 151 HPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEK 210

Query: 310 PPV-YKPPVEKPPVYKPP 360
           PP+ Y PP+EKPPV++PP
Sbjct: 211 PPIEYPPPLEKPPVHEPP 228

 Score =  163 bits (412), Expect = 6e-39
 Identities = 83/127 (65%), Positives = 96/127 (75%), Gaps = 8/127 (6%)
 Frame = +1

Query: 4   EKPPVYKP-PVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP-VY 171
           EKPP+  P P EKPPVY+PP EK PPV+ PP EKPP+ Y PP EKPPV++PP EKPP V+
Sbjct: 80  EKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVH 139

Query: 172 KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK 339
            PP +KPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPPVY+PP EK
Sbjct: 140 PPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEK 199

Query: 340 PPVYKPP 360
           PP   PP
Sbjct: 200 PPPVHPP 206

 Score =  160 bits (405), Expect = 4e-38
 Identities = 83/128 (64%), Positives = 97/128 (75%), Gaps = 9/128 (7%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV- 168
           EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPPVY+PP EK PPV+ PP EKPP+ 
Sbjct: 155 EKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIE 214

Query: 169 YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEK 339
           Y PP+EKPPV++PP EK PP   PP +KPP+ Y PP EKPPVY+PP E+ PPV+ P  EK
Sbjct: 215 YPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEK 274

Query: 340 PP-VYKPP 360
           PP VY PP
Sbjct: 275 PPFVYPPP 282

 Score =  160 bits (404), Expect = 5e-38
 Identities = 81/127 (63%), Positives = 97/127 (76%), Gaps = 8/127 (6%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVY 171
           EKPP+ Y PP EKPP+ Y PP EKPPVY+PP EK PPV+ PP EKPP+ Y PP+EKPPV+
Sbjct: 166 EKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVH 225

Query: 172 KPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEK 339
           +PP EK PP   PP +KPP+ Y PP EKPPVY+PP E+ PPV+ P  EKPP VY PP EK
Sbjct: 226 EPPYEKPPPAQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEK 285

Query: 340 PPVYKPP 360
            P+++PP
Sbjct: 286 SPMHEPP 292

 Score =  159 bits (402), Expect = 9e-38
 Identities = 83/137 (60%), Positives = 97/137 (70%), Gaps = 18/137 (13%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP------------VY 141
           EKPPVY+PP EKPP V+ PP EKPP+ Y PP+EKPPV++PP EKPP             Y
Sbjct: 188 EKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEY 247

Query: 142 KPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKP 312
            PP EKPPVY+PP E+ PPV+ P  EKPP VY PP EK P+++PP EK PPV+ PP EKP
Sbjct: 248 PPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKP 307

Query: 313 PV-YKPPVEKPPVYKPP 360
           P+ Y PP EKPPV  PP
Sbjct: 308 PIEYAPPHEKPPVEYPP 324

 Score =  159 bits (401), Expect = 1e-37
 Identities = 81/127 (63%), Positives = 97/127 (76%), Gaps = 8/127 (6%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVY 171
           EKPP+ Y PP EKPPVY+PP EK PPV+ PP EKPP+ Y PP+EKPPV++PP EK PP  
Sbjct: 177 EKPPIEYPPPHEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPAQ 236

Query: 172 KPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK- 339
            PP +KPP+ Y PP EKPPVY+PP E+ PPV+ P  EKPP VY PP EK P+++PP EK 
Sbjct: 237 PPPHDKPPIEYPPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKA 296

Query: 340 PPVYKPP 360
           PPV+ PP
Sbjct: 297 PPVHLPP 303

 Score =  154 bits (389), Expect = 3e-36
 Identities = 80/132 (60%), Positives = 95/132 (71%), Gaps = 13/132 (9%)
 Frame = +1

Query: 4   EKPP-VYKPPVEKPPVYKPPVEK------PPVYKPPVEKPPV-YKPPVEKPPV-YKPPVE 156
           EKPP V+ PP EKPP+++PP EK      PPV+ PP EKPP+ Y PP  KPP+ Y PP  
Sbjct: 10  EKPPIVHPPPHEKPPLFEPPFEKPPPAHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHV 69

Query: 157 KPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYK 324
           KPP+ Y PP EKPP+ Y  P EKPPVY+PP EK PPV+ PP EKPP+ Y PP EKPPV++
Sbjct: 70  KPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHE 129

Query: 325 PPVEKPPVYKPP 360
           PP EKPP+  PP
Sbjct: 130 PPYEKPPLVHPP 141

 Score =  152 bits (383), Expect = 1e-35
 Identities = 79/130 (60%), Positives = 94/130 (72%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK------PPVYKPPVEKPPV-YKPPVEKPP 165
           PPV+ PP EKPP V+ PP EKPP+++PP EK      PPV+ PP EKPP+ Y PP  KPP
Sbjct: 2   PPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPAHPPPVHPPPHEKPPIEYPPPHTKPP 61

Query: 166 V-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPP 330
           + Y PP  KPP+ Y PP EKPP+ Y  P EKPPVY+PP EK PPV+ PP EKPP+ Y PP
Sbjct: 62  IEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPP 121

Query: 331 VEKPPVYKPP 360
            EKPPV++PP
Sbjct: 122 HEKPPVHEPP 131

 Score =  151 bits (381), Expect = 2e-35
 Identities = 79/133 (59%), Positives = 96/133 (72%), Gaps = 14/133 (10%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVY-KPPVE------KPPV-YKPPVE 156
           EKPP+++PP EKPP  + PPV  PP  KPP+E PP + KPP+E      KPP+ Y PP E
Sbjct: 21  EKPPLFEPPFEKPPPAHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHVKPPIQYPPPHE 80

Query: 157 KPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP-VYK 324
           KPP+ Y  P EKPPVY+PP EK PPV+ PP EKPP+ Y PP EKPPV++PP EKPP V+ 
Sbjct: 81  KPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHP 140

Query: 325 PPVEKPPV-YKPP 360
           PP +KPP+ Y PP
Sbjct: 141 PPHDKPPIEYHPP 153

 Score =  150 bits (380), Expect = 3e-35
 Identities = 84/154 (54%), Positives = 98/154 (63%), Gaps = 35/154 (22%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKPPVYKPPVEKPP------------VYKPPVEKPPVYKPPVEK-PPVY 141
           EKPP+ Y PP+EKPPV++PP EKPP             Y PP EKPPVY+PP E+ PPV+
Sbjct: 209 EKPPIEYPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPPHEKPPVYEPPYERSPPVH 268

Query: 142 KPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV------YK 294
            P  EKPP VY PP EK P+++PP EK PPV+ PP EKPP+ Y PP EKPPV       K
Sbjct: 269 PPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVK 328

Query: 295 PPV------------EKPPVYKPPVEKPPVYKPP 360
           PPV            EKPP+  PP EKPPVY+PP
Sbjct: 329 PPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYEPP 362

 Score =  149 bits (377), Expect = 7e-35
 Identities = 77/133 (57%), Positives = 94/133 (70%), Gaps = 13/133 (9%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVY-KPPVE------KPPV-YKPPVEKPPV-YKPPV 153
           ++ PP + PPV  PP  KPP+E PP + KPP+E      KPP+ Y PP EKPP+ Y  P 
Sbjct: 31  EKPPPAHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHVKPPIQYPPPHEKPPIEYPLPH 90

Query: 154 EKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP-VYKPPVEKPPV-Y 321
           EKPPVY+PP EK PPV+ PP EKPP+ Y PP EKPPV++PP EKPP V+ PP +KPP+ Y
Sbjct: 91  EKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEKPPLVHPPPHDKPPIEY 150

Query: 322 KPPVEKPPVYKPP 360
            PP EKPP+  PP
Sbjct: 151 HPPHEKPPIEYPP 163

 Score =  147 bits (370), Expect = 5e-34
 Identities = 78/125 (62%), Positives = 89/125 (71%), Gaps = 6/125 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-Y 171
           EKPPVY+PP E+ PPV+ P  EKPP VY PP EK P+++PP EK PPV+ PP EKPP+ Y
Sbjct: 252 EKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEY 311

Query: 172 KPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
            PP EKPPV Y PP  KPPV Y  P EKPP +    EKPP+  PP EKPPVY+PP EKPP
Sbjct: 312 APPHEKPPVEYPPPHVKPPVEYPSPAEKPPTH----EKPPIEFPPHEKPPVYEPPYEKPP 367

Query: 346 VYKPP 360
              PP
Sbjct: 368 SVCPP 372

 Score =  137 bits (344), Expect = 5e-31
 Identities = 74/121 (61%), Positives = 84/121 (69%), Gaps = 6/121 (4%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV- 168
           +  PPV+ P  EKPP VY PP EK P+++PP EK PPV+ PP EKPP+ Y PP EKPPV 
Sbjct: 262 ERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVE 321

Query: 169 YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKP 342
           Y PP  KPPV Y  P EKPP +    EKPP+  PP EKPPVY+PP EKPP V  PP EKP
Sbjct: 322 YPPPHVKPPVEYPSPAEKPPTH----EKPPIEFPPHEKPPVYEPPYEKPPSVCPPPHEKP 377

Query: 343 P 345
           P
Sbjct: 378 P 378

 Score =  134 bits (338), Expect = 2e-30
 Identities = 81/140 (57%), Positives = 91/140 (65%), Gaps = 21/140 (15%)
 Frame = +1

Query: 4   EKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV------YKPPVE 156
           EKPP VY PP EK P+++PP EK PPV+ PP EKPP+ Y PP EKPPV       KPPVE
Sbjct: 273 EKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVE 332

Query: 157 KP-PVYKPPV-EKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPP-------VYKPPVE 306
            P P  KPP  EKPP+  PP EKPPVY+PP EKPP V  PP EKPP       +Y P   
Sbjct: 333 YPSPAEKPPTHEKPPIEFPPHEKPPVYEPPYEKPPSVCPPPHEKPPHHEKRSALYPPHHR 392

Query: 307 KPP-VYKP-PVEKPPVYKPP 360
           KPP  +KP P +KPP YK P
Sbjct: 393 KPPNHHKPLPYKKPPFYKSP 412

 Score =  130 bits (327), Expect = 5e-29
 Identities = 79/138 (57%), Positives = 90/138 (65%), Gaps = 21/138 (15%)
 Frame = +1

Query: 4   EKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV------YKPPVEKP-PVYKPPV- 153
           EK P+++PP EK PPV+ PP EKPP+ Y PP EKPPV       KPPVE P P  KPP  
Sbjct: 284 EKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTH 343

Query: 154 EKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPP-------VYKPPVEKPP-VYKP-PV 303
           EKPP+  PP EKPPVY+PP EKPP V  PP EKPP       +Y P   KPP  +KP P 
Sbjct: 344 EKPPIEFPPHEKPPVYEPPYEKPPSVCPPPHEKPPHHEKRSALYPPHHRKPPNHHKPLPY 403

Query: 304 EKPPVYK-PPVEKPPVYK 354
           +KPP YK PPVEKP  Y+
Sbjct: 404 KKPPFYKSPPVEKPSSYE 421

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 6/98 (6%)
 Frame = +1

Query: 13  PVYKPPV-EKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           P  KPP  EKPP+  PP EKPPVY+PP EKPP V  PP EKPP ++   ++  +Y P   
Sbjct: 336 PAEKPPTHEKPPIEFPPHEKPPVYEPPYEKPPSVCPPPHEKPPHHE---KRSALYPPHHR 392

Query: 187 KPP-VYKP-PVEKPPVYK-PPVEKPPVYK-PPVEKPPV 288
           KPP  +KP P +KPP YK PPVEKP  Y+  P  + PV
Sbjct: 393 KPPNHHKPLPYKKPPFYKSPPVEKPSSYESQPYGRLPV 430

[20][TOP]
>UniRef100_P06600 Proline-rich 33 kDa extensin-related protein (Fragment) n=1
           Tax=Daucus carota RepID=PRP33_DAUCA
          Length = 211

 Score =  164 bits (414), Expect = 4e-39
 Identities = 84/147 (57%), Positives = 100/147 (68%), Gaps = 30/147 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVE---------- 156
           PP++KPPV  PPV+KPP+ KPPVY PPV KPPVY PPV KPP  YKPPVE          
Sbjct: 20  PPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHY 79

Query: 157 ---KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKP-----------PVYKP-PVEKPPV 288
              KPPVYKPPV+KP P +KPPV KPP++KPPV              P++KP P+ +PPV
Sbjct: 80  PIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPV 139

Query: 289 YKPPVE-KPPVYKPPVE-KP-PVYKPP 360
           +KPP E KPPV++P  E KP PVY+PP
Sbjct: 140 HKPPTEHKPPVHEPATEHKPSPVYQPP 166

 Score =  146 bits (368), Expect = 8e-34
 Identities = 83/150 (55%), Positives = 97/150 (64%), Gaps = 32/150 (21%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPP-VYKPPVE-------------KPPVYKPPVEKP-PVY 141
           KPPVY PPV KPPVY PPV KPP  YKPPVE             KPPVYKPPV+KP P +
Sbjct: 39  KPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHYPIHKPPVYKPPVQKPAPEH 98

Query: 142 KPPVEKPPVYKPPVEKP-----------PVYKP-PVEKPPVYKPPVE-KPPVYKPPVE-K 279
           KPPV KPP++KPPV              P++KP P+ +PPV+KPP E KPPV++P  E K
Sbjct: 99  KPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPVHKPPTEHKPPVHEPATEHK 158

Query: 280 P-PVYKPP-VEKP-PVYKPPVEKPPVYKPP 360
           P PVY+PP  EKP P +KPP   P V +PP
Sbjct: 159 PSPVYQPPKTEKPVPEHKPPHLPPIVVRPP 188

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 58/119 (48%), Positives = 73/119 (61%), Gaps = 7/119 (5%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKP-PVEKPPVYKPPVE-KPPVY 171
           Q+  P +KPPV KPP++KPPV   P V        P++KP P+ +PPV+KPP E KPPV+
Sbjct: 92  QKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPVHKPPTEHKPPVH 151

Query: 172 KPPVE-KP-PVYKPP-VEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
           +P  E KP PVY+PP  EKP P +KPP   P V +PP    P   PP    P + PPVE
Sbjct: 152 EPATEHKPSPVYQPPKTEKPVPEHKPPHLPPIVVRPPPTHKP--NPPYGHHPRH-PPVE 207

[21][TOP]
>UniRef100_Q41402 Nodulin n=1 Tax=Sesbania rostrata RepID=Q41402_SESRO
          Length = 330

 Score =  161 bits (408), Expect = 2e-38
 Identities = 87/126 (69%), Positives = 89/126 (70%), Gaps = 7/126 (5%)
 Frame = +1

Query: 4   EKPPVY-KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKP 177
           EKPP Y KPP EKPP  KPP EKPP  KPP +KPP  KPP EKPP  KPP EK PP YKP
Sbjct: 194 EKPPPYEKPPHEKPPYEKPPHEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPPPEYKP 253

Query: 178 PVEK-PPVYKPPVEKPPVY-KPPVEK-PPVYKPPVEK--PPVYKPPVEKPPVYKPPVEKP 342
           P EK PP YKPP EKPP Y KPP EK PP YKPP EK  PP Y P V+ PP YKPP EKP
Sbjct: 254 PHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPHEKPPPPEYPPYVKPPPEYKPPHEKP 313

Query: 343 PVYKPP 360
           P Y PP
Sbjct: 314 PGYNPP 319

 Score =  160 bits (405), Expect = 4e-38
 Identities = 87/127 (68%), Positives = 91/127 (71%), Gaps = 7/127 (5%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPP-VYKPPVEKPPVYKPP-VEKPPVY-KPPVEKPPVYKPPVEKPPVY 171
           ++ PP Y+PP EKPP VY PP EKPP  KPP  EKPP Y KPP EKPP  KPP EKPP  
Sbjct: 161 EKPPPEYQPPQEKPPPVYPPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYEKPPHEKPPHE 220

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVY-KPPVEK- 339
           KPP +KPP  KPP EKPP  KPP EK PP YKPP EK PP YKPP EKPP Y KPP EK 
Sbjct: 221 KPPYDKPPYEKPPHEKPPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPPPYEKPPHEKP 280

Query: 340 PPVYKPP 360
           PP YKPP
Sbjct: 281 PPEYKPP 287

 Score =  157 bits (398), Expect = 3e-37
 Identities = 91/139 (65%), Positives = 92/139 (66%), Gaps = 19/139 (13%)
 Frame = +1

Query: 1   QEKPP-VYKPPVEKPPVYKPP-VEKPPVY-KPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 171
           QEKPP VY PP EKPP  KPP  EKPP Y KPP EKPP  KPP EKPP  KPP +KPP  
Sbjct: 171 QEKPPPVYPPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYEKPPHEKPPHEKPPYDKPPYE 230

Query: 172 KPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVY-KPPVEK-PPVYKPPVEK 339
           KPP EKPP  KPP EK PP YKPP EK PP YKPP EKPP Y KPP EK PP YKPP EK
Sbjct: 231 KPPHEKPPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPHEK 290

Query: 340 ------------PPVYKPP 360
                       PP YKPP
Sbjct: 291 PPPPEYPPYVKPPPEYKPP 309

 Score =  149 bits (377), Expect = 7e-35
 Identities = 86/146 (58%), Positives = 96/146 (65%), Gaps = 26/146 (17%)
 Frame = +1

Query: 1   QEKPPVYKPPV------EKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPV 153
           ++ PPVYKPP+      + PPVY PP EK PPVY PP EK PPVY PP EK PP Y+PP 
Sbjct: 46  EKPPPVYKPPIFPPPYEKPPPVYSPPYEKPPPVYPPPYEKPPPVYPPPYEKPPPEYQPPH 105

Query: 154 EK------------PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PP 285
           EK            PP Y+PP EK PP Y+PP EK PP Y+PP EK PP Y+PP EK PP
Sbjct: 106 EKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPP 165

Query: 286 VYKPPVEK-PPVYKPPVEKPPVYKPP 360
            Y+PP EK PPVY PP EKPP  KPP
Sbjct: 166 EYQPPQEKPPPVYPPPYEKPPHEKPP 191

 Score =  147 bits (370), Expect = 5e-34
 Identities = 83/131 (63%), Positives = 93/131 (70%), Gaps = 12/131 (9%)
 Frame = +1

Query: 4   EKPPVYKPPV-EKPPVYK--PPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PP 165
           E PP+ KPP  E PP Y+  PPV KPP++ PP EK PPVY PP EK PPVY PP EK PP
Sbjct: 29  EPPPIEKPPTYEPPPTYEKPPPVYKPPIFPPPYEKPPPVYSPPYEKPPPVYPPPYEKPPP 88

Query: 166 VYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPP 330
           VY PP EK PP Y+PP EK PP Y+PP E  PP Y+PP EK PP Y+PP EK PP Y+PP
Sbjct: 89  VYPPPYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPP 148

Query: 331 VEK-PPVYKPP 360
            EK PP Y+PP
Sbjct: 149 HEKPPPEYQPP 159

 Score =  136 bits (342), Expect = 8e-31
 Identities = 78/125 (62%), Positives = 80/125 (64%), Gaps = 13/125 (10%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPV-YKP 177
           EKPP  KPP EKPP  KPP +KPP  KPP EKPP  KPP EKPP  YKPP EKPP  YKP
Sbjct: 205 EKPPYEKPPHEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPPPEYKPPHEKPPPEYKP 264

Query: 178 PVEKPPVY-KPPVEKPPV-YKPPVEKPP-------VYKPPVEKPPVYKPPVEKPPVY--K 324
           P EKPP Y KPP EKPP  YKPP EKPP       V  PP  KPP  KPP   PP Y   
Sbjct: 265 PHEKPPPYEKPPHEKPPPEYKPPHEKPPPPEYPPYVKPPPEYKPPHEKPPGYNPPPYGHY 324

Query: 325 PPVEK 339
           PP +K
Sbjct: 325 PPSKK 329

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/85 (57%), Positives = 52/85 (61%), Gaps = 12/85 (14%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEKPPVY-KPPVEKPPV-YKPPVEKPP-------VYKPP 150
           ++ PP YKPP EKPP  YKPP EKPP Y KPP EKPP  YKPP EKPP       V  PP
Sbjct: 245 EKPPPEYKPPHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPHEKPPPPEYPPYVKPPP 304

Query: 151 VEKPPVYKPPVEKPPVY--KPPVEK 219
             KPP  KPP   PP Y   PP +K
Sbjct: 305 EYKPPHEKPPGYNPPPYGHYPPSKK 329

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 28/50 (56%), Positives = 32/50 (64%), Gaps = 4/50 (8%)
 Frame = +1

Query: 223 PVYKPPVEKPPVYKPPV-EKPPVYK--PPVEKPPVYKPPVEK-PPVYKPP 360
           PV     E PP+ KPP  E PP Y+  PPV KPP++ PP EK PPVY PP
Sbjct: 22  PVLANYYEPPPIEKPPTYEPPPTYEKPPPVYKPPIFPPPYEKPPPVYSPP 71

[22][TOP]
>UniRef100_Q9FUR6 ENOD2 (Fragment) n=1 Tax=Cladrastis kentukea RepID=Q9FUR6_CLALU
          Length = 244

 Score =  161 bits (407), Expect = 2e-38
 Identities = 92/136 (67%), Positives = 100/136 (73%), Gaps = 19/136 (13%)
 Frame = +1

Query: 10  PPVYKPPV-EKPP-VYKPPVEKPP-VYKPPVEK--PPVYKPPVEKPP-VYKPPVEK--PP 165
           PPVY+PP  EKPP VY PP EKPP VY+PP  +  PPVY PP EKPP VY+PP  +  PP
Sbjct: 99  PPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPP 158

Query: 166 VYKPPVEKPP-VYKPPVEK--PPVYKPPVEKPP-VYKPPV-EKPPVYKPP------VEKP 312
           VY PP EKPP VY+PP  +  PPVY PP EKPP VY+PP  EKPPVYKPP      VEKP
Sbjct: 159 VYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPVYKPPGYEPPPVEKP 218

Query: 313 PVYKPPVEKPPVYKPP 360
           PVYKPPVEKPP YKPP
Sbjct: 219 PVYKPPVEKPPSYKPP 234

 Score =  151 bits (381), Expect = 2e-35
 Identities = 87/135 (64%), Positives = 100/135 (74%), Gaps = 16/135 (11%)
 Frame = +1

Query: 4   EKPPVYKPP-VEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK--PP 165
           EKPP Y+PP  EKPP VYKPP+  PPV+ PP EK PPVY PP EK PPVY+PP  +  PP
Sbjct: 17  EKPPTYEPPPTEKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPP 76

Query: 166 VYKPP--VEKPPVYKPP--VEKPPVYKPPV-EKPP-VYKPPVEK-PPVYKPPVEK--PPV 318
           VY+PP  V+ PPVY+PP  V+ PPVY+PP  EKPP VY PP EK PPVY+PP  +  PPV
Sbjct: 77  VYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPV 136

Query: 319 YKPPVEK-PPVYKPP 360
           Y PP EK PPVY+PP
Sbjct: 137 YPPPHEKPPPVYQPP 151

 Score =  149 bits (375), Expect = 1e-34
 Identities = 85/134 (63%), Positives = 98/134 (73%), Gaps = 16/134 (11%)
 Frame = +1

Query: 7   KPPVYKPPV-EKPPVYK-PPVEK-PPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVY 171
           KPP Y+PP  EKPP Y+ PP EK PPVYKPP+  PPV+ PP EK PPVY PP EK PPVY
Sbjct: 7   KPPTYEPPATEKPPTYEPPPTEKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVY 66

Query: 172 KPPVEK--PPVYKPP--VEKPPVYKPP--VEKPPVYKPPV-EKPP-VYKPPVEK-PPVYK 324
           +PP  +  PPVY+PP  V+ PPVY+PP  V+ PPVY+PP  EKPP VY PP EK PPVY+
Sbjct: 67  QPPPHEKPPPVYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQ 126

Query: 325 PPVEK--PPVYKPP 360
           PP  +  PPVY PP
Sbjct: 127 PPPHEKPPPVYPPP 140

 Score =  149 bits (375), Expect = 1e-34
 Identities = 84/136 (61%), Positives = 99/136 (72%), Gaps = 16/136 (11%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK--PPVYKPP--VEKP 162
           ++ PPVYKPP+  PPV+ PP EK PPVY PP EK PPVY+PP  +  PPVY+PP  V+ P
Sbjct: 28  EKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYQPPPHVKPP 87

Query: 163 PVYKPP--VEKPPVYKPPV-EKPP-VYKPPVEK-PPVYKPPVEK--PPVYKPPVEK-PPV 318
           PVY+PP  V+ PPVY+PP  EKPP VY PP EK PPVY+PP  +  PPVY PP EK PPV
Sbjct: 88  PVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPV 147

Query: 319 YKPPVEK--PPVYKPP 360
           Y+PP  +  PPVY PP
Sbjct: 148 YQPPPHEKPPPVYPPP 163

 Score =  140 bits (353), Expect = 4e-32
 Identities = 79/126 (62%), Positives = 89/126 (70%), Gaps = 16/126 (12%)
 Frame = +1

Query: 1   QEKPPVYKPPVEK--PPVYKPPVEKPP-VYKPPVEK--PPVYKPPVEKPP-VYKPPVEK- 159
           ++ PPVY+PP  +  PPVY PP EKPP VY+PP  +  PPVY PP EKPP VY+PP  + 
Sbjct: 119 EKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEK 178

Query: 160 -PPVYKPPVEKPP-VYKPPV-EKPPVYKPP------VEKPPVYKPPVEKPPVYKPPVEKP 312
            PPVY PP EKPP VY+PP  EKPPVYKPP      VEKPPVYKPPVEKPP YKPP   P
Sbjct: 179 PPPVYPPPHEKPPPVYQPPPHEKPPVYKPPGYEPPPVEKPPVYKPPVEKPPSYKPP---P 235

Query: 313 PVYKPP 330
             + PP
Sbjct: 236 YGHYPP 241

 Score =  129 bits (324), Expect = 1e-28
 Identities = 76/123 (61%), Positives = 87/123 (70%), Gaps = 19/123 (15%)
 Frame = +1

Query: 49  YKPPVE------KPPVYK-PPVEK-PPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPV 198
           YKPP        KPP Y+ PP EK PPVYKPP+  PPV+ PP EK PPVY PP EK PPV
Sbjct: 6   YKPPTYEPPATEKPPTYEPPPTEKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPV 65

Query: 199 YKPPVEK--PPVYKPP--VEKPPVYKPP--VEKPPVYKPPV-EKPP-VYKPPVEK-PPVY 351
           Y+PP  +  PPVY+PP  V+ PPVY+PP  V+ PPVY+PP  EKPP VY PP EK PPVY
Sbjct: 66  YQPPPHEKPPPVYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVY 125

Query: 352 KPP 360
           +PP
Sbjct: 126 QPP 128

[23][TOP]
>UniRef100_Q9FUR5 ENOD2f (Fragment) n=1 Tax=Maackia amurensis RepID=Q9FUR5_9FABA
          Length = 308

 Score =  161 bits (407), Expect = 2e-38
 Identities = 87/130 (66%), Positives = 97/130 (74%), Gaps = 10/130 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP- 165
           ++ PP Y+PP EKPP +Y PP EKPPV Y PP EKPP VY+PP EKPP+ Y PP EKPP 
Sbjct: 113 EKPPPEYQPPYEKPPPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPP 172

Query: 166 VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPV-YKPP 330
           VY+PP EKPP VY PP EKPP+ Y PP EKPP VY+PP EKPP  Y PP EKPP+ Y PP
Sbjct: 173 VYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPPTYPPPHEKPPIEYPPP 232

Query: 331 VEKPPVYKPP 360
            EKPP  KPP
Sbjct: 233 HEKPPYEKPP 242

 Score =  157 bits (397), Expect = 3e-37
 Identities = 85/130 (65%), Positives = 96/130 (73%), Gaps = 10/130 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV 168
           ++ PP + PP EKPP  Y+PP EK PP+Y PP EKPPV Y PP EK PPVY+PP EKPP+
Sbjct: 102 EKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPI 161

Query: 169 -YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPP 330
            Y PP EK PPVY+PP EK PPVY PP EKPP+ Y PP EK PPVY+PP EK PP Y PP
Sbjct: 162 EYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPPTYPPP 221

Query: 331 VEKPPVYKPP 360
            EKPP+  PP
Sbjct: 222 HEKPPIEYPP 231

 Score =  157 bits (396), Expect = 5e-37
 Identities = 86/135 (63%), Positives = 96/135 (71%), Gaps = 15/135 (11%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP- 165
           ++ PP+Y PP EKPPV Y PP EKPP VY+PP EKPP+ Y PP EKPP VY+PP EKPP 
Sbjct: 124 EKPPPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPP 183

Query: 166 VYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKP------P 315
           VY PP EKPP+ Y PP EKPP VY+PP EKPP  Y PP EKPP+ Y PP EKP      P
Sbjct: 184 VYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPP 243

Query: 316 VYKPPVEKPPVYKPP 360
           +Y PP EKPP   PP
Sbjct: 244 LYPPPYEKPPPLYPP 258

 Score =  154 bits (390), Expect = 2e-36
 Identities = 88/153 (57%), Positives = 97/153 (63%), Gaps = 33/153 (21%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP- 165
           ++ PPVY+PP EKPP+ Y PP EKPP VY+PP EKPP VY PP EKPP+ Y PP EKPP 
Sbjct: 146 EKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPP 205

Query: 166 VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP------VYKPPVEKPPVYKPPV------ 303
           VY+PP EKPP  Y PP EKPP+ Y PP EKPP      +Y PP EKPP   PP       
Sbjct: 206 VYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPP 265

Query: 304 --EKPPVYK------------PPVEKPPVYKPP 360
             EKPP YK            PPVEKPP YKPP
Sbjct: 266 HHEKPPFYKPPVYEPPPLEKPPPVEKPPSYKPP 298

 Score =  152 bits (384), Expect = 1e-35
 Identities = 84/130 (64%), Positives = 95/130 (73%), Gaps = 10/130 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PP 165
           ++ PP Y+PP EKPP  Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK PP
Sbjct: 69  EKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPP 128

Query: 166 VYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPP 330
           +Y PP EKPPV Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP
Sbjct: 129 LYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPP 188

Query: 331 VEKPPVYKPP 360
            EKPP+  PP
Sbjct: 189 HEKPPIEYPP 198

 Score =  151 bits (381), Expect = 2e-35
 Identities = 86/130 (66%), Positives = 95/130 (73%), Gaps = 11/130 (8%)
 Frame = +1

Query: 4   EKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPV 168
           E PP Y+PP EK PP Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP 
Sbjct: 59  EPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPE 118

Query: 169 YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPV 333
           Y+PP EK PP+Y PP EKPPV Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP 
Sbjct: 119 YQPPYEKPPPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPY 178

Query: 334 EK-PPVYKPP 360
           EK PPVY PP
Sbjct: 179 EKPPPVYPPP 188

 Score =  145 bits (366), Expect = 1e-33
 Identities = 83/129 (64%), Positives = 93/129 (72%), Gaps = 12/129 (9%)
 Frame = +1

Query: 10  PPVYKPP--VEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVY 171
           PP Y+PP   E PP Y+PP EK PP Y+PP EK PP Y+PP EK PP Y PP EK PP +
Sbjct: 49  PPEYEPPPEYEPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEF 108

Query: 172 KPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVE 336
            PP EK PP Y+PP EK PP+Y PP EKPPV Y PP EK PPVY+PP EKPP+ Y PP E
Sbjct: 109 PPPYEKPPPEYQPPYEKPPPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHE 168

Query: 337 K-PPVYKPP 360
           K PPVY+PP
Sbjct: 169 KPPPVYQPP 177

 Score =  141 bits (356), Expect = 2e-32
 Identities = 81/137 (59%), Positives = 94/137 (68%), Gaps = 19/137 (13%)
 Frame = +1

Query: 7   KPPVYKPP-VEKPPVYKPP-VEK-PPVYKPP--------VEKPPVYKPP--VEKPPVYKP 147
           KPP+Y+PP  EKPP Y+PP +EK PPVY+PP        V+ PP Y+PP   E PP Y+P
Sbjct: 7   KPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEPPPEYQP 66

Query: 148 PVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK- 309
           P EK PP Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK 
Sbjct: 67  PHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKP 126

Query: 310 PPVYKPPVEKPPVYKPP 360
           PP+Y PP EKPPV  PP
Sbjct: 127 PPLYPPPHEKPPVEYPP 143

 Score =  135 bits (341), Expect = 1e-30
 Identities = 83/144 (57%), Positives = 94/144 (65%), Gaps = 25/144 (17%)
 Frame = +1

Query: 4   EKPPVYKPP------VEK-PPVYKPP--------VEKPPVYKPP--VEKPPVYKPPVEK- 129
           E PP  KPP      +EK PPVY+PP        V+ PP Y+PP   E PP Y+PP EK 
Sbjct: 12  EPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEPPPEYQPPHEKP 71

Query: 130 PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYK 294
           PP Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK PP+Y 
Sbjct: 72  PPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYP 131

Query: 295 PPVEKPPV-YKPPVEK-PPVYKPP 360
           PP EKPPV Y PP EK PPVY+PP
Sbjct: 132 PPHEKPPVEYPPPHEKPPPVYQPP 155

 Score =  123 bits (309), Expect = 6e-27
 Identities = 70/123 (56%), Positives = 79/123 (64%), Gaps = 3/123 (2%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 174
           ++ PPVY+PP EKPP  Y PP EKPP+ Y PP EKPP  KP    PP+Y PP EKPP   
Sbjct: 201 EKPPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKP----PPLYPPPYEKPPPLY 256

Query: 175 PPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           PP   P  +KPP  EKPP YKPPV +P    PP+EKP    PPVEKPP YKPP   P  +
Sbjct: 257 PP---PHHHKPPHHEKPPFYKPPVYEP----PPLEKP----PPVEKPPSYKPP---PYRH 302

Query: 352 KPP 360
            PP
Sbjct: 303 YPP 305

 Score =  117 bits (294), Expect = 3e-25
 Identities = 70/127 (55%), Positives = 81/127 (63%), Gaps = 23/127 (18%)
 Frame = +1

Query: 49  YKPPVE------KPPVYKPP-VEK-PPVYKPP--------VEKPPVYKPP--VEKPPVYK 174
           YKPP+       KPP Y+PP +EK PPVY+PP        V+ PP Y+PP   E PP Y+
Sbjct: 6   YKPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEPPPEYQ 65

Query: 175 PPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK 339
           PP EK PP Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK
Sbjct: 66  PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEK 125

Query: 340 PPVYKPP 360
           PP   PP
Sbjct: 126 PPPLYPP 132

[24][TOP]
>UniRef100_O49151 Early nodulin (Fragment) n=1 Tax=Maackia amurensis
           RepID=O49151_9FABA
          Length = 447

 Score =  160 bits (406), Expect = 3e-38
 Identities = 86/130 (66%), Positives = 97/130 (74%), Gaps = 10/130 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PP 165
           ++ PP Y+PP EKPP +Y PP EKPP+ Y PP EK PPVY+PP EKPP+ Y PP EK PP
Sbjct: 126 EKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPP 185

Query: 166 VYKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPP 330
           VY+PP EK PPVY PP EKPP+ Y PP EK PPVY+PP EK PP Y PP EKPP+ Y PP
Sbjct: 186 VYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPP 245

Query: 331 VEKPPVYKPP 360
            EKPP  KPP
Sbjct: 246 HEKPPYEKPP 255

 Score =  160 bits (406), Expect = 3e-38
 Identities = 86/130 (66%), Positives = 97/130 (74%), Gaps = 10/130 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP- 165
           ++ PP Y+PP EKPP +Y PP EKPP+ Y PP EKPP VY+PP EKPP+ Y PP EKPP 
Sbjct: 252 EKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPP 311

Query: 166 VYKPPVEKPP-VYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPV-YKPP 330
           VY+PP EKPP VY PP EKPP+ Y PP EK PPVY+PP EKPP  Y PP EKPP+ Y PP
Sbjct: 312 VYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPP 371

Query: 331 VEKPPVYKPP 360
            EKPP  KPP
Sbjct: 372 HEKPPYEKPP 381

 Score =  158 bits (400), Expect = 2e-37
 Identities = 87/136 (63%), Positives = 99/136 (72%), Gaps = 16/136 (11%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PP 165
           ++ PPVY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP EKPP+ Y PP EK PP
Sbjct: 159 EKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPP 218

Query: 166 VYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV------YKPPVEK-PPVYKPPVEKPPV 318
           VY+PP EK PP Y PP EKPP+ Y PP EKPP       Y+PP EK PP+Y PP EKPP+
Sbjct: 219 VYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPI 278

Query: 319 -YKPPVEK-PPVYKPP 360
            Y PP EK PPVY+PP
Sbjct: 279 EYPPPHEKPPPVYQPP 294

 Score =  158 bits (399), Expect = 2e-37
 Identities = 87/136 (63%), Positives = 99/136 (72%), Gaps = 16/136 (11%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPV------YKPPVEK-PPVYKPPV 153
           ++ PPVY+PP EKPP  Y PP EKPP+ Y PP EKPP       Y+PP EK PP+Y PP 
Sbjct: 214 EKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPPH 273

Query: 154 EKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV 318
           EKPP+ Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP EKPP+
Sbjct: 274 EKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPI 333

Query: 319 -YKPPVEK-PPVYKPP 360
            Y PP EK PPVY+PP
Sbjct: 334 EYPPPHEKLPPVYQPP 349

 Score =  157 bits (396), Expect = 5e-37
 Identities = 84/130 (64%), Positives = 96/130 (73%), Gaps = 10/130 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV 168
           ++ PP + PP EKPP  Y+PP EK PP+Y PP EKPP+ Y PP EK PPVY+PP EKPP+
Sbjct: 115 EKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPI 174

Query: 169 -YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPP 330
            Y PP EK PPVY+PP EK PPVY PP EKPP+ Y PP EK PPVY+PP EK PP Y PP
Sbjct: 175 EYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPP 234

Query: 331 VEKPPVYKPP 360
            EKPP+  PP
Sbjct: 235 HEKPPIEYPP 244

 Score =  156 bits (395), Expect = 6e-37
 Identities = 87/135 (64%), Positives = 97/135 (71%), Gaps = 16/135 (11%)
 Frame = +1

Query: 4   EKPPV-YKPPVEKPP-VYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV 168
           EKPP+ Y PP EKPP VY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP EKPP+
Sbjct: 148 EKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPI 207

Query: 169 -YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV------YKPPVEK-PP 315
            Y PP EK PPVY+PP EK PP Y PP EKPP+ Y PP EKPP       Y+PP EK PP
Sbjct: 208 EYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPP 267

Query: 316 VYKPPVEKPPVYKPP 360
           +Y PP EKPP+  PP
Sbjct: 268 LYPPPHEKPPIEYPP 282

 Score =  156 bits (395), Expect = 6e-37
 Identities = 85/135 (62%), Positives = 96/135 (71%), Gaps = 15/135 (11%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP- 165
           ++ PP+Y PP EKPP+ Y PP EKPP VY+PP EKPP+ Y PP EKPP VY+PP EKPP 
Sbjct: 263 EKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPP 322

Query: 166 VYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKP------P 315
           VY PP EKPP+ Y PP EK PPVY+PP EKPP  Y PP EKPP+ Y PP EKP      P
Sbjct: 323 VYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPP 382

Query: 316 VYKPPVEKPPVYKPP 360
           +Y PP EKPP   PP
Sbjct: 383 LYPPPYEKPPPLYPP 397

 Score =  154 bits (390), Expect = 2e-36
 Identities = 88/153 (57%), Positives = 97/153 (63%), Gaps = 33/153 (21%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPV-YKPPVEK-PP 165
           ++ PPVY+PP EKPP+ Y PP EKPP VY+PP EKPP VY PP EKPP+ Y PP EK PP
Sbjct: 285 EKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPP 344

Query: 166 VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP------VYKPPVEKPPVYKPPV------ 303
           VY+PP EKPP  Y PP EKPP+ Y PP EKPP      +Y PP EKPP   PP       
Sbjct: 345 VYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPP 404

Query: 304 --EKPPVYK------------PPVEKPPVYKPP 360
             EKPP YK            PPVEKPP YKPP
Sbjct: 405 HHEKPPFYKPPVYEPPPLEKPPPVEKPPSYKPP 437

 Score =  152 bits (383), Expect = 1e-35
 Identities = 83/130 (63%), Positives = 95/130 (73%), Gaps = 10/130 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PP 165
           ++ PP Y+PP EKPP  Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK PP
Sbjct: 82  EKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPP 141

Query: 166 VYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPP 330
           +Y PP EKPP+ Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP
Sbjct: 142 LYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPP 201

Query: 331 VEKPPVYKPP 360
            EKPP+  PP
Sbjct: 202 HEKPPIEYPP 211

 Score =  149 bits (377), Expect = 7e-35
 Identities = 84/130 (64%), Positives = 95/130 (73%), Gaps = 11/130 (8%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPV 168
           + PP Y+PP EKPP  Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP 
Sbjct: 72  QPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPE 131

Query: 169 YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPV 333
           Y+PP EK PP+Y PP EKPP+ Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP 
Sbjct: 132 YQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPY 191

Query: 334 EK-PPVYKPP 360
           EK PPVY PP
Sbjct: 192 EKPPPVYPPP 201

 Score =  144 bits (364), Expect = 2e-33
 Identities = 82/129 (63%), Positives = 93/129 (72%), Gaps = 12/129 (9%)
 Frame = +1

Query: 10  PPVYKPPVE--KPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVY 171
           PP Y+PP E   PP Y+PP EK PP Y+PP EK PP Y+PP EK PP Y PP EK PP +
Sbjct: 62  PPEYEPPPEYQPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEF 121

Query: 172 KPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVE 336
            PP EK PP Y+PP EK PP+Y PP EKPP+ Y PP EK PPVY+PP EKPP+ Y PP E
Sbjct: 122 PPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHE 181

Query: 337 K-PPVYKPP 360
           K PPVY+PP
Sbjct: 182 KPPPVYQPP 190

 Score =  140 bits (354), Expect = 3e-32
 Identities = 80/137 (58%), Positives = 94/137 (68%), Gaps = 19/137 (13%)
 Frame = +1

Query: 7   KPPVYKPP-VEKPPVYKPP-VEK-PPVYKPP--------VEKPPVYKPPVE--KPPVYKP 147
           KPP+Y+PP  EKPP Y+PP +EK PPVY+PP        V+ PP Y+PP E   PP Y+P
Sbjct: 20  KPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQP 79

Query: 148 PVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK- 309
           P EK PP Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK 
Sbjct: 80  PHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKP 139

Query: 310 PPVYKPPVEKPPVYKPP 360
           PP+Y PP EKPP+  PP
Sbjct: 140 PPLYPPPHEKPPIEYPP 156

 Score =  135 bits (339), Expect = 2e-30
 Identities = 82/144 (56%), Positives = 94/144 (65%), Gaps = 25/144 (17%)
 Frame = +1

Query: 4   EKPPVYKPP------VEK-PPVYKPP--------VEKPPVYKPPVE--KPPVYKPPVEK- 129
           E PP  KPP      +EK PPVY+PP        V+ PP Y+PP E   PP Y+PP EK 
Sbjct: 25  EPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQPPHEKP 84

Query: 130 PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYK 294
           PP Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK PP+Y 
Sbjct: 85  PPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYP 144

Query: 295 PPVEKPPV-YKPPVEK-PPVYKPP 360
           PP EKPP+ Y PP EK PPVY+PP
Sbjct: 145 PPHEKPPIEYPPPHEKPPPVYQPP 168

 Score =  123 bits (308), Expect = 7e-27
 Identities = 70/123 (56%), Positives = 79/123 (64%), Gaps = 3/123 (2%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 174
           ++ PPVY+PP EKPP  Y PP EKPP+ Y PP EKPP  KP    PP+Y PP EKPP   
Sbjct: 340 EKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKP----PPLYPPPYEKPPPLY 395

Query: 175 PPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           PP   P  +KPP  EKPP YKPPV +P    PP+EKP    PPVEKPP YKPP   P  +
Sbjct: 396 PP---PHHHKPPHHEKPPFYKPPVYEP----PPLEKP----PPVEKPPSYKPP---PYRH 441

Query: 352 KPP 360
            PP
Sbjct: 442 YPP 444

 Score =  117 bits (293), Expect = 4e-25
 Identities = 70/127 (55%), Positives = 81/127 (63%), Gaps = 23/127 (18%)
 Frame = +1

Query: 49  YKPPVE------KPPVYKPP-VEK-PPVYKPP--------VEKPPVYKPPVE--KPPVYK 174
           YKPP+       KPP Y+PP +EK PPVY+PP        V+ PP Y+PP E   PP Y+
Sbjct: 19  YKPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQ 78

Query: 175 PPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK 339
           PP EK PP Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP EK
Sbjct: 79  PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEK 138

Query: 340 PPVYKPP 360
           PP   PP
Sbjct: 139 PPPLYPP 145

[25][TOP]
>UniRef100_Q9LIE8 Similarity to cell wall-plasma membrane linker protein n=1
            Tax=Arabidopsis thaliana RepID=Q9LIE8_ARATH
          Length = 1480

 Score =  158 bits (399), Expect = 2e-37
 Identities = 66/118 (55%), Positives = 79/118 (66%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+E
Sbjct: 1173 KPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIE 1232

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP
Sbjct: 1233 TPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPP 1290

 Score =  154 bits (389), Expect = 3e-36
 Identities = 64/117 (54%), Positives = 78/117 (66%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV  
Sbjct: 1169 PPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVAT 1228

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             P+  PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPP
Sbjct: 1229 SPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPP 1285

 Score =  154 bits (388), Expect = 4e-36
 Identities = 64/117 (54%), Positives = 77/117 (65%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  
Sbjct: 1144 PPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVAT 1203

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPPV  PPV  PP+ KPPV   P+E PPV KPPV  PPV  PP+ KPP+  PP
Sbjct: 1204 PPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPP 1260

 Score =  153 bits (387), Expect = 5e-36
 Identities = 64/118 (54%), Positives = 77/118 (65%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV 
Sbjct: 1153 KPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVA 1212

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV  PP+ KPPV   P+E PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P
Sbjct: 1213 TPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSP 1270

 Score =  152 bits (384), Expect = 1e-35
 Identities = 63/117 (53%), Positives = 77/117 (65%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ K
Sbjct: 1164 PSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAK 1223

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV   P+E PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP
Sbjct: 1224 PPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPP 1280

 Score =  152 bits (384), Expect = 1e-35
 Identities = 64/118 (54%), Positives = 76/118 (64%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+E PPV KPPV 
Sbjct: 1183 KPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVT 1242

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P
Sbjct: 1243 TPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSP 1300

 Score =  152 bits (384), Expect = 1e-35
 Identities = 64/117 (54%), Positives = 76/117 (64%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+E PPV KPPV  PPV  PP+ K
Sbjct: 1194 PPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVK 1253

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP
Sbjct: 1254 PPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPP 1310

 Score =  151 bits (382), Expect = 2e-35
 Identities = 64/117 (54%), Positives = 75/117 (64%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP   PPV  PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  
Sbjct: 1134 PPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIAT 1193

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+E PPV KPPV  PPV  PP
Sbjct: 1194 PPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPP 1250

 Score =  151 bits (382), Expect = 2e-35
 Identities = 64/117 (54%), Positives = 76/117 (64%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV  PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ K
Sbjct: 1139 PPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIK 1198

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP+ KPPV  PPV  PP+ KPPV   P+  PPV KPPV  PPV  PP+ KPP
Sbjct: 1199 PPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPP 1255

 Score =  150 bits (379), Expect = 4e-35
 Identities = 62/116 (53%), Positives = 75/116 (64%)
 Frame = +1

Query: 13   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
            P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KP
Sbjct: 1125 PIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKP 1184

Query: 193  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+E PPV KPP
Sbjct: 1185 PVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPP 1240

 Score =  150 bits (378), Expect = 6e-35
 Identities = 63/118 (53%), Positives = 76/118 (64%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ 
Sbjct: 1148 KSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPIT 1207

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV  PPV  PP+ KPPV   P+  PPV KPPV  PPV  PP+ KPP+  PP+  PP
Sbjct: 1208 KPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPP 1265

 Score =  150 bits (378), Expect = 6e-35
 Identities = 64/117 (54%), Positives = 75/117 (64%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ KPPV  PPV  PP+ KPPV   P+E PPV KPPV  PPV  PP+ KPP+  PP+  
Sbjct: 1204 PPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIAT 1263

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPP
Sbjct: 1264 PPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPP 1320

 Score =  149 bits (377), Expect = 7e-35
 Identities = 63/118 (53%), Positives = 75/118 (63%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPP+  PP   PPV  PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPPV 
Sbjct: 1128 KPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVA 1187

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+  PPV KPPV  PP
Sbjct: 1188 SPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPP 1245

 Score =  149 bits (376), Expect = 9e-35
 Identities = 61/117 (52%), Positives = 75/117 (64%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   P +  
Sbjct: 1109 PPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIAT 1168

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPP
Sbjct: 1169 PPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPP 1225

 Score =  149 bits (375), Expect = 1e-34
 Identities = 64/117 (54%), Positives = 73/117 (62%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  
Sbjct: 818  PPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIAT 877

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PPV KPP
Sbjct: 878  PPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPP 934

 Score =  149 bits (375), Expect = 1e-34
 Identities = 65/118 (55%), Positives = 71/118 (60%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPP   PP   PPV  PP+  PP  KPPV  PP+  PPVEKPPV  PP+ KPP   PP+ 
Sbjct: 972  KPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIA 1031

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV   P   PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP   PP+  PP
Sbjct: 1032 KPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPP 1089

 Score =  149 bits (375), Expect = 1e-34
 Identities = 64/118 (54%), Positives = 74/118 (62%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV   P+E PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ 
Sbjct: 1223 KPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIA 1282

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ KPP
Sbjct: 1283 KPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPP 1340

 Score =  148 bits (374), Expect = 2e-34
 Identities = 61/117 (52%), Positives = 74/117 (63%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV  PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   
Sbjct: 1104 PPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAM 1163

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP
Sbjct: 1164 PSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPP 1220

 Score =  148 bits (373), Expect = 2e-34
 Identities = 62/117 (52%), Positives = 75/117 (64%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  
Sbjct: 1159 PPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVAT 1218

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPPV   P+  PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP
Sbjct: 1219 PPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPP 1275

 Score =  148 bits (373), Expect = 2e-34
 Identities = 64/119 (53%), Positives = 74/119 (62%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP 
Sbjct: 1232 ETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPT 1291

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
              PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ KPP  +PPV  PP
Sbjct: 1292 ATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPPVATPP 1350

 Score =  147 bits (372), Expect = 3e-34
 Identities = 64/118 (54%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV  PP+ K P+  PP   PPV  PP+EKPPV  PP   PP   PPV KPPV  PP+ 
Sbjct: 402 KPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIA 461

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP  KPP+  PP+ KPPV  PP   PP+  P   KPPV  PP+  PPV KPPV  PP
Sbjct: 462 TPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPP 519

 Score =  147 bits (372), Expect = 3e-34
 Identities = 64/118 (54%), Positives = 74/118 (62%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ 
Sbjct: 822  KPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIA 881

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP
Sbjct: 882  KPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPP 939

 Score =  147 bits (372), Expect = 3e-34
 Identities = 65/116 (56%), Positives = 71/116 (61%)
 Frame = +1

Query: 13   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
            PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPVEKPPV  PP+ KP
Sbjct: 964  PVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKP 1023

Query: 193  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            P   PP+ KPPV   P   PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP
Sbjct: 1024 PTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPP 1079

 Score =  147 bits (372), Expect = 3e-34
 Identities = 64/118 (54%), Positives = 74/118 (62%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PPV  PP+ KPPV   P+  PPV KPPV  PPV  PP+ KPP+  PP+  PP+ 
Sbjct: 1208 KPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIA 1267

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP
Sbjct: 1268 KSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPP 1325

 Score =  147 bits (371), Expect = 4e-34
 Identities = 65/117 (55%), Positives = 71/117 (60%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPV KPPV  PP+ KPP   
Sbjct: 968  PPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVL 1027

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPPVE  P   PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP   PP
Sbjct: 1028 PPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPP 1084

 Score =  147 bits (371), Expect = 4e-34
 Identities = 61/118 (51%), Positives = 74/118 (62%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   P +  PP+ 
Sbjct: 1113 KPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIG 1172

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P
Sbjct: 1173 KPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSP 1230

 Score =  147 bits (371), Expect = 4e-34
 Identities = 63/118 (53%), Positives = 74/118 (62%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP+ KPPV  PPV  PP+ KPPV   P+  PPV KPPV  PPV  PP+ KPP+ 
Sbjct: 1198 KPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIV 1257

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PP
Sbjct: 1258 TPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPP 1315

 Score =  147 bits (370), Expect = 5e-34
 Identities = 62/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  
Sbjct: 738  PPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVAT 797

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP
Sbjct: 798  PPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPP 854

 Score =  147 bits (370), Expect = 5e-34
 Identities = 59/117 (50%), Positives = 74/117 (63%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ K P+  PPV  PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ K
Sbjct: 1094 PPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAK 1153

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPP
Sbjct: 1154 PPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPP 1210

 Score =  147 bits (370), Expect = 5e-34
 Identities = 63/117 (53%), Positives = 73/117 (62%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV  PP+ KPPV   P+E PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  
Sbjct: 1214 PPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAP 1273

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PP
Sbjct: 1274 PPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPP 1330

 Score =  146 bits (369), Expect = 6e-34
 Identities = 63/118 (53%), Positives = 73/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ 
Sbjct: 572 KPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIA 631

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP
Sbjct: 632 KPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPP 689

 Score =  146 bits (369), Expect = 6e-34
 Identities = 63/118 (53%), Positives = 72/118 (61%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP  
Sbjct: 652  KPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTA 711

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP
Sbjct: 712  TPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPP 769

 Score =  146 bits (369), Expect = 6e-34
 Identities = 62/118 (52%), Positives = 71/118 (60%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV 
Sbjct: 747  KPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVA 806

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP
Sbjct: 807  TPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPP 864

 Score =  146 bits (369), Expect = 6e-34
 Identities = 62/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   
Sbjct: 798  PPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAAT 857

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP
Sbjct: 858  PPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPP 914

 Score =  146 bits (368), Expect = 8e-34
 Identities = 63/117 (53%), Positives = 72/117 (61%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  
Sbjct: 568 PPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIAT 627

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PPV KPP
Sbjct: 628 PPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPP 684

 Score =  146 bits (368), Expect = 8e-34
 Identities = 62/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   
Sbjct: 733  PPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTAT 792

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPP
Sbjct: 793  PPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPP 849

 Score =  146 bits (368), Expect = 8e-34
 Identities = 63/117 (53%), Positives = 70/117 (59%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   
Sbjct: 758  PPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTAT 817

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP
Sbjct: 818  PPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPP 874

 Score =  146 bits (368), Expect = 8e-34
 Identities = 62/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  K
Sbjct: 778  PPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAK 837

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP
Sbjct: 838  PPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPP 894

 Score =  146 bits (368), Expect = 8e-34
 Identities = 62/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K
Sbjct: 788  PPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISK 847

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPP
Sbjct: 848  PPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPP 904

 Score =  146 bits (368), Expect = 8e-34
 Identities = 66/119 (55%), Positives = 74/119 (62%), Gaps = 1/119 (0%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP+  PPV KPPV  PP+ KPP   PP+ KPPVE  P   PP   PPV  PPV 
Sbjct: 997  KPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVV 1056

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV  PP+ KPPV  PPV  PP   PP V  PP+  PP+ K P+  PPV  PP+ KPP
Sbjct: 1057 KPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPP 1115

 Score =  146 bits (368), Expect = 8e-34
 Identities = 60/118 (50%), Positives = 74/118 (62%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            K P+  PPV  PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+ 
Sbjct: 1098 KSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIA 1157

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PP
Sbjct: 1158 TPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPP 1215

 Score =  145 bits (367), Expect = 1e-33
 Identities = 63/117 (53%), Positives = 71/117 (60%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV  PP+EKPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  
Sbjct: 423 PPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVAT 482

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP   PP+  P   KPPV  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP
Sbjct: 483 PPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPP 539

 Score =  145 bits (367), Expect = 1e-33
 Identities = 61/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  
Sbjct: 768  PPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVAT 827

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPP
Sbjct: 828  PPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPP 884

 Score =  145 bits (367), Expect = 1e-33
 Identities = 62/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  
Sbjct: 773  PPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIAT 832

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP
Sbjct: 833  PPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPP 889

 Score =  145 bits (367), Expect = 1e-33
 Identities = 63/118 (53%), Positives = 72/118 (61%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+ 
Sbjct: 802  KPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPIT 861

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPP
Sbjct: 862  TPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPP 919

 Score =  145 bits (367), Expect = 1e-33
 Identities = 64/117 (54%), Positives = 70/117 (59%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV  PP    PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPVEK
Sbjct: 953  PPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEK 1012

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP+ KPP   PP+ KPPV   P   PP   PPV  PPV KPPV  PP+ KPP
Sbjct: 1013 PPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPP 1069

 Score =  145 bits (366), Expect = 1e-33
 Identities = 63/117 (53%), Positives = 71/117 (60%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  
Sbjct: 793  PPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVAT 852

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP
Sbjct: 853  PPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPP 909

 Score =  145 bits (366), Expect = 1e-33
 Identities = 63/118 (53%), Positives = 73/118 (61%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV 
Sbjct: 1238 KPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVA 1297

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
              P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ KPP  +PPV  PPV  PP
Sbjct: 1298 TSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPPVATPPVATPP 1355

 Score =  145 bits (365), Expect = 2e-33
 Identities = 62/118 (52%), Positives = 71/118 (60%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+ 
Sbjct: 552 KPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPIT 611

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPP
Sbjct: 612 TPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPP 669

 Score =  145 bits (365), Expect = 2e-33
 Identities = 62/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ K
Sbjct: 743  PPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAK 802

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP
Sbjct: 803  PPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPP 859

 Score =  145 bits (365), Expect = 2e-33
 Identities = 62/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  
Sbjct: 828  PPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVAT 887

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP   PP
Sbjct: 888  PPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPP 944

 Score =  144 bits (364), Expect = 2e-33
 Identities = 62/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  
Sbjct: 543 PPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVAT 602

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP
Sbjct: 603 PPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPP 659

 Score =  144 bits (364), Expect = 2e-33
 Identities = 62/118 (52%), Positives = 70/118 (59%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV 
Sbjct: 762  KPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVA 821

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP
Sbjct: 822  KPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPP 879

 Score =  144 bits (364), Expect = 2e-33
 Identities = 62/118 (52%), Positives = 73/118 (61%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP  
Sbjct: 1253 KPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPA 1312

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV KPPV  PP   PPV  PP+ KPP  +PPV  PPV  PP+ K PV  PP+ KPP
Sbjct: 1313 TPPVAKPPVATPPTVTPPVATPPIAKPPGARPPVATPPVATPPIAKSPVATPPMTKPP 1370

 Score =  144 bits (363), Expect = 3e-33
 Identities = 67/132 (50%), Positives = 74/132 (56%), Gaps = 15/132 (11%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV---------------YKPPVEKPPVYK 144
           PPV KPPVE PP+  PP  KPP+  PP+ KPPV                KPPV  PP+  
Sbjct: 448 PPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAI 507

Query: 145 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 324
           PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   
Sbjct: 508 PPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTAT 567

Query: 325 PPVEKPPVYKPP 360
           PPV KPPV  PP
Sbjct: 568 PPVAKPPVATPP 579

 Score =  144 bits (363), Expect = 3e-33
 Identities = 61/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  
Sbjct: 523 PPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIAT 582

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP
Sbjct: 583 PPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPP 639

 Score =  144 bits (363), Expect = 3e-33
 Identities = 62/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   
Sbjct: 753  PPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTA 812

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPP
Sbjct: 813  PPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPP 869

 Score =  144 bits (363), Expect = 3e-33
 Identities = 62/117 (52%), Positives = 72/117 (61%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  
Sbjct: 813  PPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVAT 872

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PP
Sbjct: 873  PPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPP 929

 Score =  144 bits (363), Expect = 3e-33
 Identities = 63/118 (53%), Positives = 73/118 (61%), Gaps = 1/118 (0%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PPVEKPPV  PP+ KPP   PP+ KPPV   P   PP   PPV  PPV KPPV  
Sbjct: 1003 PPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAI 1062

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPPV  PPV  PP   PP+  PP +  PP+ K P+  PPV  PP+ KPP+  PP
Sbjct: 1063 PPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPP 1120

 Score =  144 bits (362), Expect = 4e-33
 Identities = 62/118 (52%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           K P+  PP   PPV  PP+EKPPV  PP   PP   PPV KPPV  PP+  PP  KPP+ 
Sbjct: 412 KSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPIS 471

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPPV  PP   PP+  P   KPPV  PP+  PPV KPPV  PP   PP+  PP
Sbjct: 472 TPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPP 529

 Score =  144 bits (362), Expect = 4e-33
 Identities = 63/119 (52%), Positives = 70/119 (58%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+
Sbjct: 431 EKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPI 490

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             P   KPPV  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP
Sbjct: 491 TTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPP 549

 Score =  144 bits (362), Expect = 4e-33
 Identities = 62/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  P   KPPV  
Sbjct: 443 PPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVAT 502

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP
Sbjct: 503 PPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPP 559

 Score =  144 bits (362), Expect = 4e-33
 Identities = 62/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  K
Sbjct: 608 PPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAK 667

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP
Sbjct: 668 PPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPP 724

 Score =  144 bits (362), Expect = 4e-33
 Identities = 62/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  K
Sbjct: 808  PPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAK 867

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP
Sbjct: 868  PPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPP 924

 Score =  144 bits (362), Expect = 4e-33
 Identities = 63/118 (53%), Positives = 71/118 (60%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP  
Sbjct: 902  KPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTA 961

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
              PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPVEKPPV  PP
Sbjct: 962  TSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPP 1019

 Score =  144 bits (362), Expect = 4e-33
 Identities = 64/117 (54%), Positives = 70/117 (59%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP    PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPV KPPV  
Sbjct: 958  PPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVAT 1017

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPP   PP+ KPPVE  P   PP   PPV  PPV KPPV  PP+ KPPV  PP
Sbjct: 1018 PPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPP 1074

 Score =  144 bits (362), Expect = 4e-33
 Identities = 62/117 (52%), Positives = 72/117 (61%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ KPPV   P+  PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  
Sbjct: 1219 PPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGT 1278

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP
Sbjct: 1279 PPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPP 1335

 Score =  143 bits (361), Expect = 5e-33
 Identities = 64/123 (52%), Positives = 72/123 (58%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 171
           KPP+  PP+ KPPV  PP   PP+      KPPV  PP+  PPV KPPV  PP   PP+ 
Sbjct: 467 KPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIA 526

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
            PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  
Sbjct: 527 TPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTA 586

Query: 352 KPP 360
           KPP
Sbjct: 587 KPP 589

 Score =  143 bits (361), Expect = 5e-33
 Identities = 61/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   
Sbjct: 548 PPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAAT 607

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP
Sbjct: 608 PPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPP 664

 Score =  143 bits (361), Expect = 5e-33
 Identities = 62/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  
Sbjct: 613 PPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAI 672

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP
Sbjct: 673 PPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPP 729

 Score =  143 bits (361), Expect = 5e-33
 Identities = 62/118 (52%), Positives = 69/118 (58%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ 
Sbjct: 722  KPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIA 781

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP
Sbjct: 782  KSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPP 839

 Score =  143 bits (361), Expect = 5e-33
 Identities = 65/123 (52%), Positives = 73/123 (59%), Gaps = 6/123 (4%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV  PP+  PP  KPPV  PP+  PPVEKPPV  PP+ KPP   PP+ KPPV   P   
Sbjct: 983  PPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTAT 1042

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP------VEKPPVYKPPVEKPPVY 351
            PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP      V  PP+  PP+ K P+ 
Sbjct: 1043 PPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIA 1102

Query: 352  KPP 360
             PP
Sbjct: 1103 TPP 1105

 Score =  143 bits (361), Expect = 5e-33
 Identities = 64/118 (54%), Positives = 72/118 (61%), Gaps = 1/118 (0%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP  KPPV  PP+  PPVEKPPV  PP+ KPP   PP+ KPPV   P   PP   PPV  
Sbjct: 993  PPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAI 1052

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPP 360
            PPV KPPV  PP+ KPPV  PPV  PP   PP+  PP +  PP+ K P+  PPV  PP
Sbjct: 1053 PPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPP 1110

 Score =  143 bits (360), Expect = 7e-33
 Identities = 61/118 (51%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV 
Sbjct: 512 KPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVA 571

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP
Sbjct: 572 KPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPP 629

 Score =  143 bits (360), Expect = 7e-33
 Identities = 61/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  
Sbjct: 563 PPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVAT 622

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PP
Sbjct: 623 PPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPP 679

 Score =  143 bits (360), Expect = 7e-33
 Identities = 61/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   
Sbjct: 583 PPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTAT 642

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+  PP
Sbjct: 643 PPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPP 699

 Score =  143 bits (360), Expect = 7e-33
 Identities = 61/118 (51%), Positives = 71/118 (60%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+ 
Sbjct: 587 KPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIA 646

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PP
Sbjct: 647 TSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPP 704

 Score =  143 bits (360), Expect = 7e-33
 Identities = 62/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   
Sbjct: 713  PPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTAT 772

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP
Sbjct: 773  PPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPP 829

 Score =  143 bits (360), Expect = 7e-33
 Identities = 61/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  
Sbjct: 728  PPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVAT 787

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP
Sbjct: 788  PPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPP 844

 Score =  142 bits (359), Expect = 9e-33
 Identities = 62/118 (52%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP  
Sbjct: 632 KPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTA 691

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP
Sbjct: 692 TPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPP 749

 Score =  142 bits (359), Expect = 9e-33
 Identities = 61/118 (51%), Positives = 71/118 (60%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+ 
Sbjct: 837  KPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIA 896

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
              PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+   P+  PP
Sbjct: 897  TSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPP 954

 Score =  142 bits (359), Expect = 9e-33
 Identities = 62/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP  KPPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP    PV  PP+ K
Sbjct: 913  PPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAK 972

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PP   PPV  PP+  PP  KPPV  PP+  PPVEKPPV  PP+ KPP   PP
Sbjct: 973  PPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPP 1029

 Score =  142 bits (359), Expect = 9e-33
 Identities = 62/118 (52%), Positives = 70/118 (59%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP  
Sbjct: 917  KPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTT 976

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP   PPV  PP+  PP  KPPV  PP+  PPV KPPV  PP+ KPP   PP+ KPP
Sbjct: 977  TPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPP 1034

 Score =  142 bits (359), Expect = 9e-33
 Identities = 64/125 (51%), Positives = 74/125 (59%), Gaps = 6/125 (4%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            EKPPV  PP+ KPP   PP+ KPPV   P   PP   PPV  PPV KPPV  PP+ KPPV
Sbjct: 1011 EKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPV 1070

Query: 184  EKPPVYKPP------VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
              PPV  PP      V  PP+  PP+ K P+  PPV  PP+ KPP+  PPV   P+ KPP
Sbjct: 1071 ATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPP 1130

Query: 346  VYKPP 360
            +  PP
Sbjct: 1131 IATPP 1135

 Score =  142 bits (359), Expect = 9e-33
 Identities = 61/116 (52%), Positives = 72/116 (62%)
 Frame = +1

Query: 13   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
            P+  PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  P
Sbjct: 1230 PIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATP 1289

Query: 193  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            P   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ KPP  +PP
Sbjct: 1290 PTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPP 1345

 Score =  142 bits (358), Expect = 1e-32
 Identities = 62/118 (52%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV 
Sbjct: 497 KPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVV 556

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP
Sbjct: 557 TPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPP 614

 Score =  142 bits (358), Expect = 1e-32
 Identities = 62/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   
Sbjct: 508 PPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTAT 567

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP
Sbjct: 568 PPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPP 624

 Score =  142 bits (358), Expect = 1e-32
 Identities = 61/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  K
Sbjct: 528 PPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAK 587

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP
Sbjct: 588 PPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPP 644

 Score =  142 bits (358), Expect = 1e-32
 Identities = 61/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K
Sbjct: 538 PPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISK 597

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPP
Sbjct: 598 SPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPP 654

 Score =  142 bits (358), Expect = 1e-32
 Identities = 61/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  
Sbjct: 578 PPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVAT 637

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP   PP
Sbjct: 638 PPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPP 694

 Score =  142 bits (358), Expect = 1e-32
 Identities = 61/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV K
Sbjct: 593 PPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAK 652

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP
Sbjct: 653 PPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPP 709

 Score =  142 bits (358), Expect = 1e-32
 Identities = 62/118 (52%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP+ 
Sbjct: 617 KPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIA 676

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PP
Sbjct: 677 TPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPP 734

 Score =  142 bits (358), Expect = 1e-32
 Identities = 62/116 (53%), Positives = 70/116 (60%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  P
Sbjct: 649 PVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTP 708

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPP
Sbjct: 709 PTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPP 764

 Score =  142 bits (358), Expect = 1e-32
 Identities = 61/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ K
Sbjct: 663  PPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAK 722

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP
Sbjct: 723  PPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPP 779

 Score =  142 bits (358), Expect = 1e-32
 Identities = 61/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PPV KPPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP   PP   
Sbjct: 923  PPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTAT 982

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP+  PP  KPPV  PP+  PPVEKPPV  PP+ KPP   PP+ KPPV   P
Sbjct: 983  PPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSP 1039

 Score =  142 bits (358), Expect = 1e-32
 Identities = 65/118 (55%), Positives = 71/118 (60%), Gaps = 1/118 (0%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP   PPV  PP+  PP  KPPV  PP+  PPV KPPV  PP+ KPP   PP+ KPPVE 
Sbjct: 978  PPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVET 1037

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP 360
             P   PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP   PP V  PP+  PP
Sbjct: 1038 SPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPP 1095

 Score =  142 bits (358), Expect = 1e-32
 Identities = 61/117 (52%), Positives = 72/117 (61%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  
Sbjct: 1249 PPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVAT 1308

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PPV KPPV  PP   PPV  PP+ KPP  +PPV  PPV  PP+ K PV  PP
Sbjct: 1309 PPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPPVATPPVATPPIAKSPVATPP 1365

 Score =  142 bits (357), Expect = 2e-32
 Identities = 61/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   
Sbjct: 503 PPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTT 562

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPP
Sbjct: 563 PPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPP 619

 Score =  142 bits (357), Expect = 2e-32
 Identities = 60/117 (51%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  
Sbjct: 518 PPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVAT 577

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPP
Sbjct: 578 PPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPP 634

 Score =  142 bits (357), Expect = 2e-32
 Identities = 61/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ 
Sbjct: 603 PPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKT 662

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP
Sbjct: 663 PPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPP 719

 Score =  142 bits (357), Expect = 2e-32
 Identities = 61/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV K
Sbjct: 623 PPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAK 682

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP
Sbjct: 683 PPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPP 739

 Score =  142 bits (357), Expect = 2e-32
 Identities = 60/117 (51%), Positives = 69/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   
Sbjct: 673  PPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTAT 732

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP
Sbjct: 733  PPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPP 789

 Score =  142 bits (357), Expect = 2e-32
 Identities = 60/117 (51%), Positives = 69/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  
Sbjct: 693  PPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIAT 752

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP
Sbjct: 753  PPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPP 809

 Score =  142 bits (357), Expect = 2e-32
 Identities = 61/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  
Sbjct: 718  PPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIAT 777

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP
Sbjct: 778  PPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPP 834

 Score =  141 bits (356), Expect = 2e-32
 Identities = 61/118 (51%), Positives = 70/118 (59%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP  
Sbjct: 667  KPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTT 726

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K P
Sbjct: 727  IPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSP 784

 Score =  141 bits (356), Expect = 2e-32
 Identities = 61/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV K
Sbjct: 843  PPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAK 902

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP
Sbjct: 903  PPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPP 959

 Score =  141 bits (355), Expect = 3e-32
 Identities = 63/121 (52%), Positives = 72/121 (59%), Gaps = 5/121 (4%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P+  PP  KPPV  PP+ K P+  PP   PPV  PP+EKPPV  PP   PP   PPV KP
Sbjct: 394 PIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKP 453

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKP 357
           PV  PP+  PP  KPP+  PP+ KPPV  PP   PP+      KPPV  PP+  PPV KP
Sbjct: 454 PVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKP 513

Query: 358 P 360
           P
Sbjct: 514 P 514

 Score =  141 bits (355), Expect = 3e-32
 Identities = 61/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  K
Sbjct: 558 PPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAK 617

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP
Sbjct: 618 PPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPP 674

 Score =  141 bits (355), Expect = 3e-32
 Identities = 61/118 (51%), Positives = 69/118 (58%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+ 
Sbjct: 782  KSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPIL 841

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   P
Sbjct: 842  TPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSP 899

 Score =  141 bits (355), Expect = 3e-32
 Identities = 61/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   
Sbjct: 833  PPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTAT 892

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+   P
Sbjct: 893  PPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSP 949

 Score =  140 bits (354), Expect = 3e-32
 Identities = 60/117 (51%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  
Sbjct: 643 PPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIAT 702

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PP
Sbjct: 703 PPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPP 759

 Score =  140 bits (354), Expect = 3e-32
 Identities = 61/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  
Sbjct: 658  PPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVAT 717

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP
Sbjct: 718  PPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPP 774

 Score =  140 bits (354), Expect = 3e-32
 Identities = 61/117 (52%), Positives = 68/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  
Sbjct: 708  PPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVT 767

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPP
Sbjct: 768  PPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPP 824

 Score =  140 bits (354), Expect = 3e-32
 Identities = 61/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP    PV  
Sbjct: 908  PPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVAT 967

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPV KPPV  PP+ KPP
Sbjct: 968  PPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPP 1024

 Score =  140 bits (354), Expect = 3e-32
 Identities = 61/117 (52%), Positives = 68/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+   P+  PPV  PP    PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  
Sbjct: 943  PPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVAT 1002

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PPVEKPPV  PP+ KPP   PP+ KPPV   P   PP   PPV  PPV KPP
Sbjct: 1003 PPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPP 1059

 Score =  140 bits (353), Expect = 4e-32
 Identities = 59/117 (50%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP  K P+  PP+ + PV  PP    P++ PP  KPPV  PP+ K P+  PP   PPV  
Sbjct: 368 PPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVAT 427

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+ KPPV  PP   PP   PPV KPPVE PP+  PP  KPP+  PP+ KPPV  PP
Sbjct: 428 PPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPP 484

 Score =  140 bits (353), Expect = 4e-32
 Identities = 63/123 (51%), Positives = 71/123 (57%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 171
           KPPV  PP   PP+      KPPV  PP+  PPV KPPV  PP   PP+  PP+ K PV 
Sbjct: 477 KPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVA 536

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
            PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ 
Sbjct: 537 TPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPIS 596

Query: 352 KPP 360
           K P
Sbjct: 597 KSP 599

 Score =  140 bits (353), Expect = 4e-32
 Identities = 61/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  
Sbjct: 628 PPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVAT 687

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP
Sbjct: 688 PPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPP 744

 Score =  140 bits (353), Expect = 4e-32
 Identities = 60/118 (50%), Positives = 68/118 (57%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP+ 
Sbjct: 682  KPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIA 741

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP
Sbjct: 742  TPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPP 799

 Score =  140 bits (353), Expect = 4e-32
 Identities = 57/117 (48%), Positives = 72/117 (61%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            P V  PP+  PP+ K P+  PPV  PP+ KPP+  PPV   P+ KPP+  PP   PPV  
Sbjct: 1084 PIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVAN 1143

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPP
Sbjct: 1144 PPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPP 1200

 Score =  140 bits (352), Expect = 6e-32
 Identities = 55/117 (47%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV  PP+  PP   PP+  PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  
Sbjct: 200 PPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIAN 259

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+  PP+  PPV  PP+  PP+ KPPV  PP   PP+ KPP+  PP+  PP   PP
Sbjct: 260 PPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPP 316

 Score =  140 bits (352), Expect = 6e-32
 Identities = 60/117 (51%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP    P++ PP  KPPV  PP+ K P+  PP   PPV  PP+ KPPV  PP   PP   
Sbjct: 388 PPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTAT 447

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV KPPVE PP+  PP  KPP+  PP+ KPPV  PP   PP+  P   KPPV  PP
Sbjct: 448 PPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPP 504

 Score =  140 bits (352), Expect = 6e-32
 Identities = 60/118 (50%), Positives = 72/118 (61%), Gaps = 1/118 (0%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVE 186
            PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP   PP+  PP +  PP+ K P+ 
Sbjct: 1043 PPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIA 1102

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV  PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP
Sbjct: 1103 TPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPP 1160

 Score =  140 bits (352), Expect = 6e-32
 Identities = 61/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  
Sbjct: 1264 PPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVAT 1323

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PPV  PP+ KPP  +PPV  PPV  PP+ K PV  PP+ KPPV   P+  PP
Sbjct: 1324 PPTVTPPVATPPIAKPPGARPPVATPPVATPPIAKSPVATPPMTKPPVASSPIATPP 1380

 Score =  140 bits (352), Expect = 6e-32
 Identities = 61/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  
Sbjct: 1274 PPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVAT 1333

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ KPP  +PPV  PPV  PP+ K PV  PP+ KPPV   P+  PP+ K P+  PP
Sbjct: 1334 PPIAKPPGARPPVATPPVATPPIAKSPVATPPMTKPPVASSPIATPPIAKTPIATPP 1390

 Score =  139 bits (351), Expect = 7e-32
 Identities = 58/117 (49%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+  PP  K P+  PP+ + PV  PP    P+  PP  KPPV  PP+ K P+  PP   
Sbjct: 363 PPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTAT 422

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV  PP+EKPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPP
Sbjct: 423 PPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPP 479

 Score =  139 bits (351), Expect = 7e-32
 Identities = 61/117 (52%), Positives = 68/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P   KPPV  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ K
Sbjct: 493 PTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAK 552

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP
Sbjct: 553 PPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPP 609

 Score =  139 bits (351), Expect = 7e-32
 Identities = 60/118 (50%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+ 
Sbjct: 532 KSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPIS 591

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   P
Sbjct: 592 TPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSP 649

 Score =  139 bits (351), Expect = 7e-32
 Identities = 60/117 (51%), Positives = 67/117 (57%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV K
Sbjct: 703  PPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAK 762

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PP
Sbjct: 763  PPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPP 819

 Score =  139 bits (351), Expect = 7e-32
 Identities = 61/117 (52%), Positives = 68/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV KPPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP   PP   PPV  
Sbjct: 928  PPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAM 987

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP  KPPV  PP+  PPV KPPV  PP+ KPP   PP+ KPPVE  P   PP
Sbjct: 988  PPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPP 1044

 Score =  139 bits (350), Expect = 1e-31
 Identities = 59/118 (50%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           K P+  PP+ + PV  PP    P+  PP  KPPV  PP+ K P+  PP   PPV  PP+E
Sbjct: 372 KSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIE 431

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP
Sbjct: 432 KPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPP 489

 Score =  139 bits (350), Expect = 1e-31
 Identities = 61/118 (51%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV 
Sbjct: 597 KSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVA 656

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PP
Sbjct: 657 TPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPP 714

 Score =  139 bits (350), Expect = 1e-31
 Identities = 60/117 (51%), Positives = 68/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  
Sbjct: 678  PPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAM 737

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PP
Sbjct: 738  PPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPP 794

 Score =  139 bits (350), Expect = 1e-31
 Identities = 60/117 (51%), Positives = 68/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  
Sbjct: 698  PPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAI 757

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP
Sbjct: 758  PPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPP 814

 Score =  139 bits (350), Expect = 1e-31
 Identities = 60/118 (50%), Positives = 67/118 (56%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP   PP   PPV  PP+ 
Sbjct: 932  KPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIA 991

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP  KPPV  PP+  PPVEKPPV  PP+ KPP   PP+ KPPV   P   PP   PP
Sbjct: 992  TPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPP 1049

 Score =  139 bits (350), Expect = 1e-31
 Identities = 64/128 (50%), Positives = 75/128 (58%), Gaps = 11/128 (8%)
 Frame = +1

Query: 10   PPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP------VE 156
            PP+ KPPVE      PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP      V 
Sbjct: 1028 PPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVT 1087

Query: 157  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
             PP+  PP+ K P+  PPV  PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ 
Sbjct: 1088 PPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIA 1147

Query: 337  KPPVYKPP 360
            K P+ KPP
Sbjct: 1148 KSPIAKPP 1155

 Score =  139 bits (350), Expect = 1e-31
 Identities = 61/117 (52%), Positives = 71/117 (60%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV K
Sbjct: 1259 PPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAK 1318

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP   PPV  PP+ KPP  +PPV  PPV  PP+ K PV  PP+ KPPV   P
Sbjct: 1319 PPVATPPTVTPPVATPPIAKPPGARPPVATPPVATPPIAKSPVATPPMTKPPVASSP 1375

 Score =  139 bits (349), Expect = 1e-31
 Identities = 60/117 (51%), Positives = 68/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+  
Sbjct: 638 PPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIAT 697

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP
Sbjct: 698 PPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPP 754

 Score =  139 bits (349), Expect = 1e-31
 Identities = 59/117 (50%), Positives = 68/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  K
Sbjct: 688  PPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAK 747

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPP
Sbjct: 748  PPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPP 804

 Score =  138 bits (348), Expect = 2e-31
 Identities = 61/117 (52%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+  P   KPPV  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  
Sbjct: 488 PPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVAT 547

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP
Sbjct: 548 PPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPP 604

 Score =  138 bits (347), Expect = 2e-31
 Identities = 58/116 (50%), Positives = 69/116 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+ + PV  PP    P++ PP  KPPV  PP+ K P+  PP   PPV  PP+ KPPV  
Sbjct: 378 PPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVAT 437

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP   PP   PPV KPPVE PP+  PP  KPP+  PP+ KPPV  PP   PP+  P
Sbjct: 438 PPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTP 493

 Score =  138 bits (347), Expect = 2e-31
 Identities = 60/124 (48%), Positives = 73/124 (58%), Gaps = 6/124 (4%)
 Frame = +1

Query: 7    KPPVYKPPVEKPP------VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            KPPV  PPV  PP      V  PP+  PP+ K P+  PPV  PP+ KPP+  PPV   P+
Sbjct: 1067 KPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPI 1126

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
             KPP+  PP   PPV  PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPPV
Sbjct: 1127 AKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPV 1186

Query: 349  YKPP 360
              PP
Sbjct: 1187 ASPP 1190

 Score =  138 bits (347), Expect = 2e-31
 Identities = 61/118 (51%), Positives = 71/118 (60%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP  
Sbjct: 1268 KSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTV 1327

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV  PP+ KPP  +PPV  PPV  PP+ K PV  PP+ KPPV   P+  PP+ K P
Sbjct: 1328 TPPVATPPIAKPPGARPPVATPPVATPPIAKSPVATPPMTKPPVASSPIATPPIAKTP 1385

 Score =  137 bits (346), Expect = 3e-31
 Identities = 56/120 (46%), Positives = 71/120 (59%), Gaps = 2/120 (1%)
 Frame = +1

Query: 7   KPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           +PP +KPP     PPV  PP+  PP   PP+  PP+ K PV  PP+  PP   PP+  PP
Sbjct: 187 QPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPP 246

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           V  PP+  PP+  PP+  PP+  PPV  PP+  PP+ KPPV  PP   PP+ KPP+  PP
Sbjct: 247 VATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPP 306

 Score =  137 bits (346), Expect = 3e-31
 Identities = 54/117 (46%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+  PP + PP+  PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  
Sbjct: 205 PPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIM 264

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+  PPV  PP+  PP+ KPPV  PP   PP+ KPP+  PP+  PP   PP   PP
Sbjct: 265 PPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPP 321

 Score =  137 bits (346), Expect = 3e-31
 Identities = 58/117 (49%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV  PP+  PP  K P+  PP+ + PV  PP    P++ PP  KPPV  PP+ K P+  
Sbjct: 358 PPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIAT 417

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP   PPV  PP+ KPPV  PP   PP   PPV KPPVE PP+  PP  KPP+  PP
Sbjct: 418 PPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPP 474

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/117 (51%), Positives = 71/117 (60%), Gaps = 1/117 (0%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVE 186
            PPV  PPV KPPV  PP+ KPPV  PPV  PP   PP V  PP+  PP+ K P+  PPV 
Sbjct: 1048 PPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVS 1107

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
             PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   P
Sbjct: 1108 TPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMP 1164

 Score =  137 bits (346), Expect = 3e-31
 Identities = 60/124 (48%), Positives = 73/124 (58%), Gaps = 6/124 (4%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPP------VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            KPPV  PP+ KPPV  PPV  PP      V  PP+  PP+ K P+  PPV  PP+ KPP+
Sbjct: 1057 KPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPI 1116

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   P +  PP+ KPPV
Sbjct: 1117 ATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPV 1176

Query: 349  YKPP 360
              PP
Sbjct: 1177 ATPP 1180

 Score =  137 bits (345), Expect = 4e-31
 Identities = 59/116 (50%), Positives = 67/116 (57%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV  PP    P+  PP  KPPV  PP+ K P+  PP   PPV  PP+EKPPV  PP   P
Sbjct: 384 PVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTP 443

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  P   KPP
Sbjct: 444 PTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPP 499

 Score =  137 bits (345), Expect = 4e-31
 Identities = 60/117 (51%), Positives = 69/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  
Sbjct: 863  PPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAI 922

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PPV KPPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP   PP
Sbjct: 923  PPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPP 979

 Score =  137 bits (345), Expect = 4e-31
 Identities = 58/118 (49%), Positives = 71/118 (60%), Gaps = 1/118 (0%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVE 186
            PPV KPPV  PP+ KPPV  PPV  PP   PP+  PP +  PP+ K P+  PPV  PP+ 
Sbjct: 1053 PPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIA 1112

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   P +  PP
Sbjct: 1113 KPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPP 1170

 Score =  137 bits (344), Expect = 5e-31
 Identities = 60/117 (51%), Positives = 69/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  K
Sbjct: 858  PPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAK 917

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP
Sbjct: 918  PPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPP 974

 Score =  136 bits (342), Expect = 8e-31
 Identities = 58/118 (49%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PPV  PP   PPV  PP+  PP  K P+  PP+ + PV  PP    P++ PP  KPPV 
Sbjct: 347 QPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPPVA 406

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+ K P+  PP   PPV  PP+ KPPV  PP   PP   PPV KPPVE PP+  PP
Sbjct: 407 TPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPP 464

 Score =  136 bits (342), Expect = 8e-31
 Identities = 58/117 (49%), Positives = 67/117 (57%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   PPV  PP+  PP  K P+  PP+ + PV  PP    P+  PP  KPPV  PP+ K
Sbjct: 353 PPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAK 412

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            P+  PP   PPV  PP+EKPPV  PP   PP   PPV KPPV  PP+  PP  KPP
Sbjct: 413 SPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPP 469

 Score =  136 bits (342), Expect = 8e-31
 Identities = 60/118 (50%), Positives = 68/118 (57%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP+ 
Sbjct: 867  KPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIA 926

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV KPPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP   PP   PP
Sbjct: 927  TPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPP 984

 Score =  135 bits (341), Expect = 1e-30
 Identities = 59/117 (50%), Positives = 68/117 (58%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV K
Sbjct: 873  PPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAK 932

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP   PP   PPV  PP
Sbjct: 933  PPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPP 989

 Score =  135 bits (341), Expect = 1e-30
 Identities = 60/116 (51%), Positives = 69/116 (59%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ K
Sbjct: 1279 PPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAK 1338

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            PP  +PPV  PPV  PP+ K PV  PP+ KPPV   P+  PP+ K P+  PP   P
Sbjct: 1339 PPGARPPVATPPVATPPIAKSPVATPPMTKPPVASSPIATPPIAKTPIATPPTTMP 1394

 Score =  135 bits (340), Expect = 1e-30
 Identities = 54/119 (45%), Positives = 69/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           + PP+  PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV
Sbjct: 213 QMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPV 272

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP+  PP+ KPPV  PP   PP+ KPP+  PP+  PP   PP   PP+   P  KPP
Sbjct: 273 AAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPP 331

 Score =  135 bits (340), Expect = 1e-30
 Identities = 60/118 (50%), Positives = 68/118 (57%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV 
Sbjct: 847  KPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVA 906

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP    P
Sbjct: 907  IPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSP 964

 Score =  135 bits (339), Expect = 2e-30
 Identities = 53/117 (45%), Positives = 67/117 (57%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   PP+  PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  
Sbjct: 210 PPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIAT 269

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV  PP+  PP+ KPPV  PP   PP+ KPP+  PP+  PP   PP   PP+   P
Sbjct: 270 PPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLP 326

 Score =  133 bits (335), Expect = 5e-30
 Identities = 57/116 (49%), Positives = 67/116 (57%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P+ +PPV  PP   PPV  PP+  PP  K P+  PP+ + PV  PP    P+  PP  KP
Sbjct: 344 PIAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKP 403

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PV  PP+ K P+  PP   PPV  PP+EKPPV  PP   PP   PPV KPPV  PP
Sbjct: 404 PVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPP 459

 Score =  132 bits (333), Expect = 9e-30
 Identities = 54/117 (46%), Positives = 67/117 (57%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV  PP+  
Sbjct: 220 PPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITN 279

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+ KPPV  PP   PP+ KPP+  PP+  PP   PP   PP+   P  KPPV   P
Sbjct: 280 PPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPPVAISP 336

 Score =  131 bits (330), Expect = 2e-29
 Identities = 54/118 (45%), Positives = 67/118 (56%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV  PP+  PP+ 
Sbjct: 224 KSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPIS 283

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPPV  PP   PP+ KPP+  PP+  PP   PP   PP+   P  KPPV   P+  PP
Sbjct: 284 KPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPPVAISPIVTPP 341

 Score =  130 bits (328), Expect = 3e-29
 Identities = 58/112 (51%), Positives = 66/112 (58%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ KPP  
Sbjct: 1283 KPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGA 1342

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
            +PPV  PPV  PP+ K PV  PP+ KPPV   P+  PP+ K P+  PP   P
Sbjct: 1343 RPPVATPPVATPPIAKSPVATPPMTKPPVASSPIATPPIAKTPIATPPTTMP 1394

 Score =  129 bits (324), Expect = 1e-28
 Identities = 56/125 (44%), Positives = 70/125 (56%), Gaps = 8/125 (6%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV  PP+  PP+ KPPV  
Sbjct: 230 PPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTT 289

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPPV---EKPP 345
           PP   PP+ KPP+  PP+  PP   PP   PP+      KPPV   P+  PPV    +PP
Sbjct: 290 PPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPPVAISPIVTPPVTPIAQPP 349

Query: 346 VYKPP 360
           V  PP
Sbjct: 350 VATPP 354

 Score =  128 bits (322), Expect = 2e-28
 Identities = 57/124 (45%), Positives = 70/124 (56%), Gaps = 6/124 (4%)
 Frame = +1

Query: 7   KPPVYKPP--VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPV 168
           KPP  KPP    KPP   PP    +PP +KPP     PPV  PP+  PP   PP+  PP+
Sbjct: 163 KPPSVKPPPSTPKPPTTNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPI 222

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV  PP+  PP+
Sbjct: 223 AKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPI 282

Query: 349 YKPP 360
            KPP
Sbjct: 283 SKPP 286

 Score =  121 bits (304), Expect = 2e-26
 Identities = 54/121 (44%), Positives = 66/121 (54%), Gaps = 3/121 (2%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV- 183
           KPPV  PP   PP+ KPP+  PP+  PP   PP   PP+   P  KPPV   P+  PPV 
Sbjct: 284 KPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPPVAISPIVTPPVT 343

Query: 184 --EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
              +PPV  PP   PPV  PP+  PP  K P+  PP+ + PV  PP    P++ PP  KP
Sbjct: 344 PIAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKP 403

Query: 358 P 360
           P
Sbjct: 404 P 404

 Score =  111 bits (278), Expect = 2e-23
 Identities = 57/161 (35%), Positives = 71/161 (44%), Gaps = 44/161 (27%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP----------------------- 120
           PP+ KPPV  PP   PP+ KPP+  PP+  PP   PP                       
Sbjct: 280 PPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPPVAISPIVT 339

Query: 121 -----VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----------------P 237
                + +PPV  PP   PPV  PP+  PP  K P+  PP+ +                P
Sbjct: 340 PPVTPIAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPP 399

Query: 238 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P + P V  PP+ K P+  PP   PPV  PP+EKPPV  PP
Sbjct: 400 PAKPP-VATPPIAKSPIATPPTATPPVATPPIEKPPVATPP 439

 Score =  108 bits (271), Expect = 1e-22
 Identities = 58/125 (46%), Positives = 65/125 (52%), Gaps = 7/125 (5%)
 Frame = +1

Query: 7   KPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP--VEKPPVYKP 177
           KPP  KP P  KPP    P  KPP    P  KPP  KPP  KPP  KPP    KPP   P
Sbjct: 123 KPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPP-PKPPSVKPPPSTPKPPTTNP 181

Query: 178 P--VEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           P    +PP +KPP     PPV  PP+  PP   PP+  PP+ K PV  PP+  PP   PP
Sbjct: 182 PPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPP 241

Query: 346 VYKPP 360
           +  PP
Sbjct: 242 ITIPP 246

 Score =  106 bits (264), Expect = 9e-22
 Identities = 60/132 (45%), Positives = 66/132 (50%), Gaps = 14/132 (10%)
 Frame = +1

Query: 7   KPPVYKPPVE-------KPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 162
           KPP  KPP         KPP  KP P  KPP    P  KPP    P  KPP  KPP  KP
Sbjct: 106 KPPTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPP-PKP 164

Query: 163 PVYKPP--VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYK 324
           P  KPP    KPP   PP    +PP +KPP     PPV  PP+  PP   PP+  PP+ K
Sbjct: 165 PSVKPPPSTPKPPTTNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAK 224

Query: 325 PPVEKPPVYKPP 360
            PV  PP+  PP
Sbjct: 225 SPVATPPIATPP 236

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 62/137 (45%), Positives = 64/137 (46%), Gaps = 19/137 (13%)
 Frame = +1

Query: 7   KPPVYKPPVEK------PPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--- 156
           KPP  KPP  K      PP  KP P  KPP    P  KPP    P  KPP  KPP     
Sbjct: 59  KPPTIKPPPPKRHPHPKPPTVKPHPHPKPPTKPHPHPKPPTKPHPHPKPPTIKPPPHPKP 118

Query: 157 ----KPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP--VEKPP 315
               KPP  KP P  KPP    P  KPP    P  KPP  KPP  KPP  KPP    KPP
Sbjct: 119 RPHPKPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPP-PKPPSVKPPPSTPKPP 177

Query: 316 VYKPP--VEKPPVYKPP 360
              PP    +PP +KPP
Sbjct: 178 TTNPPPSTPQPPTHKPP 194

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 63/124 (50%), Positives = 66/124 (53%), Gaps = 6/124 (4%)
 Frame = +1

Query: 7   KPPVYKP-PVEKPPVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKP 177
           KPP  KP P  KPP  KPP  K  P  KPP  KP P  KPP +  P  KPP +  P  KP
Sbjct: 48  KPPAVKPHPHPKPPTIKPPPPKRHPHPKPPTVKPHPHPKPPTKPHPHPKPPTKPHPHPKP 107

Query: 178 PVEKPPVY-KP-PVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           P  KPP + KP P  KPP  KP P  KPP    P  KPP    P  KPP  KPP  KPP 
Sbjct: 108 PTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPP-PKPPS 166

Query: 349 YKPP 360
            KPP
Sbjct: 167 VKPP 170

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 58/133 (43%), Positives = 59/133 (44%), Gaps = 16/133 (12%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPV------EKPPVYKP-PVEKPP 165
           PP   P   KPP +     KPP  KP P  KPP  KPP        KPP  KP P  KPP
Sbjct: 29  PPKPSPKPHKPPKHSVVPPKPPAVKPHPHPKPPTIKPPPPKRHPHPKPPTVKPHPHPKPP 88

Query: 166 VYKPPVEKPPVYKPPVEKPPVYKPPVE-------KPPVYKP-PVEKPPVYKPPVEKPPVY 321
               P  KPP    P  KPP  KPP         KPP  KP P  KPP    P  KPP  
Sbjct: 89  TKPHPHPKPPTKPHPHPKPPTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTK 148

Query: 322 KPPVEKPPVYKPP 360
             P  KPP  KPP
Sbjct: 149 HHPHPKPPTIKPP 161

[26][TOP]
>UniRef100_P08297 Early nodulin-75 n=1 Tax=Glycine max RepID=NO75_SOYBN
          Length = 309

 Score =  155 bits (391), Expect = 2e-36
 Identities = 82/135 (60%), Positives = 97/135 (71%), Gaps = 15/135 (11%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVY 171
           ++ PP Y+PP EKPP  ++PP EKPP ++PP EKPP  Y+PP EKPP  Y+PP EKPP  
Sbjct: 164 EKPPPEYQPPHEKPPPEHQPPHEKPPEHQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPHE 223

Query: 172 KPPVE-------KPPVYKPPVEKPP-VYKPPVEKPP-VYKPPVEKPP--VYKPPVEKPPV 318
           KPP E        PP ++PP EKPP VY PP EKPP VY+PP EKPP  VY PP EKPP+
Sbjct: 224 KPPPEYQPPHEKPPPEHQPPHEKPPPVYPPPYEKPPPVYEPPYEKPPPVVYPPPHEKPPI 283

Query: 319 YK-PPVEKPPVYKPP 360
           Y+ PP+EKPPVY PP
Sbjct: 284 YEPPPLEKPPVYNPP 298

 Score =  141 bits (356), Expect = 2e-32
 Identities = 77/128 (60%), Positives = 93/128 (72%), Gaps = 8/128 (6%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV- 168
           +  PP ++PP EKPP ++PP EKPP  Y+PP EKPP  Y+PP EKPP  Y+PP EKPP  
Sbjct: 110 ENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPE 169

Query: 169 YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVE- 336
           Y+PP EKPP  ++PP EKPP ++PP EKPP  Y+PP EKPP  Y+PP EKPP  KPP E 
Sbjct: 170 YQPPHEKPPPEHQPPHEKPPEHQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPHEKPPPEY 229

Query: 337 KPPVYKPP 360
           +PP  KPP
Sbjct: 230 QPPHEKPP 237

 Score =  139 bits (351), Expect = 7e-32
 Identities = 78/134 (58%), Positives = 95/134 (70%), Gaps = 14/134 (10%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEK------PPVYKPPVEKPPVYKPPVEK-PPVYKPPVE 156
           ++ PP Y PP EKPP  Y+PP EK      PP ++PP EKPP ++PP EK PP Y+PP E
Sbjct: 83  EKPPPEYLPPHEKPPPEYQPPHEKPPHENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPHE 142

Query: 157 K-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPPVEK-PPVY 321
           K PP Y+PP EK PP Y+PP EK PP Y+PP EK PP ++PP EKPP ++PP EK PP Y
Sbjct: 143 KPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEHQPPHEKPPEHQPPHEKPPPEY 202

Query: 322 KPPVEK-PPVYKPP 360
           +PP EK PP Y+PP
Sbjct: 203 QPPHEKPPPEYQPP 216

 Score =  134 bits (337), Expect = 3e-30
 Identities = 78/135 (57%), Positives = 90/135 (66%), Gaps = 16/135 (11%)
 Frame = +1

Query: 4   EKPPVYKPP-VEKPPVYKPPV-EKPPVYKPPVEK-PPVYKPPVEK--PPVYKPPVEK-PP 165
           EKPP Y+PP   KPP Y PPV   PP Y+PP EK PP Y PP  +  PP Y PP EK PP
Sbjct: 39  EKPPTYEPPPFYKPPYYPPPVHHPPPEYQPPHEKTPPEYLPPPHEKPPPEYLPPHEKPPP 98

Query: 166 VYKPPVEK------PPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPV 318
            Y+PP EK      PP ++PP EKPP ++PP EK PP Y+PP EK PP Y+PP EK PP 
Sbjct: 99  EYQPPHEKPPHENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPHEKPPPEYQPPHEKPPPE 158

Query: 319 YKPPVEK-PPVYKPP 360
           Y+PP EK PP Y+PP
Sbjct: 159 YQPPHEKPPPEYQPP 173

 Score =  130 bits (326), Expect = 6e-29
 Identities = 72/120 (60%), Positives = 84/120 (70%), Gaps = 7/120 (5%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVY 171
           ++ PP Y+PP EKPP  Y+PP EKPP  KP    PP Y+PP EK PP ++PP EK PPVY
Sbjct: 196 EKPPPEYQPPHEKPPPEYQPPQEKPPHEKP----PPEYQPPHEKPPPEHQPPHEKPPPVY 251

Query: 172 KPPVEK-PPVYKPPVEKPP--VYKPPVEKPPVYK-PPVEKPPVYKPPVEKPPVYKPPVEK 339
            PP EK PPVY+PP EKPP  VY PP EKPP+Y+ PP+EKPPVY PP   P    PP +K
Sbjct: 252 PPPYEKPPPVYEPPYEKPPPVVYPPPHEKPPIYEPPPLEKPPVYNPP---PYGRYPPSKK 308

 Score =  120 bits (302), Expect = 4e-26
 Identities = 71/129 (55%), Positives = 82/129 (63%), Gaps = 20/129 (15%)
 Frame = +1

Query: 34  EKPPVYKPPV-EKPPVYKPPVEKPPV------YKPPVEK-PPVYKPPVEK--PPVYKPPV 183
           E PP+ KPP  E PP YKPP   PPV      Y+PP EK PP Y PP  +  PP Y PP 
Sbjct: 34  EPPPIEKPPTYEPPPFYKPPYYPPPVHHPPPEYQPPHEKTPPEYLPPPHEKPPPEYLPPH 93

Query: 184 EK-PPVYKPPVEK------PPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVE 336
           EK PP Y+PP EK      PP ++PP EKPP ++PP EK PP Y+PP EK PP Y+PP E
Sbjct: 94  EKPPPEYQPPHEKPPHENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPHEKPPPEYQPPHE 153

Query: 337 K-PPVYKPP 360
           K PP Y+PP
Sbjct: 154 KPPPEYQPP 162

[27][TOP]
>UniRef100_Q7M1Z7 Extensin (Fragment) n=1 Tax=Daucus carota RepID=Q7M1Z7_DAUCA
          Length = 154

 Score =  151 bits (382), Expect = 2e-35
 Identities = 74/122 (60%), Positives = 85/122 (69%), Gaps = 5/122 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYKP--- 177
           PP++KPPV  PPV+KPP+ KPPVY PPV KPPVY PPV KPP  YKPPVE          
Sbjct: 20  PPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHY 79

Query: 178 PVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P+ KPPVYKPPV+KP P +KPPV KPP++KPPV    VYK     PP++ PP   PPVY 
Sbjct: 80  PIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVH-TLVYKYKSPPPPMHSPP---PPVYS 135

Query: 355 PP 360
           PP
Sbjct: 136 PP 137

 Score =  123 bits (308), Expect = 7e-27
 Identities = 66/118 (55%), Positives = 74/118 (62%), Gaps = 5/118 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYKP---PVEKPPVYKPPVEKP-PVY 171
           KPPVY PPV KPPVY PPV KPP  YKPPVE          P+ KPPVYKPPV+KP P +
Sbjct: 39  KPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHYPIHKPPVYKPPVQKPAPEH 98

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           KPPV KPP++KPPV    VYK     PP++ PP   PPVY PP   PP +      PP
Sbjct: 99  KPPVHKPPIHKPPVH-TLVYKYKSPPPPMHSPP---PPVYSPP---PPKHHYSYTSPP 149

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 30/65 (46%), Positives = 37/65 (56%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           Q+  P +KPPV KPP++KPPV    VYK     PP++ PP   PPVY PP   PP +   
Sbjct: 92  QKPAPEHKPPVHKPPIHKPPVH-TLVYKYKSPPPPMHSPP---PPVYSPP---PPKHHYS 144

Query: 181 VEKPP 195
              PP
Sbjct: 145 YTSPP 149

[28][TOP]
>UniRef100_Q9ZQI0 Putative uncharacterized protein At2g27380 n=1 Tax=Arabidopsis
           thaliana RepID=Q9ZQI0_ARATH
          Length = 761

 Score =  150 bits (380), Expect = 3e-35
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 34/151 (22%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-------PPVYKPPVEK-------PPVYKP 147
           PP+Y PP+  PP+ KPP   PP+Y PP++K       PP+Y PP++K       PP+Y P
Sbjct: 60  PPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPP 119

Query: 148 PVEK-------PPVYKPPVEKPPV--YKPPVEKPPV-------YKPPVEKPPVYKPPVE- 276
           P++K       PP+Y PP++KPP   Y PPV+ PPV       Y PP++ PPV+KPP   
Sbjct: 120 PIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPT 179

Query: 277 -KPPVYKPPVEKP--PVYKPPVEKPPVYKPP 360
             PP+ KPPV KP  P+Y PP++ PPV+KPP
Sbjct: 180 YSPPI-KPPVHKPPTPIYSPPIKPPPVHKPP 209

 Score =  147 bits (372), Expect = 3e-34
 Identities = 71/130 (54%), Positives = 88/130 (67%), Gaps = 12/130 (9%)
 Frame = +1

Query: 7   KPPVYKP--PVEKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP-- 162
           KPPV+KP  P+  PP+  PPV KP  P+Y PP++ PPV+KPP     PPV  PPV KP  
Sbjct: 185 KPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPT 244

Query: 163 PVYKPPVEKPPVYKP--PVEKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPP 330
           P+Y PP++ PPV+KP  P+  PPV  PPV+ P  P+Y PPV+ PPV+KPP    P Y PP
Sbjct: 245 PIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPT---PTYSPP 301

Query: 331 VEKPPVYKPP 360
           V+ PPV KPP
Sbjct: 302 VKSPPVQKPP 311

 Score =  147 bits (370), Expect = 5e-34
 Identities = 71/130 (54%), Positives = 88/130 (67%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKP--PVYKPPVEKPPVYKP--PVEKPPVYKPPVEKP--PVYKPPVEKPPVY 171
           PPV  PPV KP  P+Y PP++ PPV+KP  P+  PPV  PPV+ P  P+Y PPV+ PPV+
Sbjct: 232 PPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVH 291

Query: 172 KPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP-PVYKPP 330
           KPP     PPV  PPV+KP  P Y PP++ PPV KPP     PP+  PPV+ P P+Y PP
Sbjct: 292 KPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPP 351

Query: 331 VEKPPVYKPP 360
           V+ PPV+KPP
Sbjct: 352 VKPPPVHKPP 361

 Score =  145 bits (367), Expect = 1e-33
 Identities = 67/124 (54%), Positives = 85/124 (68%), Gaps = 8/124 (6%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP--PVE 186
           P+Y PP++ PPV+KPP    P Y PPV+ PPV+KPP    P+Y PP++ PPV+KP  P+ 
Sbjct: 211 PIYSPPIKPPPVHKPPT---PTYSPPVKPPPVHKPPT---PIYSPPIKPPPVHKPPTPIY 264

Query: 187 KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPV 348
            PPV  PPV+ P  P+Y PPV+ PPV+KPP     PPV  PPV+KP  P Y PP++ PPV
Sbjct: 265 SPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPV 324

Query: 349 YKPP 360
            KPP
Sbjct: 325 QKPP 328

 Score =  145 bits (365), Expect = 2e-33
 Identities = 67/123 (54%), Positives = 84/123 (68%), Gaps = 7/123 (5%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYK 174
           P+Y PPV+ PPV+KPP     PPV  PPV+KP  P Y PP++ PPV KPP     PP+  
Sbjct: 279 PIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKP 338

Query: 175 PPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           PPV+ P P+Y PPV+ PPV+KPP    P+Y PPV+ PPV+KPP    P+Y PPV+ PP+ 
Sbjct: 339 PPVKPPTPIYSPPVKPPPVHKPPT---PIYSPPVKPPPVHKPPT---PIYSPPVKPPPIQ 392

Query: 352 KPP 360
           KPP
Sbjct: 393 KPP 395

 Score =  143 bits (360), Expect = 7e-33
 Identities = 68/132 (51%), Positives = 88/132 (66%), Gaps = 15/132 (11%)
 Frame = +1

Query: 10  PPVYKPPVEKPPV--YKPPVEKPPV------YKPPVEKPPVYKPPVEKPPVYKPPVEKPP 165
           PP+  PPV+KPP   Y PP++ PPV      Y PPV+ PPV+KPP    P+Y PPV+ PP
Sbjct: 317 PPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPT---PIYSPPVKPPP 373

Query: 166 VYKP--PVEKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP-PVYK 324
           V+KP  P+  PPV  PP++KP  P Y PP++ PP+ KPP     PP+  PPV+ P P+Y 
Sbjct: 374 VHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYS 433

Query: 325 PPVEKPPVYKPP 360
           PPV+ PPV+KPP
Sbjct: 434 PPVKPPPVHKPP 445

 Score =  140 bits (354), Expect = 3e-32
 Identities = 67/131 (51%), Positives = 83/131 (63%), Gaps = 14/131 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVY 171
           PP+  PP+ KP  P Y PP++ PPV+KPP     PP+  PPV KP  P Y PP++ PPV+
Sbjct: 551 PPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVH 610

Query: 172 KPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKP 327
           KPP     PP+  PPV KP  P Y PP++ PPV+KPP     PP+  PPV+KP  P Y P
Sbjct: 611 KPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSP 670

Query: 328 PVEKPPVYKPP 360
           PV+ PPV  PP
Sbjct: 671 PVKPPPVQLPP 681

 Score =  140 bits (353), Expect = 4e-32
 Identities = 71/145 (48%), Positives = 89/145 (61%), Gaps = 28/145 (19%)
 Frame = +1

Query: 10  PPVYKPPVEKPPV--YKPPVEKPPV------YKPPVEKPPVYKP--PVEKPPVYKPPVEK 159
           PP+  PP++KPP   Y PP++ PPV      Y PPV+ PPV+KP  P+  PPV  PPV K
Sbjct: 401 PPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHK 460

Query: 160 P--PVYKPPVEKPPV------YKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPV 303
           P  P Y PP++ PPV      Y PPV+ PPV KPP     PPV  PP++KP  P Y PP+
Sbjct: 461 PPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPI 520

Query: 304 EKPPV------YKPPVEKPPVYKPP 360
           + PPV      Y PP++ PPV+KPP
Sbjct: 521 KPPPVKPPTPTYSPPIKPPPVHKPP 545

 Score =  140 bits (352), Expect = 6e-32
 Identities = 63/124 (50%), Positives = 80/124 (64%), Gaps = 8/124 (6%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYK 174
           P Y PP++ PP++KPP     PP+  PPV KP  P Y PP++ PPV+KPP     PP+  
Sbjct: 547 PTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 606

Query: 175 PPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           PPV KP  P Y PP++ PPV+KPP    P Y PP++ PPV+KPP    P Y PP++ PPV
Sbjct: 607 PPVHKPPTPTYSPPIKPPPVHKPPT---PTYSPPIKPPPVHKPPT---PTYSPPIKPPPV 660

Query: 349 YKPP 360
            KPP
Sbjct: 661 QKPP 664

 Score =  136 bits (343), Expect = 6e-31
 Identities = 68/137 (49%), Positives = 83/137 (60%), Gaps = 20/137 (14%)
 Frame = +1

Query: 10  PPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PP+  PPV KP  P Y PP++ PPV+KPP    P Y PP++ PPV+KPP    P Y PP+
Sbjct: 585 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPT---PTYSPPIKPPPVHKPPT---PTYSPPI 638

Query: 184 EKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPV-------YKPPVEKPPV---- 318
           + PPV+KPP     PP+  PPV+KP  P Y PPV+ PPV       Y PPV+ PPV    
Sbjct: 639 KPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPP 698

Query: 319 ---YKPPVEKPPVYKPP 360
              Y PPV+ PPV  PP
Sbjct: 699 TPTYSPPVKPPPVQVPP 715

 Score =  126 bits (316), Expect = 9e-28
 Identities = 67/145 (46%), Positives = 81/145 (55%), Gaps = 29/145 (20%)
 Frame = +1

Query: 13   PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYK 174
            P Y PP++ PPV+KPP     PP+  PPV KPP   Y PP++ PPV+KPP     PP+  
Sbjct: 598  PTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKP 657

Query: 175  PPVEKPPV--YKPPVEKPPV-------YKPPVEKPPV-------YKPPVEKPPV------ 288
            PPV+KPP   Y PPV+ PPV       Y PPV+ PPV       Y PPV+ PPV      
Sbjct: 658  PPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTP 717

Query: 289  -YKPPVEKPPVYKPPVEKPPVYKPP 360
             Y PP++ PPV  PP    P   PP
Sbjct: 718  TYSPPIKPPPVQVPPTPTTP--SPP 740

 Score =  108 bits (269), Expect = 2e-22
 Identities = 58/124 (46%), Positives = 69/124 (55%), Gaps = 22/124 (17%)
 Frame = +1

Query: 10  PPVYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPV--YKPPVEKPPV- 168
           PP+  PPV KPP   Y PP++ PPV+KPP     PP+  PPV+KPP   Y PPV+ PPV 
Sbjct: 619 PPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQ 678

Query: 169 ------YKPPVEKPPV-------YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPV 303
                 Y PPV+ PPV       Y PPV+ PPV  PP     PP+  PPV+ PP   P  
Sbjct: 679 LPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPT--PTT 736

Query: 304 EKPP 315
             PP
Sbjct: 737 PSPP 740

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/112 (43%), Positives = 57/112 (50%), Gaps = 28/112 (25%)
 Frame = +1

Query: 10  PPVYKPPVE--KPPVYKPPVEKPPV--YKPPVEKPPV-------YKPPVEKPPV------ 138
           PPV+KPP     PP+  PPV+KPP   Y PPV+ PPV       Y PPV+ PPV      
Sbjct: 641 PPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTP 700

Query: 139 -YKPPVEKPPV-------YKPPVEKPPVYKPPVEKPPVYKPP---VEKPPVY 261
            Y PPV+ PPV       Y PP++ PPV  PP    P   PP      PP Y
Sbjct: 701 TYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTP--SPPQGGYGTPPPY 750

[29][TOP]
>UniRef100_A7PF96 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PF96_VITVI
          Length = 266

 Score =  147 bits (372), Expect = 3e-34
 Identities = 62/118 (52%), Positives = 81/118 (68%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP+ +PP+ KPP+  PPV  PP+ KPP+  PPV  PP+ KPP+  PP+  PP+ KPP+ 
Sbjct: 54  KPPITRPPIVKPPITVPPVV-PPIVKPPITLPPVV-PPIVKPPITVPPITVPPIVKPPIT 111

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP+ KPP+  PP+  PP+ KPPV  PP+  PP+ KPP+  PPV  PPV KPP
Sbjct: 112 VPPITVPPIVKPPITVPPITVPPIVKPPVTVPPITVPPIIKPPITVPPVVTPPVNKPP 169

 Score =  142 bits (358), Expect = 1e-32
 Identities = 63/122 (51%), Positives = 82/122 (67%), Gaps = 2/122 (1%)
 Frame = +1

Query: 1   QEKPPVY-KPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 174
           Q KPP + KPP   KPP  KPP+ +PP+ KPP+  PPV  PP+ KPP+  PPV  PP+ K
Sbjct: 35  QHKPPFHHKPPSHHKPPKGKPPITRPPIVKPPITVPPVV-PPIVKPPITLPPV-VPPIVK 92

Query: 175 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP+  PP+  PP+ KPP+  PP+  PP+ KPP+  PP+  PP+ KPPV  PP+  PP+ K
Sbjct: 93  PPITVPPITVPPIVKPPITVPPITVPPIVKPPITVPPITVPPIVKPPVTVPPITVPPIIK 152

Query: 355 PP 360
           PP
Sbjct: 153 PP 154

 Score =  142 bits (358), Expect = 1e-32
 Identities = 61/119 (51%), Positives = 81/119 (68%), Gaps = 1/119 (0%)
 Frame = +1

Query: 7   KPPVY-KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           KPP + KPP  KPP+ +PP+ KPP+  PPV  PP+ KPP+  PPV  PP+ KPP+  PP+
Sbjct: 43  KPPSHHKPPKGKPPITRPPIVKPPITVPPVV-PPIVKPPITLPPVV-PPIVKPPITVPPI 100

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP+ KPP+  PP+  PP+ KPP+  PP+  PP+ KPPV  PP+  PP+ KPP+  PP
Sbjct: 101 TVPPIVKPPITVPPITVPPIVKPPITVPPITVPPIVKPPVTVPPITVPPIIKPPITVPP 159

 Score =  132 bits (331), Expect = 2e-29
 Identities = 58/117 (49%), Positives = 75/117 (64%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP +KPP    P   P   KPP  KPP+ +PP+ KPP+  PPV  PP+ KPP+  PPV  
Sbjct: 33  PPQHKPPFHHKP---PSHHKPPKGKPPITRPPIVKPPITVPPVV-PPIVKPPITLPPV-V 87

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+ KPP+  PP+  PP+ KPP+  PP+  PP+ KPP+  PP+  PP+ KPPV  PP
Sbjct: 88  PPIVKPPITVPPITVPPIVKPPITVPPITVPPIVKPPITVPPITVPPIVKPPVTVPP 144

 Score =  124 bits (311), Expect = 3e-27
 Identities = 53/110 (48%), Positives = 69/110 (62%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP+  PPV  PP+ KPP+  PP+  PP+ KPP+  PP+  PP+ KPP+  PP+  PP+ 
Sbjct: 78  KPPITLPPVV-PPIVKPPITVPPITVPPIVKPPITVPPITVPPIVKPPITVPPITVPPIV 136

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
           KPPV  PP+  PP+ KPP+  PPV  PPV KPPV  P    P     P++
Sbjct: 137 KPPVTVPPITVPPIIKPPITVPPVVTPPVNKPPVGTPCPPPPASATCPID 186

[30][TOP]
>UniRef100_Q94G51 Proline-rich protein-1 n=1 Tax=Gossypium hirsutum
           RepID=Q94G51_GOSHI
          Length = 299

 Score =  145 bits (365), Expect = 2e-33
 Identities = 71/135 (52%), Positives = 92/135 (68%), Gaps = 15/135 (11%)
 Frame = +1

Query: 1   QEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPP 150
           + KPPVY PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP
Sbjct: 154 EPKPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP 212

Query: 151 VEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
            +KPP+Y+P   KPPVY PP +     KPP+Y+PP   PP+Y+P   KPPVY PP E+ P
Sbjct: 213 -KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPP-NNPPIYEPKPPKPPVYAPPKEEKP 270

Query: 316 VYKPPVEKPPVYKPP 360
             KPPV +PP ++PP
Sbjct: 271 KPKPPVYEPPAHEPP 285

 Score =  143 bits (361), Expect = 5e-33
 Identities = 69/130 (53%), Positives = 89/130 (68%), Gaps = 10/130 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           + KPPVY+PP ++ P  KPPV  PP  + P  KPPVY+PP +KPP+Y+P   KPPVY PP
Sbjct: 139 EPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPP 197

Query: 181 VE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPP 330
            +     KPP+Y+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP   PP+Y+P 
Sbjct: 198 KKEKPEPKPPMYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPP-NNPPIYEPK 255

Query: 331 VEKPPVYKPP 360
             KPPVY PP
Sbjct: 256 PPKPPVYAPP 265

 Score =  141 bits (356), Expect = 2e-32
 Identities = 72/140 (51%), Positives = 92/140 (65%), Gaps = 20/140 (14%)
 Frame = +1

Query: 1   QEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--- 156
           + KPPVY PP +     KPPVY+PP ++ P  KPP+  PP  + P  KPPVY+PP +   
Sbjct: 94  EPKPPVYTPPKKEVPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKP 153

Query: 157 --KPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPP 300
             KPPVY PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP
Sbjct: 154 EPKPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP 212

Query: 301 VEKPPVYKPPVEKPPVYKPP 360
            +KPP+Y+P   KPPVY PP
Sbjct: 213 -KKPPMYEPKPPKPPVYTPP 231

 Score =  137 bits (344), Expect = 5e-31
 Identities = 66/129 (51%), Positives = 87/129 (67%), Gaps = 10/129 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPP 165
           + KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP +KPP+Y+P   KPP
Sbjct: 169 EPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPPMYEPKPPKPP 226

Query: 166 VYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 330
           VY PP +     KPP+Y+PP   PP+Y+P   KPPVY PP E+ P  KPPV +PP ++PP
Sbjct: 227 VYTPPKKEKPEPKPPMYQPP-NNPPIYEPKPPKPPVYAPPKEEKPKPKPPVYEPPAHEPP 285

Query: 331 VEKPPVYKP 357
               P + P
Sbjct: 286 YGHYPGHPP 294

 Score =  134 bits (338), Expect = 2e-30
 Identities = 73/150 (48%), Positives = 93/150 (62%), Gaps = 30/150 (20%)
 Frame = +1

Query: 1   QEKPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPP 150
           + KPPVY+PP +     KPPVY PP +     KP +Y+PP ++ P  KPPV  PP  + P
Sbjct: 49  EPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPTMYEPPKKEKPEPKPPVYTPPKKEVP 108

Query: 151 VEKPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE--- 276
             KPPVY+PP +     KPP+Y PP +     KPPVY+PP +     KPPVY PP +   
Sbjct: 109 KPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKP 168

Query: 277 --KPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             KPPVY+PP +KPP+Y+P   KPPVY PP
Sbjct: 169 EPKPPVYEPP-KKPPMYEPKPPKPPVYTPP 197

 Score =  129 bits (323), Expect = 1e-28
 Identities = 70/143 (48%), Positives = 87/143 (60%), Gaps = 27/143 (18%)
 Frame = +1

Query: 13  PVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE----- 156
           PV+KPP  KPP Y  KPPV +PP  + P  KPPVY PP +     KP +Y+PP +     
Sbjct: 36  PVFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPTMYEPPKKEKPEP 95

Query: 157 KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVY 291
           KPPVY PP +     KPPVY+PP +     KPP+Y PP +     KPPVY+PP ++ P  
Sbjct: 96  KPPVYTPPKKEVPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEP 155

Query: 292 KPPVEKPPVYKPPVEKPPVYKPP 360
           KPPV  PP  + P  KPPVY+PP
Sbjct: 156 KPPVYTPPKKEKPEPKPPVYEPP 178

[31][TOP]
>UniRef100_O49201 Proline-rich protein n=1 Tax=Gossypium hirsutum RepID=O49201_GOSHI
          Length = 299

 Score =  142 bits (358), Expect = 1e-32
 Identities = 68/130 (52%), Positives = 89/130 (68%), Gaps = 10/130 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           + KPPVY+PP ++ P  +PPV  PP  + P  KPPVY+PP +KPP+Y+P   KPPVY PP
Sbjct: 139 EPKPPVYEPPKKEKPEPRPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPP 197

Query: 181 VE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPP 330
            +     KPP+Y+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP   PP+Y+P 
Sbjct: 198 KKEKPEPKPPMYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPP-NNPPIYEPK 255

Query: 331 VEKPPVYKPP 360
             KPPVY PP
Sbjct: 256 PPKPPVYAPP 265

 Score =  140 bits (353), Expect = 4e-32
 Identities = 71/140 (50%), Positives = 92/140 (65%), Gaps = 20/140 (14%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE--- 156
           + KPPVY PP ++ P  KPPV +PP  + P  KPP+Y PP +     KPPVY+PP +   
Sbjct: 94  EPKPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKP 153

Query: 157 --KPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPP 300
             +PPVY PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP
Sbjct: 154 EPRPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP 212

Query: 301 VEKPPVYKPPVEKPPVYKPP 360
            +KPP+Y+P   KPPVY PP
Sbjct: 213 -KKPPMYEPKPPKPPVYTPP 231

 Score =  140 bits (352), Expect = 6e-32
 Identities = 69/135 (51%), Positives = 90/135 (66%), Gaps = 15/135 (11%)
 Frame = +1

Query: 1   QEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPP 150
           + +PPVY PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP
Sbjct: 154 EPRPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP 212

Query: 151 VEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
            +KPP+Y+P   KPPVY PP +     KPP+Y+PP   PP+Y+P   KPPVY PP E+ P
Sbjct: 213 -KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYQPP-NNPPIYEPKPPKPPVYAPPKEEKP 270

Query: 316 VYKPPVEKPPVYKPP 360
             KPPV   P ++PP
Sbjct: 271 KPKPPVYDAPAHEPP 285

 Score =  137 bits (344), Expect = 5e-31
 Identities = 73/150 (48%), Positives = 94/150 (62%), Gaps = 30/150 (20%)
 Frame = +1

Query: 1   QEKPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPP 150
           + KPPVY+PP +     KPPVY PP +     KPP+Y+PP ++ P  KPPV  PP  + P
Sbjct: 49  EPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPPMYEPPKKEKPEPKPPVYTPPKKEEP 108

Query: 151 VEKPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE--- 276
             KPPVY+PP +     KPP+Y PP +     KPPVY+PP +     +PPVY PP +   
Sbjct: 109 KPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPRPPVYTPPKKEKP 168

Query: 277 --KPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             KPPVY+PP +KPP+Y+P   KPPVY PP
Sbjct: 169 EPKPPVYEPP-KKPPMYEPKPPKPPVYTPP 197

 Score =  133 bits (334), Expect = 7e-30
 Identities = 65/129 (50%), Positives = 85/129 (65%), Gaps = 10/129 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPP 165
           + KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP +KPP+Y+P   KPP
Sbjct: 169 EPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPPMYEPKPPKPP 226

Query: 166 VYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 330
           VY PP +     KPP+Y+PP   PP+Y+P   KPPVY PP E+ P  KPPV   P ++PP
Sbjct: 227 VYTPPKKEKPEPKPPMYQPP-NNPPIYEPKPPKPPVYAPPKEEKPKPKPPVYDAPAHEPP 285

Query: 331 VEKPPVYKP 357
               P + P
Sbjct: 286 YGHYPGHPP 294

 Score =  130 bits (328), Expect = 3e-29
 Identities = 70/143 (48%), Positives = 88/143 (61%), Gaps = 27/143 (18%)
 Frame = +1

Query: 13  PVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE----- 156
           PV+KPP  KPP Y  KPPV +PP  + P  KPPVY PP +     KPP+Y+PP +     
Sbjct: 36  PVFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPPMYEPPKKEKPEP 95

Query: 157 KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVY 291
           KPPVY PP +     KPPVY+PP +     KPP+Y PP +     KPPVY+PP ++ P  
Sbjct: 96  KPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEP 155

Query: 292 KPPVEKPPVYKPPVEKPPVYKPP 360
           +PPV  PP  + P  KPPVY+PP
Sbjct: 156 RPPVYTPPKKEKPEPKPPVYEPP 178

[32][TOP]
>UniRef100_B8CCT2 Predicted protein n=1 Tax=Thalassiosira pseudonana CCMP1335
           RepID=B8CCT2_THAPS
          Length = 937

 Score =  142 bits (358), Expect = 1e-32
 Identities = 63/111 (56%), Positives = 65/111 (58%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           PP++K    KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP  K
Sbjct: 578 PPIQKQTAGKPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAK 637

Query: 205 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            P  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP
Sbjct: 638 LPAAKPPAAKPPAAKPPAAKPPTAKPPTAKPPTAKPPAAKPPTVKPPTVKP 688

 Score =  142 bits (357), Expect = 2e-32
 Identities = 64/117 (54%), Positives = 65/117 (55%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+ K    KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP  K
Sbjct: 578 PPIQKQTAGKPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAK 637

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            P  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP     P
Sbjct: 638 LPAAKPPAAKPPAAKPPAAKPPTAKPPTAKPPTAKPPAAKPPTVKPPTVKPTAAVKP 694

 Score =  136 bits (343), Expect = 6e-31
 Identities = 62/114 (54%), Positives = 63/114 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           +K    KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP  K P 
Sbjct: 581 QKQTAGKPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAKLPA 640

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
            KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP     P
Sbjct: 641 AKPPAAKPPAAKPPAAKPPTAKPPTAKPPTAKPPAAKPPTVKPPTVKPTAAVKP 694

[33][TOP]
>UniRef100_Q89392 A57R protein n=1 Tax=Paramecium bursaria Chlorella virus 1
           RepID=Q89392_PBCV1
          Length = 544

 Score =  141 bits (355), Expect = 3e-32
 Identities = 68/118 (57%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 39  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 98

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  +PP  +PP  +PP  +PP
Sbjct: 99  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPP 156

 Score =  140 bits (353), Expect = 4e-32
 Identities = 67/118 (56%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 44  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 103

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  +PP  +PP  +PP  +PP  +PP
Sbjct: 104 KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPP 161

 Score =  139 bits (351), Expect = 7e-32
 Identities = 66/118 (55%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 49  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 108

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPP  KPP  KPP  KPP  KPP  KPP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 109 KPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPPAPEPP 166

 Score =  139 bits (351), Expect = 7e-32
 Identities = 65/118 (55%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 54  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 113

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPP  KPP  KPP  KPP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 114 KPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPPAPEPPALEPP 171

 Score =  138 bits (347), Expect = 2e-31
 Identities = 63/118 (53%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 64  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 123

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPP  KPP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 124 KPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPPAPEPPALEPPAPEPPAPEPP 181

 Score =  137 bits (345), Expect = 4e-31
 Identities = 64/118 (54%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 59  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 118

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPP  KPP  KPP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 119 KPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPPAPEPPALEPPAPEPP 176

 Score =  135 bits (341), Expect = 1e-30
 Identities = 62/118 (52%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 69  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 128

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 129 KPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPPAPEPPALEPPAPEPPAPEPPAPEPP 186

 Score =  125 bits (314), Expect = 1e-27
 Identities = 57/115 (49%), Positives = 68/115 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 79  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPAP 138

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +   Y
Sbjct: 139 EPPAPEPPAPEPPAPEPPAPEPPAPEPPALEPPAPEPPAPEPPAPEPPAPEQNFY 193

[34][TOP]
>UniRef100_C9SV57 Repetitive proline-rich cell wall protein n=1 Tax=Verticillium
           albo-atrum VaMs.102 RepID=C9SV57_9PEZI
          Length = 345

 Score =  140 bits (354), Expect = 3e-32
 Identities = 67/117 (57%), Positives = 77/117 (65%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVY+PP E  PVY+PP E  P  +PP E  PVY+PPVE  PVY+PPVE  PVY+PP E 
Sbjct: 24  PPVYEPPAESHPVYEPPKESYPPVEPPKESHPVYEPPVESHPVYEPPVESHPVYEPPKES 83

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PVY+PP E  PVY+PP E  PVY+PP E  PVY+P  E    Y PP   P  Y PP
Sbjct: 84  HPVYEPPKESHPVYEPPKESHPVYEPPKESHPVYEPLKES---YSPP--PPHEYPPP 135

 Score =  139 bits (350), Expect = 1e-31
 Identities = 64/111 (57%), Positives = 74/111 (66%)
 Frame = +1

Query: 28  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 207
           P   PPVY+PP E  PVY+PP E  P  +PP E  PVY+PPVE  PVY+PPVE  PVY+P
Sbjct: 20  PAPDPPVYEPPAESHPVYEPPKESYPPVEPPKESHPVYEPPVESHPVYEPPVESHPVYEP 79

Query: 208 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P E  PVY+PP E  PVY+PP E  PVY+PP E  PVY+P  E    Y PP
Sbjct: 80  PKESHPVYEPPKESHPVYEPPKESHPVYEPPKESHPVYEPLKES---YSPP 127

 Score =  113 bits (282), Expect = 8e-24
 Identities = 56/102 (54%), Positives = 65/102 (63%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           +E  P  +PP E  PVY+PPVE  PVY+PPVE  PVY+PP E  PVY+PP E  PVY+PP
Sbjct: 41  KESYPPVEPPKESHPVYEPPVESHPVYEPPVESHPVYEPPKESHPVYEPPKESHPVYEPP 100

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 306
            E  PVY+PP E  PVY+P  E    Y PP   PP   PP E
Sbjct: 101 KESHPVYEPPKESHPVYEPLKES---YSPP---PPHEYPPPE 136

[35][TOP]
>UniRef100_Q6PZE9 Putative uncharacterized protein (Fragment) n=1 Tax=Brassica napus
           var. napus RepID=Q6PZE9_BRANA
          Length = 225

 Score =  140 bits (353), Expect = 4e-32
 Identities = 70/129 (54%), Positives = 83/129 (64%), Gaps = 12/129 (9%)
 Frame = +1

Query: 10  PPVYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPV--YKPPVEKPPVY 171
           PPV  PPV+KPP   Y PP++ PPV KPP     PP+  PPV+KPP   Y PPV+ PPV 
Sbjct: 91  PPVKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQ 150

Query: 172 KPPVE--KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP-PVYKPPV 333
           KPP     PP+  PPV+ P P+Y PPV+ PPV KPP     PP+  PPV+ P P Y PPV
Sbjct: 151 KPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVQKPPTPTYSPPIKPPPVKPPTPTYSPPV 210

Query: 334 EKPPVYKPP 360
           + PPV KPP
Sbjct: 211 KPPPVQKPP 219

 Score =  139 bits (349), Expect = 1e-31
 Identities = 73/139 (52%), Positives = 85/139 (61%), Gaps = 20/139 (14%)
 Frame = +1

Query: 4   EKPPV--YKPPVEKPPVYKPPVE--KPPVYKPPVEKP-PVYKPPVEKPPV-------YKP 147
           +KPP   Y PP++ PPV KPP     PPV  PPV+ P P+Y PPV  PPV       Y P
Sbjct: 15  QKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVKPPTPIYSPPVMPPPVQQPPTPSYSP 74

Query: 148 PVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKPPVEK 309
           PV+ PPV KPP     PPV  PPV+KP  P Y PP++ PPV KPP     PP+  PPV+K
Sbjct: 75  PVKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVQK 134

Query: 310 P--PVYKPPVEKPPVYKPP 360
           P  P Y PPV+ PPV KPP
Sbjct: 135 PPTPTYSPPVKPPPVQKPP 153

 Score =  137 bits (346), Expect = 3e-31
 Identities = 68/127 (53%), Positives = 79/127 (62%), Gaps = 7/127 (5%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPV 168
           Q   P Y PPV+ PPV KPP     PPV  PPV+KP  P Y PP++ PPV KPP    P 
Sbjct: 66  QPPTPSYSPPVKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVQKPPT---PT 122

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP-PVYKPPVEK 339
           Y PP++ PPV KPP    P Y PPV+ PPV KPP     PP+  PPV+ P P+Y PPV+ 
Sbjct: 123 YSPPIKPPPVQKPPT---PTYSPPVKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKP 179

Query: 340 PPVYKPP 360
           PPV KPP
Sbjct: 180 PPVQKPP 186

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 49/94 (52%), Positives = 56/94 (59%), Gaps = 8/94 (8%)
 Frame = +1

Query: 10  PPVYKPPVEKPPV--YKPPVEKPPV------YKPPVEKPPVYKPPVEKPPVYKPPVEKPP 165
           PPV  PPV+KPP   Y PP++ PPV      Y PPV+ PPV KPP    P Y PP++ PP
Sbjct: 142 PPVKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVQKPPT---PTYSPPIKPPP 198

Query: 166 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 267
           V KPP    P Y PPV+ PPV KPP    P Y P
Sbjct: 199 V-KPPT---PTYSPPVKPPPVQKPPT---PTYSP 225

[36][TOP]
>UniRef100_C6TN18 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TN18_SOYBN
          Length = 143

 Score =  140 bits (353), Expect = 4e-32
 Identities = 73/120 (60%), Positives = 89/120 (74%), Gaps = 10/120 (8%)
 Frame = +1

Query: 10  PPVYKPP-VEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVEK-PPVYKP 177
           PP+Y+PP +EKPP+Y+P    PP Y+PP  +  PP+YKPP   PPVY+PP EK PPVY+P
Sbjct: 27  PPIYEPPPIEKPPIYEP----PPSYEPPPTENPPPLYKPPFYPPPVYQPPYEKPPPVYQP 82

Query: 178 PVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVY--KPPVEK 339
           P EK PPVY+PP EK PPVY+PP EK PPVY+PP EK PP Y+PP+  PP Y   PP +K
Sbjct: 83  PYEKPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPNEKPPPEYQPPIYNPPPYGHYPPSKK 142

 Score =  139 bits (350), Expect = 1e-31
 Identities = 70/112 (62%), Positives = 85/112 (75%), Gaps = 8/112 (7%)
 Frame = +1

Query: 40  PPVYKPP-VEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVEKPP-VYKP 207
           PP+Y+PP +EKPP+Y+PP    P Y+PP  +  PP+YKPP   PPVY+PP EKPP VY+P
Sbjct: 27  PPIYEPPPIEKPPIYEPP----PSYEPPPTENPPPLYKPPFYPPPVYQPPYEKPPPVYQP 82

Query: 208 PVEKPP-VYKPPVEKPP-VYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVY 351
           P EKPP VY+PP EKPP VY+PP EK PPVY+PP EK PP Y+PP+  PP Y
Sbjct: 83  PYEKPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPNEKPPPEYQPPIYNPPPY 134

 Score =  127 bits (319), Expect = 4e-28
 Identities = 66/105 (62%), Positives = 79/105 (75%), Gaps = 8/105 (7%)
 Frame = +1

Query: 70  PPVYKPPVEKPPVYKPPV-EKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVEK-PPVYKP 237
           PP+Y+PP    P+ KPP+ E PP Y+PP  +  PP+YKPP   PPVY+PP EK PPVY+P
Sbjct: 27  PPIYEPP----PIEKPPIYEPPPSYEPPPTENPPPLYKPPFYPPPVYQPPYEKPPPVYQP 82

Query: 238 PVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPP 360
           P EK PPVY+PP EK PPVY+PP EK PPVY+PP EK PP Y+PP
Sbjct: 83  PYEKPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPNEKPPPEYQPP 127

 Score =  122 bits (305), Expect = 2e-26
 Identities = 65/114 (57%), Positives = 77/114 (67%), Gaps = 12/114 (10%)
 Frame = +1

Query: 4   EKPPVYKPPVE--------KPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPV 153
           EKPP+Y+PP           PP+YKPP   PPVY+PP EK PPVY+PP EK PPVY+PP 
Sbjct: 36  EKPPIYEPPPSYEPPPTENPPPLYKPPFYPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPY 95

Query: 154 EK-PPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 309
           EK PPVY+PP EK PPVY+PP EKP    PP  +PP+Y PP   P  + PP +K
Sbjct: 96  EKPPPVYQPPYEKPPPVYQPPNEKP----PPEYQPPIYNPP---PYGHYPPSKK 142

 Score =  112 bits (279), Expect = 2e-23
 Identities = 58/97 (59%), Positives = 69/97 (71%), Gaps = 4/97 (4%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPV 168
           +  PP+YKPP   PPVY+PP EK PPVY+PP EK PPVY+PP EK PPVY+PP EK PPV
Sbjct: 53  ENPPPLYKPPFYPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPYEKPPPV 112

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 279
           Y+PP EKP    PP  +PP+Y PP   P  + PP +K
Sbjct: 113 YQPPNEKP----PPEYQPPIYNPP---PYGHYPPSKK 142

[37][TOP]
>UniRef100_A1YL95 Proline-rich protein n=1 Tax=Gossypium hirsutum RepID=A1YL95_GOSHI
          Length = 258

 Score =  139 bits (350), Expect = 1e-31
 Identities = 75/150 (50%), Positives = 94/150 (62%), Gaps = 30/150 (20%)
 Frame = +1

Query: 1   QEKPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE--- 126
           + KPPVY+PP +     KPPVY PP +     KPPVY+PP +     KPPVY PP +   
Sbjct: 48  EPKPPVYEPPKKEKPEPKPPVYAPPKKEKPGPKPPVYEPPKKEKPEPKPPVYTPPKKEEP 107

Query: 127 --KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPP 270
             KPPVY+PP +     KPP+Y PP +     KPPVY+PP ++ P  KPPV  PP  + P
Sbjct: 108 KPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKP 167

Query: 271 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             KPPVY+PP +KPP+Y+P   KPPVY PP
Sbjct: 168 EPKPPVYEPP-KKPPMYEPKPPKPPVYTPP 196

 Score =  137 bits (344), Expect = 5e-31
 Identities = 76/153 (49%), Positives = 97/153 (63%), Gaps = 35/153 (22%)
 Frame = +1

Query: 7   KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE----- 126
           KPPVY+PP +     KPPVY PP +     KPPVY+PP +     KPP+Y PP +     
Sbjct: 80  KPPVYEPPKKEKPEPKPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEP 139

Query: 127 KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 276
           KPPVY+PP +     KPPVY PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +
Sbjct: 140 KPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKK 198

Query: 277 K-----PPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +     PP+Y+PP +KPP+ +P   KPPVY PP
Sbjct: 199 EKPEPIPPMYEPP-KKPPMCEPKPPKPPVYTPP 230

 Score =  131 bits (330), Expect = 2e-29
 Identities = 70/140 (50%), Positives = 86/140 (61%), Gaps = 22/140 (15%)
 Frame = +1

Query: 7   KPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           KPP  KPP    KPPVY+PP ++ P  KPPV  PP  + P  KPPVY+PP ++ P  KPP
Sbjct: 38  KPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKPGPKPPVYEPPKKEKPEPKPP 97

Query: 181 VEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPP 315
           V  PP  + P  KPPVY+PP +     KPP+Y PP +     KPPVY+PP +     KPP
Sbjct: 98  VYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPP 157

Query: 316 VYKPPVE-----KPPVYKPP 360
           VY PP +     KPPVY+PP
Sbjct: 158 VYTPPKKEKPEPKPPVYEPP 177

 Score =  127 bits (318), Expect = 5e-28
 Identities = 72/162 (44%), Positives = 96/162 (59%), Gaps = 43/162 (26%)
 Frame = +1

Query: 1   QEKPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE--- 126
           + KPPVY PP +     KPPVY+PP +     KPP+Y PP +     KPPVY+PP +   
Sbjct: 93  EPKPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKP 152

Query: 127 --KPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----PPVYKPP 270
             KPPVY PP +     KPPVY+PP +KPP+Y+P   KPPVY PP ++     PP+Y+PP
Sbjct: 153 EPKPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPIPPMYEPP 211

Query: 271 VEKPPVYKPPVEKPPVYKPP-------------VEKPPVYKP 357
            +KPP+ +P   KPPVY PP             + +P +Y+P
Sbjct: 212 -KKPPMCEPKPPKPPVYTPPKKEKSDPSQPCINLPQPTIYEP 252

 Score =  114 bits (285), Expect = 3e-24
 Identities = 62/126 (49%), Positives = 75/126 (59%), Gaps = 17/126 (13%)
 Frame = +1

Query: 34  EKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-----KP 192
           E P   KPP    P +KPP  KPP Y  KPPV +PP  + P  KPPVY PP +     KP
Sbjct: 25  ESPNYGKPPT---PEFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKPGPKP 81

Query: 193 PVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
           PVY+PP +     KPPVY PP +     KPPVY+PP ++ P  KPP+  PP  + P  KP
Sbjct: 82  PVYEPPKKEKPEPKPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKP 141

Query: 343 PVYKPP 360
           PVY+PP
Sbjct: 142 PVYEPP 147

[38][TOP]
>UniRef100_Q9FEW3 Putative repetitive proline-rich protein n=1 Tax=Medicago
           truncatula RepID=Q9FEW3_MEDTR
          Length = 174

 Score =  137 bits (344), Expect = 5e-31
 Identities = 63/119 (52%), Positives = 80/119 (67%), Gaps = 3/119 (2%)
 Frame = +1

Query: 13  PVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PVY PP+ KPP  YKPP++K P+ K P +KP + KPP+ KPP  +PP  K P+  PP +K
Sbjct: 51  PVYNPPIYKPPPTYKPPIKKQPINKSPNKKPLLLKPPLPKPPHKEPPSRKRPINTPPDKK 110

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPP 360
           PP+ KPP  KPP  KPP  K P+  PP +KPP+ KPPV KPP  KP  ++PP Y  +PP
Sbjct: 111 PPLLKPPFPKPPQKKPPSRKRPINTPPNKKPPLPKPPVNKPPHKKPSNKRPPPYGNQPP 169

 Score =  134 bits (338), Expect = 2e-30
 Identities = 62/120 (51%), Positives = 78/120 (65%), Gaps = 5/120 (4%)
 Frame = +1

Query: 13  PVYKPPVEK----PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           P+Y  P+ K     PVY PP+ KPP  YKPP++K P+ K P +KP + KPP+ KPP  +P
Sbjct: 37  PIYTTPIHKNPTNTPVYNPPIYKPPPTYKPPIKKQPINKSPNKKPLLLKPPLPKPPHKEP 96

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P  K P+  PP +KPP+ KPP  KPP  KPP  K P+  PP +KPP+ KPPV KPP  KP
Sbjct: 97  PSRKRPINTPPDKKPPLLKPPFPKPPQKKPPSRKRPINTPPNKKPPLPKPPVNKPPHKKP 156

 Score =  127 bits (318), Expect = 5e-28
 Identities = 57/109 (52%), Positives = 73/109 (66%), Gaps = 2/109 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKPP++K P+ K P +KP + KPP+ KPP  +PP  K P+  PP +KPP+ KPP  K
Sbjct: 61  PPTYKPPIKKQPINKSPNKKPLLLKPPLPKPPHKEPPSRKRPINTPPDKKPPLLKPPFPK 120

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPP 330
           PP  KPP  K P+  PP +KPP+ KPPV KPP  KP  ++PP Y  +PP
Sbjct: 121 PPQKKPPSRKRPINTPPNKKPPLPKPPVNKPPHKKPSNKRPPPYGNQPP 169

 Score =  115 bits (289), Expect = 1e-24
 Identities = 55/119 (46%), Positives = 71/119 (59%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           +K P +  P    P+Y  P+ K P    PV  PP+YKPP    P YKPP++K P+ K P 
Sbjct: 26  DKSPSHNMPPN--PIYTTPIHKNPT-NTPVYNPPIYKPP----PTYKPPIKKQPINKSPN 78

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +KP + KPP+ KPP  +PP  K P+  PP +KPP+ KPP  KPP  KPP  K P+  PP
Sbjct: 79  KKPLLLKPPLPKPPHKEPPSRKRPINTPPDKKPPLLKPPFPKPPQKKPPSRKRPINTPP 137

 Score =  102 bits (254), Expect = 1e-20
 Identities = 47/91 (51%), Positives = 60/91 (65%), Gaps = 2/91 (2%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           +KP + KPP+ KPP  +PP  K P+  PP +KPP+ KPP  KPP  KPP  K P+  PP 
Sbjct: 79  KKPLLLKPPLPKPPHKEPPSRKRPINTPPDKKPPLLKPPFPKPPQKKPPSRKRPINTPPN 138

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVY--KPP 270
           +KPP+ KPPV KPP  KP  ++PP Y  +PP
Sbjct: 139 KKPPLPKPPVNKPPHKKPSNKRPPPYGNQPP 169

[39][TOP]
>UniRef100_UPI0001AF2AEF putative secreted protein n=1 Tax=Streptomyces roseosporus NRRL
           11379 RepID=UPI0001AF2AEF
          Length = 227

 Score =  135 bits (341), Expect = 1e-30
 Identities = 59/106 (55%), Positives = 85/106 (80%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           P  E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 75  PKHEHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 133

Query: 205 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
           PPV++PPV +PPV++PPV +PPV++PPV +PP + P    P  + P
Sbjct: 134 PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTP 179

 Score =  135 bits (340), Expect = 1e-30
 Identities = 60/116 (51%), Positives = 87/116 (75%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV
Sbjct: 78  EHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPV 136

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           ++PPV +PPV++PPV +PPV++PPV +PP + P    P  + P    P    P  +
Sbjct: 137 DEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTPDAH 192

 Score =  134 bits (337), Expect = 3e-30
 Identities = 58/101 (57%), Positives = 83/101 (82%)
 Frame = +1

Query: 55  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 234
           P  E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 75  PKHEHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 133

Query: 235 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PPV++PPV +PPV++PPV +PPV++PPV +PP + P    P
Sbjct: 134 PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTP 174

 Score =  132 bits (333), Expect = 9e-30
 Identities = 55/100 (55%), Positives = 82/100 (82%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P ++ P  KPPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++P
Sbjct: 75  PKHEHPPVKPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEP 134

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 312
           PV +PPV++PPV +PPV++PPV +PPV++PP   P  + P
Sbjct: 135 PVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTP 174

 Score =  130 bits (328), Expect = 3e-29
 Identities = 56/92 (60%), Positives = 80/92 (86%)
 Frame = +1

Query: 85  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 264
           P  E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 75  PKHEHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 133

Query: 265 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV++PPV +PPV++PPV +PPV++PPV +PP
Sbjct: 134 PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 165

[40][TOP]
>UniRef100_UPI0001AECDFF putative secreted protein n=1 Tax=Streptomyces roseosporus NRRL
           15998 RepID=UPI0001AECDFF
          Length = 207

 Score =  135 bits (341), Expect = 1e-30
 Identities = 59/106 (55%), Positives = 85/106 (80%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           P  E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 75  PKHEHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 133

Query: 205 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
           PPV++PPV +PPV++PPV +PPV++PPV +PP + P    P  + P
Sbjct: 134 PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTP 179

 Score =  135 bits (340), Expect = 1e-30
 Identities = 60/116 (51%), Positives = 87/116 (75%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV
Sbjct: 78  EHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPV 136

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           ++PPV +PPV++PPV +PPV++PPV +PP + P    P  + P    P    P  +
Sbjct: 137 DEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTPDAH 192

 Score =  134 bits (337), Expect = 3e-30
 Identities = 58/101 (57%), Positives = 83/101 (82%)
 Frame = +1

Query: 55  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 234
           P  E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 75  PKHEHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 133

Query: 235 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PPV++PPV +PPV++PPV +PPV++PPV +PP + P    P
Sbjct: 134 PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTP 174

 Score =  132 bits (333), Expect = 9e-30
 Identities = 55/100 (55%), Positives = 82/100 (82%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P ++ P  KPPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++P
Sbjct: 75  PKHEHPPVKPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEP 134

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 312
           PV +PPV++PPV +PPV++PPV +PPV++PP   P  + P
Sbjct: 135 PVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTP 174

 Score =  130 bits (328), Expect = 3e-29
 Identities = 56/92 (60%), Positives = 80/92 (86%)
 Frame = +1

Query: 85  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 264
           P  E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 75  PKHEHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 133

Query: 265 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV++PPV +PPV++PPV +PPV++PPV +PP
Sbjct: 134 PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 165

[41][TOP]
>UniRef100_O49870 Extensin (Fragment) n=1 Tax=Hordeum vulgare RepID=O49870_HORVU
          Length = 330

 Score =  135 bits (339), Expect = 2e-30
 Identities = 60/125 (48%), Positives = 65/125 (52%), Gaps = 8/125 (6%)
 Frame = +1

Query: 10  PPVYKP--------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 165
           PP YKP        P   PP YKPP   PP  KPP   PP YKPP   PP +KPP   PP
Sbjct: 196 PPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPP 255

Query: 166 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
            +KP    PP +KPP   PP +K P    P YKPP   PP  KPP   P  +KPP   PP
Sbjct: 256 AHKPATPTPPAHKPPTPTPPAHK-PTTPTPAYKPPTPTPPADKPPTPTPLAHKPPTPTPP 314

Query: 346 VYKPP 360
            YK P
Sbjct: 315 AYKAP 319

 Score =  133 bits (335), Expect = 5e-30
 Identities = 56/112 (50%), Positives = 61/112 (54%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKPP   PP  KPP   PP YKPP   PP +KPP   PP +KP    PP +KPP   
Sbjct: 214 PPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPPTPT 273

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           PP +K P    P YKPP   PP  KPP   P  +KPP   PP YK P   PP
Sbjct: 274 PPAHK-PTTPTPAYKPPTPTPPADKPPTPTPLAHKPPTPTPPAYKAPTPSPP 324

 Score =  132 bits (332), Expect = 1e-29
 Identities = 66/137 (48%), Positives = 69/137 (50%), Gaps = 20/137 (14%)
 Frame = +1

Query: 10  PPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP--------PVEKPPVYKPPVE 156
           PP YKP P   PP YKP P   PP YKP P   PP YKP        P   PP YKPP  
Sbjct: 163 PPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTP 222

Query: 157 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-------- 312
            PP  KPP   PP YKPP   PP +KPP   PP +KP    PP +KPP   P        
Sbjct: 223 TPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPPTPTPPAHKPTTP 282

Query: 313 -PVYKPPVEKPPVYKPP 360
            P YKPP   PP  KPP
Sbjct: 283 TPAYKPPTPTPPADKPP 299

 Score =  130 bits (326), Expect = 6e-29
 Identities = 68/130 (52%), Positives = 70/130 (53%), Gaps = 14/130 (10%)
 Frame = +1

Query: 10  PPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYK 174
           PP YKP P   PP YKP P   PP YKP P   PP YKP P   PP YKP P   PP YK
Sbjct: 130 PPAYKPAPKVSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYK 189

Query: 175 P-PVEKPPVYKP--------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 327
           P P   PP YKP        P   PP YKPP   PP  KPP   PP YKPP   PP +KP
Sbjct: 190 PAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKP 249

Query: 328 PVEKPPVYKP 357
           P   PP +KP
Sbjct: 250 PTPTPPAHKP 259

 Score =  129 bits (324), Expect = 1e-28
 Identities = 70/132 (53%), Positives = 71/132 (53%), Gaps = 15/132 (11%)
 Frame = +1

Query: 10  PPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYK 174
           PP YKP P   PP YKP P   PP YKP P   PP YKP P   PP YKP P   PP YK
Sbjct: 119 PPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYK 178

Query: 175 P-PVEKPPVYKP-PVEKPPVYKP--------PVEKPPVYKPPVEKPPVYKPPVEKPPVYK 324
           P P   PP YKP P   PP YKP        P   PP YKPP   PP  KPP   PP YK
Sbjct: 179 PAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYK 238

Query: 325 PPVEKPPVYKPP 360
           PP   PP +KPP
Sbjct: 239 PPTPTPPAHKPP 250

 Score =  104 bits (260), Expect = 3e-21
 Identities = 64/134 (47%), Positives = 67/134 (50%), Gaps = 16/134 (11%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKP------PVYKPPVEK 159
           EKPP    P       KPPV  + PP Y PP  KP    PP  KP      P+ KPP   
Sbjct: 27  EKPPKGHKPPHHHHHAKPPVGSQAPPTYSPPTAKPT---PPAPKPAPPTYAPIPKPPKPS 83

Query: 160 PPVYKP-PVEKPPVYKPPVE---KPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPV 318
           PP Y P P   PP YKPP +    PP YKP P   PP YKP P   PP YKP P   PP 
Sbjct: 84  PPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPA 143

Query: 319 YKP-PVEKPPVYKP 357
           YKP P   PP YKP
Sbjct: 144 YKPAPKVSPPAYKP 157

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 63/136 (46%), Positives = 67/136 (49%), Gaps = 20/136 (14%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPV-EKPPVY----KPPV--EKPPVYKPPVEKPPVYKPPVEKP-- 162
           PP   P    P   KPP   KPP +    KPPV  + PP Y PP  KP    PP  KP  
Sbjct: 14  PPSPTPISPAPKHEKPPKGHKPPHHHHHAKPPVGSQAPPTYSPPTAKPT---PPAPKPAP 70

Query: 163 ----PVYKPPVEKPPVYKP-PVEKPPVYKPPVE---KPPVYKP-PVEKPPVYKP-PVEKP 312
               P+ KPP   PP Y P P   PP YKPP +    PP YKP P   PP YKP P   P
Sbjct: 71  PTYAPIPKPPKPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSP 130

Query: 313 PVYKP-PVEKPPVYKP 357
           P YKP P   PP YKP
Sbjct: 131 PAYKPAPKVSPPAYKP 146

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 42/87 (48%), Positives = 43/87 (49%), Gaps = 4/87 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP----PVYKPPVEKPPVYK 174
           KPP   PP  KPP   PP  KP    PP  KPP   PP  KP    P YKPP   PP  K
Sbjct: 238 KPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPPTPTPPAHKPTTPTPAYKPPTPTPPADK 297

Query: 175 PPVEKPPVYKPPVEKPPVYKPPVEKPP 255
           PP   P  +KPP   PP YK P   PP
Sbjct: 298 PPTPTPLAHKPPTPTPPAYKAPTPSPP 324

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 40/104 (38%), Positives = 42/104 (40%), Gaps = 2/104 (1%)
 Frame = +1

Query: 55  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPPV 228
           PP   P    P  EKPP    P       KPPV  + PP Y PP  KP    PP  KP  
Sbjct: 14  PPSPTPISPAPKHEKPPKGHKPPHHHHHAKPPVGSQAPPTYSPPTAKPT---PPAPKPA- 69

Query: 229 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
              P    P+ KPP   PP Y P     P   PP  KPP    P
Sbjct: 70  ---PPTYAPIPKPPKPSPPAYHPT----PKPAPPTYKPPTQPKP 106

[42][TOP]
>UniRef100_B1VVM2 Putative secreted protein n=1 Tax=Streptomyces griseus subsp.
           griseus NBRC 13350 RepID=B1VVM2_STRGG
          Length = 231

 Score =  134 bits (336), Expect = 4e-30
 Identities = 55/109 (50%), Positives = 83/109 (76%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           PP++ PP+  PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 88  PPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 147

Query: 205 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           PPV++PPV +PPV++PPV +PPV++PP   P  + P    P    P  +
Sbjct: 148 PPVDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTPGSGTPGSNTPDAH 196

 Score =  132 bits (333), Expect = 9e-30
 Identities = 54/101 (53%), Positives = 81/101 (80%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           P  + PP+  PP++ PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 83  PKHDHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 142

Query: 205 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 327
           PPV++PPV +PPV++PPV +PPV++PPV +PP + P    P
Sbjct: 143 PPVDEPPVDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTP 183

 Score =  132 bits (333), Expect = 9e-30
 Identities = 54/101 (53%), Positives = 81/101 (80%)
 Frame = +1

Query: 55  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 234
           P  + PP+  PP++ PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 83  PKHDHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 142

Query: 235 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PPV++PPV +PPV++PPV +PPV++PPV +PP + P    P
Sbjct: 143 PPVDEPPVDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTP 183

 Score =  131 bits (330), Expect = 2e-29
 Identities = 53/98 (54%), Positives = 80/98 (81%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           + PP+  PP++ PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV
Sbjct: 86  DHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPV 145

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 297
           ++PPV +PPV++PPV +PPV++PPV +PP + P    P
Sbjct: 146 DEPPVDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTP 183

 Score =  129 bits (324), Expect = 1e-28
 Identities = 52/92 (56%), Positives = 78/92 (84%)
 Frame = +1

Query: 85  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 264
           P  + PP+  PP++ PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 83  PKHDHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 142

Query: 265 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV++PPV +PPV++PPV +PPV++PPV +PP
Sbjct: 143 PPVDEPPVDQPPVDEPPVDQPPVDEPPVDQPP 174

 Score =  127 bits (319), Expect = 4e-28
 Identities = 53/106 (50%), Positives = 80/106 (75%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           + PP+  PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV
Sbjct: 91  DHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPV 150

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 321
           ++PPV +PPV++PPV +PPV++PP   P  + P    P    P  +
Sbjct: 151 DQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTPGSGTPGSNTPDAH 196

[43][TOP]
>UniRef100_B5UN98 Cell surface protein n=1 Tax=Bacillus cereus AH1134
           RepID=B5UN98_BACCE
          Length = 814

 Score =  133 bits (334), Expect = 7e-30
 Identities = 68/114 (59%), Positives = 71/114 (62%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           +++P V KP  EKP V KP  EKP V KP  EKP V KP  EKP V KP  EKP V KP 
Sbjct: 321 EKQPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPE 380

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
            EKP V KP  EKP   KP  EKP   KP VEKP V KP VEKP V KP VEKP
Sbjct: 381 AEKPEVEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKPEVEKP 434

 Score =  132 bits (331), Expect = 2e-29
 Identities = 68/112 (60%), Positives = 69/112 (61%)
 Frame = +1

Query: 22  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 201
           +P VEKP   KP VEKP   KP VEKP   KP VEKP   KP VEKP   KP VEKP   
Sbjct: 323 QPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAE 382

Query: 202 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           KP VEKP   KP  EKP   KP  EKP V KP VEKP V KP VEKP V KP
Sbjct: 383 KPEVEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKPEVEKP 434

 Score =  129 bits (324), Expect = 1e-28
 Identities = 67/111 (60%), Positives = 67/111 (60%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EKP   KP VEKP   KP VEKP   KP VEKP   KP VEKP   KP VEKP   KP V
Sbjct: 327 EKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEV 386

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
           EKP   KP  EKP   KP  EKP V KP VEKP V KP VEKP V KP  E
Sbjct: 387 EKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKPEVEKPDAE 437

 Score =  126 bits (317), Expect = 7e-28
 Identities = 67/119 (56%), Positives = 70/119 (58%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           Q+K    K   ++P V KP  EKP V KP  EKP V KP  EKP V KP  EKP V KP 
Sbjct: 311 QDKLEQIKNEEKQPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPE 370

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            EKP V KP  EKP V KP  EKP   KP  EKP   KP VEKP V KP VEKP V KP
Sbjct: 371 AEKPEVEKPEAEKPEVEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKP 429

[44][TOP]
>UniRef100_Q25434 Adhesive plaque matrix protein n=1 Tax=Mytilus coruscus
           RepID=FP1_MYTCO
          Length = 872

 Score =  132 bits (332), Expect = 1e-29
 Identities = 59/126 (46%), Positives = 64/126 (50%), Gaps = 10/126 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YKP     P YKP +  PP YKP    PP YKP    
Sbjct: 349 PPTYKPKITYPPTYKPKPSYPPSYKPKKTYSPTYKPKITYPPTYKPKPSYPPSYKPKTTY 408

Query: 190 PPVYKPPVEKPPVYKPPVE----------KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           PP YKP +  PP YKP              PP YKP +  PP YKP    PP YKP +  
Sbjct: 409 PPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKITY 468

Query: 340 PPVYKP 357
           PP YKP
Sbjct: 469 PPTYKP 474

 Score =  131 bits (330), Expect = 2e-29
 Identities = 62/146 (42%), Positives = 68/146 (46%), Gaps = 30/146 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 174
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YKP +  PP YK     
Sbjct: 439 PPTYKPKISYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKPKITYPPTYKRKPSY 498

Query: 175 ----------PPVEK---------------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 279
                     PP+ K               PP YKP +  PP YKP    PP YKP    
Sbjct: 499 PTPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKTTY 558

Query: 280 PPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP +  PP YKP    PP YKP
Sbjct: 559 PPTYKPKIRYPPTYKPKASYPPTYKP 584

 Score =  131 bits (329), Expect = 3e-29
 Identities = 62/146 (42%), Positives = 68/146 (46%), Gaps = 30/146 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--------------- 144
           PP YKP    PP YKP +  PP YKP    PP YKP +  PP YK               
Sbjct: 449 PPTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKPKITYPPTYKRKPSYPTPYKQKPSY 508

Query: 145 PPVEK---------------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 279
           PP+ K               PP YKP +  PP YKP    PP YKP    PP YKP +  
Sbjct: 509 PPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRY 568

Query: 280 PPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP    PP YKP +  PP YKP
Sbjct: 569 PPTYKPKASYPPTYKPKITYPPTYKP 594

 Score =  129 bits (325), Expect = 8e-29
 Identities = 58/125 (46%), Positives = 63/125 (50%), Gaps = 10/125 (8%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE- 186
           PP YKP     P YKP +  PP YKP    PP YKP    PP YKP +  PP YKP    
Sbjct: 369 PPSYKPKKTYSPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKPKASY 428

Query: 187 ---------KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
                     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YKP +  
Sbjct: 429 VSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKPKITY 488

Query: 340 PPVYK 354
           PP YK
Sbjct: 489 PPTYK 493

 Score =  129 bits (324), Expect = 1e-28
 Identities = 60/136 (44%), Positives = 67/136 (49%), Gaps = 20/136 (14%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YKP    PP YKP +  PP YKP    PP YKP +  
Sbjct: 529 PPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRYPPTYKPKASYPPTYKPKITY 588

Query: 190 PPVYKPPVEKPPVYK-----PPVEK---------------PPVYKPPVEKPPVYKPPVEK 309
           PP YKP    P  YK     PP+ K               PP YKP +  PP YKP    
Sbjct: 589 PPTYKPKPSYPTPYKQKPSYPPIYKSKSSYPTAYKSKKTYPPTYKPKITYPPTYKPKPSY 648

Query: 310 PPVYKPPVEKPPVYKP 357
           PP Y+P +  PP YKP
Sbjct: 649 PPSYRPKITYPPTYKP 664

 Score =  127 bits (318), Expect = 5e-28
 Identities = 61/136 (44%), Positives = 66/136 (48%), Gaps = 20/136 (14%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YKP V  PP YKP    PP YKP +  PP YKP    
Sbjct: 259 PPTYKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKPKPSYPPTYKPKITYPPTYKPKPSY 318

Query: 190 PPVYK-----PPVEK---------------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 309
           P  YK     PP+ K               PP YKP +  PP YKP    PP YKP    
Sbjct: 319 PTPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKKTY 378

Query: 310 PPVYKPPVEKPPVYKP 357
            P YKP +  PP YKP
Sbjct: 379 SPTYKPKITYPPTYKP 394

 Score =  126 bits (317), Expect = 7e-28
 Identities = 62/146 (42%), Positives = 67/146 (45%), Gaps = 30/146 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---------------PVEK----- 129
           PP YKP V  PP YKP    PP YKP +  PP YKP               P+ K     
Sbjct: 279 PPTYKPKVTYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSY 338

Query: 130 ----------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 279
                     PP YKP +  PP YKP    PP YKP     P YKP +  PP YKP    
Sbjct: 339 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKKTYSPTYKPKITYPPTYKPKPSY 398

Query: 280 PPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP    PP YKP +  PP YKP
Sbjct: 399 PPSYKPKTTYPPTYKPKISYPPTYKP 424

 Score =  123 bits (309), Expect = 6e-27
 Identities = 57/126 (45%), Positives = 61/126 (48%), Gaps = 10/126 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YKP +  PP YKP    PP YKP     P YKP +  PP YKP    
Sbjct: 339 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKKTYSPTYKPKITYPPTYKPKPSY 398

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVE----------KPPVYKPPVEKPPVYKPPVEK 339
           PP YKP    PP YKP +  PP YKP              PP YKP +  PP YKP    
Sbjct: 399 PPSYKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSY 458

Query: 340 PPVYKP 357
           PP YKP
Sbjct: 459 PPTYKP 464

 Score =  123 bits (309), Expect = 6e-27
 Identities = 62/156 (39%), Positives = 68/156 (43%), Gaps = 40/156 (25%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE----------KPPVYKPPVEK 159
           PP YKP    PP YKP    PP YKP +  PP YKP              PP YKP +  
Sbjct: 389 PPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISY 448

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--------------- 294
           PP YKP    PP YKP +  PP YKP    PP YKP +  PP YK               
Sbjct: 449 PPTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKPKITYPPTYKRKPSYPTPYKQKPSY 508

Query: 295 PPVEK---------------PPVYKPPVEKPPVYKP 357
           PP+ K               PP YKP +  PP YKP
Sbjct: 509 PPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKP 544

 Score =  122 bits (305), Expect = 2e-26
 Identities = 55/116 (47%), Positives = 60/116 (51%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YK      P YKP    PP YKP +  P +YKP       YK     
Sbjct: 200 PPTYKPKITYPPTYKRKPSYTP-YKPKTTYPPTYKPKISYPSIYKPKASYVSSYKSKKTY 258

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP +  PP YKP    PP YKP V  PP YKP    PP YKP +  PP YKP
Sbjct: 259 PPTYKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKPKPSYPPTYKPKITYPPTYKP 314

 Score =  121 bits (304), Expect = 2e-26
 Identities = 61/146 (41%), Positives = 67/146 (45%), Gaps = 30/146 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVE----------KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 159
           PP YKP +  P +YKP              PP YKP +  PP YKP    PP YKP V  
Sbjct: 229 PPTYKPKISYPSIYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKVTY 288

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK--------------- 279
           PP YKP    PP YKP +  PP YKP    P  YK     PP+ K               
Sbjct: 289 PPTYKPKPSYPPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSYPTSYKSKKTY 348

Query: 280 PPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP +  PP YKP    PP YKP
Sbjct: 349 PPTYKPKITYPPTYKPKPSYPPSYKP 374

 Score =  121 bits (304), Expect = 2e-26
 Identities = 56/126 (44%), Positives = 61/126 (48%), Gaps = 10/126 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+YK     P  YK     PP YKP +  PP YKP    PP YKP     P YKP +  
Sbjct: 329 PPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKKTYSPTYKPKITY 388

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE----------KPPVYKPPVEK 339
           PP YKP    PP YKP    PP YKP +  PP YKP              PP YKP +  
Sbjct: 389 PPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISY 448

Query: 340 PPVYKP 357
           PP YKP
Sbjct: 449 PPTYKP 454

 Score =  121 bits (303), Expect = 3e-26
 Identities = 59/145 (40%), Positives = 65/145 (44%), Gaps = 30/145 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK---------------PPVEK--------------- 99
           PP YKP    PP YKP +  PP YK               PP+ K               
Sbjct: 469 PPTYKPKPSYPPTYKPKITYPPTYKRKPSYPTPYKQKPSYPPIYKSKSSYPTSYKSKKTY 528

Query: 100 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 279
           PP YKP +  PP YKP    PP YKP    PP YKP +  PP YKP    PP YKP +  
Sbjct: 529 PPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRYPPTYKPKASYPPTYKPKITY 588

Query: 280 PPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP    P  YK     PP+YK
Sbjct: 589 PPTYKPKPSYPTPYKQKPSYPPIYK 613

 Score =  120 bits (302), Expect = 4e-26
 Identities = 52/116 (44%), Positives = 59/116 (50%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP YKP       YKP +  PP YKP       YKP +  PP YKP       YKP +  
Sbjct: 749  PPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRY 808

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            PP YKP       YKP +  PP YKP +  PP YKP +  PP YKP +  PP YKP
Sbjct: 809  PPTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPTYKPKISYPPAYKP 864

 Score =  120 bits (301), Expect = 5e-26
 Identities = 64/166 (38%), Positives = 70/166 (42%), Gaps = 50/166 (30%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKP---------------PVEKP-----PVYKPPVEKPPVYKPPVEK 129
           PP YKP +  PP YKP               P  KP     P YKP    PP YKP +  
Sbjct: 409 PPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKITY 468

Query: 130 PPVYKPPVEKPPVYKPPVEKPPVYK---------------PPVEK--------------- 219
           PP YKP    PP YKP +  PP YK               PP+ K               
Sbjct: 469 PPTYKPKPSYPPTYKPKITYPPTYKRKPSYPTPYKQKPSYPPIYKSKSSYPTSYKSKKTY 528

Query: 220 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP +  PP YKP    PP YKP    PP YKP +  PP YKP
Sbjct: 529 PPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRYPPTYKP 574

 Score =  120 bits (301), Expect = 5e-26
 Identities = 58/136 (42%), Positives = 64/136 (47%), Gaps = 20/136 (14%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+YK     P  YK     PP YKP +  PP YKP    PP YKP    PP YKP +  
Sbjct: 509 PPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRY 568

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK--------------- 309
           PP YKP    PP YKP +  PP YKP    P  YK     PP+ K               
Sbjct: 569 PPTYKPKASYPPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSYPTAYKSKKTY 628

Query: 310 PPVYKPPVEKPPVYKP 357
           PP YKP +  PP YKP
Sbjct: 629 PPTYKPKITYPPTYKP 644

 Score =  120 bits (300), Expect = 6e-26
 Identities = 52/115 (45%), Positives = 58/115 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YKP +  PP YKP    P  YK     PP+YK     
Sbjct: 559 PPTYKPKIRYPPTYKPKASYPPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSY 618

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  YK     PP YKP +  PP YKP    PP Y+P +  PP YKP    P  YK
Sbjct: 619 PTAYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSYPQAYK 673

 Score =  117 bits (294), Expect = 3e-25
 Identities = 52/112 (46%), Positives = 57/112 (50%)
 Frame = +1

Query: 19  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 198
           YKP    PP YKP +  P +YKP       YK     PP YKP +  PP YKP    PP 
Sbjct: 222 YKPKTTYPPTYKPKISYPSIYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPT 281

Query: 199 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           YKP V  PP YKP    PP YKP +  PP YKP    P  YK     PP+YK
Sbjct: 282 YKPKVTYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYK 333

 Score =  117 bits (293), Expect = 4e-25
 Identities = 60/146 (41%), Positives = 65/146 (44%), Gaps = 30/146 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK---------------PPVYKPPVEK 129
           PP YKP +  PP YKP    P  YK     PP+ K               PP YKP +  
Sbjct: 299 PPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITY 358

Query: 130 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 309
           PP YKP    PP YKP     P YKP +  PP YKP    PP YKP    PP YKP +  
Sbjct: 359 PPTYKPKPSYPPSYKPKKTYSPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKISY 418

Query: 310 PPVYKPPVE----------KPPVYKP 357
           PP YKP              PP YKP
Sbjct: 419 PPTYKPKASYVSSYKSKKTYPPTYKP 444

 Score =  115 bits (289), Expect = 1e-24
 Identities = 62/164 (37%), Positives = 66/164 (40%), Gaps = 48/164 (29%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---------PPVEKP 162
           PP YKP +  PP YK     PP YKP    PP YKP +  PP YK         P    P
Sbjct: 141 PPTYKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKPKITYPPTYKRKPSYTPYKPKATYP 200

Query: 163 PVYKPPVEKPPVYK--------------PPVEKP-------------------------P 225
           P YKP +  PP YK              PP  KP                         P
Sbjct: 201 PTYKPKITYPPTYKRKPSYTPYKPKTTYPPTYKPKISYPSIYKPKASYVSSYKSKKTYPP 260

Query: 226 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            YKP +  PP YKP    PP YKP V  PP YKP    PP YKP
Sbjct: 261 TYKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKPKPSYPPTYKP 304

 Score =  115 bits (289), Expect = 1e-24
 Identities = 57/136 (41%), Positives = 63/136 (46%), Gaps = 20/136 (14%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK--------------- 129
           PP YKP    PP YKP +  PP YKP    P  YK     PP+ K               
Sbjct: 569 PPTYKPKASYPPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSYPTAYKSKKTY 628

Query: 130 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 309
           PP YKP +  PP YKP    PP Y+P +  PP YKP    P  YK     PP Y+P    
Sbjct: 629 PPTYKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSYPQAYKSKGSYPPSYQPKKTY 688

Query: 310 PPVYKPPVEKPPVYKP 357
           PP YKP    PP YKP
Sbjct: 689 PPSYKPKKTYPPTYKP 704

 Score =  115 bits (289), Expect = 1e-24
 Identities = 49/111 (44%), Positives = 57/111 (51%)
 Frame = +1

Query: 19   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 198
            YKP +  PP YKP       YKP +  PP YKP       YKP +  PP YKP       
Sbjct: 762  YKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASS 821

Query: 199  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
            YKP +  PP YKP +  PP YKP +  PP YKP +  PP YKP +  P  Y
Sbjct: 822  YKPKITYPPTYKPKISYPPTYKPKITYPPTYKPKISYPPAYKPKISYPSQY 872

 Score =  115 bits (287), Expect = 2e-24
 Identities = 51/115 (44%), Positives = 57/115 (49%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP Y+P +  PP YKP    P  YK     PP Y+P    
Sbjct: 629 PPTYKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSYPQAYKSKGSYPPSYQPKKTY 688

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP    PP YKP +  PP YK     P  YK     PP YKP +  P  YK
Sbjct: 689 PPSYKPKKTYPPTYKPKISYPPTYKTKPSYPASYKRKTSYPPTYKPKISYPSTYK 743

 Score =  113 bits (282), Expect = 8e-24
 Identities = 61/164 (37%), Positives = 66/164 (40%), Gaps = 48/164 (29%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 174
           PP YK  +  PP YKP +  PP YK     PP YKP    PP YKP +  PP YK     
Sbjct: 131 PPSYKHKITYPPTYKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKPKITYPPTYKRKPSY 190

Query: 175 ----PPVEKPPVYKPPVEKPPVYK--------------PPVEKP---------------- 252
               P    PP YKP +  PP YK              PP  KP                
Sbjct: 191 TPYKPKATYPPTYKPKITYPPTYKRKPSYTPYKPKTTYPPTYKPKISYPSIYKPKASYVS 250

Query: 253 ---------PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
                    P YKP +  PP YKP    PP YKP V  PP YKP
Sbjct: 251 SYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKP 294

 Score =  113 bits (282), Expect = 8e-24
 Identities = 51/116 (43%), Positives = 56/116 (48%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP    PP Y+P +  PP YKP    P  YK     PP Y+P    PP YKP    
Sbjct: 639 PPTYKPKPSYPPSYRPKITYPPTYKPKKSYPQAYKSKGSYPPSYQPKKTYPPSYKPKKTY 698

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP +  PP YK     P  YK     PP YKP +  P  YK     PP YKP
Sbjct: 699 PPTYKPKISYPPTYKTKPSYPASYKRKTSYPPTYKPKISYPSTYKAKPSYPPTYKP 754

 Score =  112 bits (280), Expect = 1e-23
 Identities = 51/116 (43%), Positives = 56/116 (48%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YKP +  PP YKP    PP Y+P +  PP YKP    P  YK     
Sbjct: 619 PTAYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSYPQAYKSKGSY 678

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP Y+P    PP YKP    PP YKP +  PP YK     P  YK     PP YKP
Sbjct: 679 PPSYQPKKTYPPSYKPKKTYPPTYKPKISYPPTYKTKPSYPASYKRKTSYPPTYKP 734

 Score =  110 bits (275), Expect = 5e-23
 Identities = 50/115 (43%), Positives = 56/115 (48%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+YK     P  YK     PP YKP +  PP YKP    PP Y+P +  PP YKP    
Sbjct: 609 PPIYKSKSSYPTAYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSY 668

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  YK     PP Y+P    PP YKP    PP YKP +  PP YK     P  YK
Sbjct: 669 PQAYKSKGSYPPSYQPKKTYPPSYKPKKTYPPTYKPKISYPPTYKTKPSYPASYK 723

 Score =  110 bits (274), Expect = 6e-23
 Identities = 53/125 (42%), Positives = 61/125 (48%), Gaps = 10/125 (8%)
 Frame = +1

Query: 10  PPVYKP------PVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 159
           PP YKP      P ++    PP+YK     P  YK     PP YKP +  PP YKP    
Sbjct: 589 PPTYKPKPSYPTPYKQKPSYPPIYKSKSSYPTAYKSKKTYPPTYKPKITYPPTYKPKPSY 648

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           PP Y+P +  PP YKP    P  YK     PP Y+P    PP YKP    PP YKP +  
Sbjct: 649 PPSYRPKITYPPTYKPKKSYPQAYKSKGSYPPSYQPKKTYPPSYKPKKTYPPTYKPKISY 708

Query: 340 PPVYK 354
           PP YK
Sbjct: 709 PPTYK 713

 Score =  110 bits (274), Expect = 6e-23
 Identities = 50/116 (43%), Positives = 55/116 (47%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP Y+P    PP YKP    PP YKP +  PP YK     P  YK     PP YKP +  
Sbjct: 679  PPSYQPKKTYPPSYKPKKTYPPTYKPKISYPPTYKTKPSYPASYKRKTSYPPTYKPKISY 738

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            P  YK     PP YKP       YKP +  PP YKP       YKP +  PP YKP
Sbjct: 739  PSTYKAKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKP 794

 Score =  108 bits (271), Expect = 1e-22
 Identities = 49/116 (42%), Positives = 54/116 (46%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP YKP +  PP YK     P  YK     PP YKP +  P  YK     PP YKP    
Sbjct: 699  PPTYKPKISYPPTYKTKPSYPASYKRKTSYPPTYKPKISYPSTYKAKPSYPPTYKPKPSY 758

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
               YKP +  PP YKP       YKP +  PP YKP       YKP +  PP YKP
Sbjct: 759  ASSYKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKP 814

 Score =  108 bits (270), Expect = 2e-22
 Identities = 50/116 (43%), Positives = 54/116 (46%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP YKP    P  YK     PP Y+P    PP YKP    PP YKP +  PP YK     
Sbjct: 659  PPTYKPKKSYPQAYKSKGSYPPSYQPKKTYPPSYKPKKTYPPTYKPKISYPPTYKTKPSY 718

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            P  YK     PP YKP +  P  YK     PP YKP       YKP +  PP YKP
Sbjct: 719  PASYKRKTSYPPTYKPKISYPSTYKAKPSYPPTYKPKPSYASSYKPKIRYPPTYKP 774

 Score =  108 bits (270), Expect = 2e-22
 Identities = 46/104 (44%), Positives = 53/104 (50%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP YKP       YKP +  PP YKP       YKP +  PP YKP       YKP +  
Sbjct: 769  PPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKITY 828

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 321
            PP YKP +  PP YKP +  PP YKP +  PP YKP +  P  Y
Sbjct: 829  PPTYKPKISYPPTYKPKITYPPTYKPKISYPPAYKPKISYPSQY 872

 Score =  100 bits (250), Expect = 4e-20
 Identities = 57/145 (39%), Positives = 64/145 (44%), Gaps = 29/145 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKP----------PVYKPPVEKPPVYK-----PPVEKPPVYKPPVEK----- 129
           PP+YKP  +K           P YK     PP YK     PP  KP +  PP  K     
Sbjct: 101 PPIYKPIAKKLSSYKAIKTTYPAYKAKTSYPPSYKHKITYPPTYKPKITYPPTYKQKPSY 160

Query: 130 PPVYKPPVEKPPVYKPPVEKPPV---------YKPPVEKPPVYKPPVEKPPVYKPPVEKP 282
           PP YKP    PP YKP +  PP          YKP    PP YKP +  PP YK      
Sbjct: 161 PPSYKPKTTYPPTYKPKITYPPTYKRKPSYTPYKPKATYPPTYKPKITYPPTYKRKPSYT 220

Query: 283 PVYKPPVEKPPVYKPPVEKPPVYKP 357
           P YKP    PP YKP +  P +YKP
Sbjct: 221 P-YKPKTTYPPTYKPKISYPSIYKP 244

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 50/126 (39%), Positives = 55/126 (43%), Gaps = 9/126 (7%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KP  Y P     P Y      PP+YKP  +K   YK      P YK     PP YK  + 
Sbjct: 80  KPKGYYPTKRYQPTYGSKTNYPPIYKPIAKKLSSYKAIKTTYPAYKAKTSYPPSYKHKIT 139

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV---------YKPPVEK 339
            PP YKP +  PP YK     PP YKP    PP YKP +  PP          YKP    
Sbjct: 140 YPPTYKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKPKITYPPTYKRKPSYTPYKPKATY 199

Query: 340 PPVYKP 357
           PP YKP
Sbjct: 200 PPTYKP 205

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 54/158 (34%), Positives = 61/158 (38%), Gaps = 44/158 (27%)
 Frame = +1

Query: 13  PVYKPPVEKP-------------------------PVYKPPVEKPPVYKPPVEK------ 99
           PVYKP  + P                         P Y      PP+YKP  +K      
Sbjct: 57  PVYKPMNKIPTPYISKKSYPAPYKPKGYYPTKRYQPTYGSKTNYPPIYKPIAKKLSSYKA 116

Query: 100 ----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 267
                P YK     PP YK  +  PP YKP +  PP YK     PP YKP    PP YKP
Sbjct: 117 IKTTYPAYKAKTSYPPSYKHKITYPPTYKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKP 176

Query: 268 PVEKPPV---------YKPPVEKPPVYKPPVEKPPVYK 354
            +  PP          YKP    PP YKP +  PP YK
Sbjct: 177 KITYPPTYKRKPSYTPYKPKATYPPTYKPKITYPPTYK 214

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 40/95 (42%), Positives = 47/95 (49%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KP +  P     P YKP       YKP +  PP YKP       YKP +  PP YKP + 
Sbjct: 783  KPKIRYP-----PTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKIS 837

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 291
             PP YKP +  PP YKP +  PP YKP +  P  Y
Sbjct: 838  YPPTYKPKITYPPTYKPKISYPPAYKPKISYPSQY 872

[45][TOP]
>UniRef100_Q5XGC9-2 Isoform 2 of Serum response factor-binding protein 1 n=1
           Tax=Xenopus (Silurana) tropicalis RepID=Q5XGC9-2
          Length = 530

 Score =  132 bits (331), Expect = 2e-29
 Identities = 61/119 (51%), Positives = 83/119 (69%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P V
Sbjct: 217 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAV 276

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V  P VE+PPV  PP
Sbjct: 277 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPP 335

 Score =  128 bits (322), Expect = 2e-28
 Identities = 60/117 (51%), Positives = 81/117 (69%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P V
Sbjct: 222 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAV 281

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE P V +PPVE PP  K
Sbjct: 282 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPPKKK 338

 Score =  124 bits (312), Expect = 2e-27
 Identities = 58/115 (50%), Positives = 80/115 (69%)
 Frame = +1

Query: 16  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 195
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 216 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 275

Query: 196 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE P V +PP
Sbjct: 276 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPP 330

 Score =  119 bits (298), Expect = 1e-25
 Identities = 56/112 (50%), Positives = 77/112 (68%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P V
Sbjct: 232 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAV 291

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           E+P V +P VE+P V +P VE+P V +P VE P V +PPVE PP  K  +E+
Sbjct: 292 ERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPPKKKACLEQ 343

 Score =  103 bits (257), Expect = 6e-21
 Identities = 52/118 (44%), Positives = 74/118 (62%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E P V +   E+    K   +   V +P VE+P V +P VE+P V +P VE+P V +P V
Sbjct: 192 ELPYVQENLPEQTAENKEQPKAQDVERPAVERPAVERPAVERPAVERPAVERPAVERPAV 251

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P
Sbjct: 252 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERP 309

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 47/109 (43%), Positives = 68/109 (62%)
 Frame = +1

Query: 31  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 210
           +E P V +   E+    K   +   V +P VE+P V +P VE+P V +P VE+P V +P 
Sbjct: 191 LELPYVQENLPEQTAENKEQPKAQDVERPAVERPAVERPAVERPAVERPAVERPAVERPA 250

Query: 211 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P
Sbjct: 251 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERP 299

[46][TOP]
>UniRef100_Q5XGC9 Serum response factor-binding protein 1 n=1 Tax=Xenopus (Silurana)
           tropicalis RepID=SRFB1_XENTR
          Length = 535

 Score =  132 bits (331), Expect = 2e-29
 Identities = 61/119 (51%), Positives = 83/119 (69%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P V
Sbjct: 222 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAV 281

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V  P VE+PPV  PP
Sbjct: 282 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPP 340

 Score =  129 bits (325), Expect = 8e-29
 Identities = 60/119 (50%), Positives = 83/119 (69%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P V
Sbjct: 217 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAV 276

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE P V +PP
Sbjct: 277 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPP 335

 Score =  128 bits (322), Expect = 2e-28
 Identities = 60/117 (51%), Positives = 81/117 (69%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P V
Sbjct: 227 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAV 286

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE P V +PPVE PP  K
Sbjct: 287 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPPKKK 343

 Score =  122 bits (305), Expect = 2e-26
 Identities = 57/114 (50%), Positives = 79/114 (69%)
 Frame = +1

Query: 16  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 195
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 216 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 275

Query: 196 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V  P
Sbjct: 276 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESP 329

 Score =  119 bits (298), Expect = 1e-25
 Identities = 56/112 (50%), Positives = 77/112 (68%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P V
Sbjct: 237 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAV 296

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           E+P V +P VE+P V +P VE+P V +P VE P V +PPVE PP  K  +E+
Sbjct: 297 ERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPPKKKACLEQ 348

 Score =  103 bits (257), Expect = 6e-21
 Identities = 52/118 (44%), Positives = 74/118 (62%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E P V +   E+    K   +   V +P VE+P V +P VE+P V +P VE+P V +P V
Sbjct: 192 ELPYVQENLPEQTAENKEQPKAQDVERPAVERPAVERPAVERPAVERPAVERPAVERPAV 251

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P
Sbjct: 252 ERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERP 309

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 47/109 (43%), Positives = 68/109 (62%)
 Frame = +1

Query: 31  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 210
           +E P V +   E+    K   +   V +P VE+P V +P VE+P V +P VE+P V +P 
Sbjct: 191 LELPYVQENLPEQTAENKEQPKAQDVERPAVERPAVERPAVERPAVERPAVERPAVERPA 250

Query: 211 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P
Sbjct: 251 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERP 299

[47][TOP]
>UniRef100_UPI0000E49E3C PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus purpuratus
            RepID=UPI0000E49E3C
          Length = 1082

 Score =  130 bits (328), Expect = 3e-29
 Identities = 49/118 (41%), Positives = 73/118 (61%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ 
Sbjct: 652  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPIT 711

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP
Sbjct: 712  QPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPP 769

 Score =  130 bits (328), Expect = 3e-29
 Identities = 49/118 (41%), Positives = 73/118 (61%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  
Sbjct: 657  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPST 716

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP
Sbjct: 717  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPP 774

 Score =  128 bits (321), Expect = 2e-28
 Identities = 49/118 (41%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  
Sbjct: 502 QPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTA 561

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 562 QPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPP 619

 Score =  128 bits (321), Expect = 2e-28
 Identities = 48/118 (40%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 637 QPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 696

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP
Sbjct: 697 QPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPP 754

 Score =  128 bits (321), Expect = 2e-28
 Identities = 48/118 (40%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 642 QPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 701

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP
Sbjct: 702 QPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPP 759

 Score =  128 bits (321), Expect = 2e-28
 Identities = 48/118 (40%), Positives = 72/118 (61%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 647  RQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 706

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP
Sbjct: 707  QPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPP 764

 Score =  127 bits (319), Expect = 4e-28
 Identities = 49/117 (41%), Positives = 71/117 (60%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 493 PPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQ 552

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 553 PPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPP 609

 Score =  127 bits (319), Expect = 4e-28
 Identities = 49/118 (41%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ 
Sbjct: 497 QPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMT 556

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 557 HPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPP 614

 Score =  127 bits (319), Expect = 4e-28
 Identities = 49/118 (41%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  
Sbjct: 507 QPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTT 566

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 567 QPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPP 624

 Score =  126 bits (317), Expect = 7e-28
 Identities = 49/118 (41%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 477 QPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPST 536

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP
Sbjct: 537 QPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPP 594

 Score =  126 bits (317), Expect = 7e-28
 Identities = 49/118 (41%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 482 QPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTT 541

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP
Sbjct: 542 QPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPP 599

 Score =  126 bits (317), Expect = 7e-28
 Identities = 47/118 (39%), Positives = 72/118 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 632 QPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 691

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 692 QPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 749

 Score =  126 bits (317), Expect = 7e-28
 Identities = 48/118 (40%), Positives = 71/118 (60%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  
Sbjct: 662  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTT 721

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP    P
Sbjct: 722  QPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPPTTPVP 779

 Score =  126 bits (316), Expect = 9e-28
 Identities = 49/117 (41%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 488 PPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQ 547

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 548 PPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPP 604

 Score =  125 bits (315), Expect = 1e-27
 Identities = 49/118 (41%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 467 QPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTT 526

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP
Sbjct: 527 QPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPP 584

 Score =  125 bits (315), Expect = 1e-27
 Identities = 49/118 (41%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 472 QPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTT 531

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP
Sbjct: 532 QPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPP 589

 Score =  125 bits (313), Expect = 2e-27
 Identities = 49/118 (41%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  
Sbjct: 457 QPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTM 516

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP
Sbjct: 517 QPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPP 574

 Score =  125 bits (313), Expect = 2e-27
 Identities = 49/118 (41%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 462 QPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTT 521

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP
Sbjct: 522 QPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPP 579

 Score =  125 bits (313), Expect = 2e-27
 Identities = 48/118 (40%), Positives = 71/118 (60%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  
Sbjct: 512 EPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPST 571

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P
Sbjct: 572 KPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLP 629

 Score =  124 bits (312), Expect = 2e-27
 Identities = 48/118 (40%), Positives = 71/118 (60%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  
Sbjct: 517 QPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTT 576

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP
Sbjct: 577 QPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPP 634

 Score =  124 bits (310), Expect = 4e-27
 Identities = 48/118 (40%), Positives = 71/118 (60%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  
Sbjct: 522 QPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTT 581

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP
Sbjct: 582 QPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPP 639

 Score =  124 bits (310), Expect = 4e-27
 Identities = 48/118 (40%), Positives = 71/118 (60%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  
Sbjct: 527 QPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTT 586

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP
Sbjct: 587 QPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPP 644

 Score =  123 bits (309), Expect = 6e-27
 Identities = 48/118 (40%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  
Sbjct: 452 QPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPST 511

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP
Sbjct: 512 EPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPP 569

 Score =  123 bits (309), Expect = 6e-27
 Identities = 46/116 (39%), Positives = 70/116 (60%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P
Sbjct: 629 PTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQP 688

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 689 PTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 744

 Score =  123 bits (308), Expect = 7e-27
 Identities = 47/118 (39%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  
Sbjct: 572 KPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTT 631

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 632 QPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 689

 Score =  123 bits (308), Expect = 7e-27
 Identities = 46/118 (38%), Positives = 71/118 (60%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  
Sbjct: 612 RPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTT 671

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP
Sbjct: 672 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPP 729

 Score =  123 bits (308), Expect = 7e-27
 Identities = 47/117 (40%), Positives = 69/117 (58%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  
Sbjct: 667  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTT 726

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP    P   P
Sbjct: 727  QPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPPTTPVPCLHP 783

 Score =  122 bits (307), Expect = 9e-27
 Identities = 46/118 (38%), Positives = 71/118 (60%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  
Sbjct: 597 QPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTT 656

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP
Sbjct: 657 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPP 714

 Score =  122 bits (307), Expect = 9e-27
 Identities = 46/118 (38%), Positives = 71/118 (60%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  
Sbjct: 602 QPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTT 661

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP
Sbjct: 662 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPP 719

 Score =  122 bits (307), Expect = 9e-27
 Identities = 46/118 (38%), Positives = 71/118 (60%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  
Sbjct: 607 QPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTT 666

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP
Sbjct: 667 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPP 724

 Score =  122 bits (307), Expect = 9e-27
 Identities = 46/118 (38%), Positives = 71/118 (60%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  
Sbjct: 617 QPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTT 676

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP
Sbjct: 677 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPP 734

 Score =  122 bits (307), Expect = 9e-27
 Identities = 46/118 (38%), Positives = 71/118 (60%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 622 QPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 681

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 682 QPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPP 739

 Score =  122 bits (306), Expect = 1e-26
 Identities = 47/118 (39%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 562 QPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTT 621

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 622 QPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 679

 Score =  122 bits (306), Expect = 1e-26
 Identities = 47/118 (39%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 567 QPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTT 626

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 627 QLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 684

 Score =  122 bits (305), Expect = 2e-26
 Identities = 47/118 (39%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  
Sbjct: 537 QPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTT 596

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP
Sbjct: 597 QPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPP 654

 Score =  122 bits (305), Expect = 2e-26
 Identities = 47/118 (39%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 542 QPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPST 601

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP
Sbjct: 602 QPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPP 659

 Score =  122 bits (305), Expect = 2e-26
 Identities = 47/118 (39%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 547 QPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTT 606

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP
Sbjct: 607 QPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPP 664

 Score =  122 bits (305), Expect = 2e-26
 Identities = 47/118 (39%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 552 QPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYT 611

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP
Sbjct: 612 RPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPP 669

 Score =  122 bits (305), Expect = 2e-26
 Identities = 47/117 (40%), Positives = 69/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 558 PPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQ 617

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP
Sbjct: 618 PPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPP 674

 Score =  121 bits (304), Expect = 2e-26
 Identities = 46/118 (38%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  
Sbjct: 577 QPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPST 636

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 637 QPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 694

 Score =  121 bits (304), Expect = 2e-26
 Identities = 46/118 (38%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  
Sbjct: 582 QPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTT 641

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 642 QPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 699

 Score =  121 bits (304), Expect = 2e-26
 Identities = 46/118 (38%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  
Sbjct: 587 QPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTT 646

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 647 RQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 704

 Score =  121 bits (304), Expect = 2e-26
 Identities = 46/118 (38%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  
Sbjct: 592 QPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTT 651

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 652 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 709

 Score =  121 bits (303), Expect = 3e-26
 Identities = 48/118 (40%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  
Sbjct: 197 QPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTT 256

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP
Sbjct: 257 QPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPP 314

 Score =  121 bits (303), Expect = 3e-26
 Identities = 47/116 (40%), Positives = 68/116 (58%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +P
Sbjct: 449 PTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQP 508

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP
Sbjct: 509 PSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPP 564

 Score =  121 bits (303), Expect = 3e-26
 Identities = 47/118 (39%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  
Sbjct: 532 QPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTT 591

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P
Sbjct: 592 QPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQP 649

 Score =  120 bits (302), Expect = 4e-26
 Identities = 47/118 (39%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  
Sbjct: 417 QPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTT 476

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 477 QPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPP 534

 Score =  120 bits (300), Expect = 6e-26
 Identities = 47/118 (39%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 427 QPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPST 486

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 487 SPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPP 544

 Score =  120 bits (300), Expect = 6e-26
 Identities = 47/118 (39%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  
Sbjct: 437 QPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTP 496

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 497 QPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPP 554

 Score =  120 bits (300), Expect = 6e-26
 Identities = 47/117 (40%), Positives = 68/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +
Sbjct: 443 PPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQ 502

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP
Sbjct: 503 PPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPP 559

 Score =  119 bits (299), Expect = 8e-26
 Identities = 48/117 (41%), Positives = 68/117 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  
Sbjct: 202 QPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTT 261

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP
Sbjct: 262 RPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKP 318

 Score =  119 bits (299), Expect = 8e-26
 Identities = 47/117 (40%), Positives = 68/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP  +
Sbjct: 283 PPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQ 342

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 343 PPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPP 399

 Score =  119 bits (299), Expect = 8e-26
 Identities = 47/118 (39%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP  
Sbjct: 287 QPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPST 346

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 347 QPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPP 404

 Score =  119 bits (298), Expect = 1e-25
 Identities = 47/118 (39%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  
Sbjct: 152 QPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPST 211

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP
Sbjct: 212 QPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPP 269

 Score =  119 bits (298), Expect = 1e-25
 Identities = 47/118 (39%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 422 QPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTI 481

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 482 QPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPP 539

 Score =  119 bits (298), Expect = 1e-25
 Identities = 47/118 (39%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  
Sbjct: 432 QPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTT 491

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 492 HPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPP 549

 Score =  119 bits (297), Expect = 1e-25
 Identities = 48/123 (39%), Positives = 70/123 (56%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 332 QPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTT 391

Query: 187 KPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           +PP  +PP  +PP  +P     P  +PP  +PP  +PP  +PP  +PP   PP  + P  
Sbjct: 392 QPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTT 451

Query: 352 KPP 360
           +PP
Sbjct: 452 QPP 454

 Score =  118 bits (296), Expect = 2e-25
 Identities = 47/118 (39%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 112 QPPTTQPPTTQPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTT 171

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 172 QPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPP 229

 Score =  118 bits (296), Expect = 2e-25
 Identities = 48/123 (39%), Positives = 70/123 (56%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 347 QPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTT 406

Query: 187 KP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           +P     P  +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  
Sbjct: 407 QPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTT 466

Query: 352 KPP 360
           +PP
Sbjct: 467 QPP 469

 Score =  118 bits (295), Expect = 2e-25
 Identities = 46/118 (38%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  
Sbjct: 327 QPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPST 386

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +P   + P  +PP  +PP  +PP  +PP  +PP   PP
Sbjct: 387 QPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPP 444

 Score =  118 bits (295), Expect = 2e-25
 Identities = 46/118 (38%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 342 QPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTT 401

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +P   + P  +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP
Sbjct: 402 QPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPP 459

 Score =  117 bits (294), Expect = 3e-25
 Identities = 47/118 (39%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 117 QPPTTQPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTT 176

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 177 QPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPP 234

 Score =  117 bits (294), Expect = 3e-25
 Identities = 47/118 (39%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 122 QPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTT 181

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 182 QPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPP 239

 Score =  117 bits (294), Expect = 3e-25
 Identities = 47/118 (39%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P   
Sbjct: 127 KPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPHTT 186

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 187 QPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPP 244

 Score =  117 bits (294), Expect = 3e-25
 Identities = 47/116 (40%), Positives = 67/116 (57%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   P
Sbjct: 194 PSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYP 253

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP
Sbjct: 254 PTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPP 309

 Score =  117 bits (294), Expect = 3e-25
 Identities = 47/118 (39%), Positives = 67/118 (56%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   
Sbjct: 262 RPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTT 321

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP
Sbjct: 322 QPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPP 379

 Score =  117 bits (294), Expect = 3e-25
 Identities = 47/118 (39%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  
Sbjct: 277 QPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTT 336

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 337 QPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPP 394

 Score =  117 bits (294), Expect = 3e-25
 Identities = 48/123 (39%), Positives = 70/123 (56%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVY 171
           +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P     P  
Sbjct: 357 QPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTT 416

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  
Sbjct: 417 QPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTT 476

Query: 352 KPP 360
           +PP
Sbjct: 477 QPP 479

 Score =  117 bits (294), Expect = 3e-25
 Identities = 46/114 (40%), Positives = 67/114 (58%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  
Sbjct: 672  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTT 731

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP    P   P V
Sbjct: 732  QPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPPTTPVPCLHPGV 785

 Score =  117 bits (293), Expect = 4e-25
 Identities = 46/117 (39%), Positives = 68/117 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP  +PP  
Sbjct: 292 QPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTT 351

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P
Sbjct: 352 QPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQP 408

 Score =  117 bits (292), Expect = 5e-25
 Identities = 47/117 (40%), Positives = 67/117 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ 
Sbjct: 207 QPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPIT 266

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P
Sbjct: 267 KPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQP 323

 Score =  117 bits (292), Expect = 5e-25
 Identities = 47/117 (40%), Positives = 66/117 (56%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +
Sbjct: 253 PPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQ 312

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP  KP   +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP
Sbjct: 313 PPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPP 369

 Score =  117 bits (292), Expect = 5e-25
 Identities = 45/118 (38%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P   + P  +PP  +PP  
Sbjct: 367 QPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTT 426

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 427 QPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPP 484

 Score =  117 bits (292), Expect = 5e-25
 Identities = 46/116 (39%), Positives = 66/116 (56%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P  +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +P
Sbjct: 414 PTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQP 473

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 474 PTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPP 529

 Score =  116 bits (291), Expect = 7e-25
 Identities = 46/118 (38%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  
Sbjct: 147 QPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPST 206

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP
Sbjct: 207 QPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPP 264

 Score =  116 bits (291), Expect = 7e-25
 Identities = 47/118 (39%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 187 QPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTT 246

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP
Sbjct: 247 QPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPP 304

 Score =  116 bits (291), Expect = 7e-25
 Identities = 47/118 (39%), Positives = 67/118 (56%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  
Sbjct: 257 QPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPST 316

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KP   +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP
Sbjct: 317 KPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPP 374

 Score =  116 bits (290), Expect = 9e-25
 Identities = 46/118 (38%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P   +PP  
Sbjct: 132 QPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTT 191

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 192 QLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPP 249

 Score =  116 bits (290), Expect = 9e-25
 Identities = 50/133 (37%), Positives = 69/133 (51%), Gaps = 15/133 (11%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  
Sbjct: 232 QPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTT 291

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYK---------------PPVEKPPVYKPPVEKPPVY 321
           +PP  +PP+  PP  +PP  +PP  K               PP  +PP  +PP  +PP  
Sbjct: 292 QPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTT 351

Query: 322 KPPVEKPPVYKPP 360
           +PP  +PP  KPP
Sbjct: 352 QPPTTQPPTTKPP 364

 Score =  116 bits (290), Expect = 9e-25
 Identities = 45/118 (38%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  
Sbjct: 322 QPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTT 381

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +P   + P  +PP  +PP  +PP  +PP  +PP
Sbjct: 382 QPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPP 439

 Score =  115 bits (289), Expect = 1e-24
 Identities = 46/119 (38%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           +  P  +PP  +PP  +PP  KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP 
Sbjct: 106 DSEPTTQPPTTQPPTTQPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPT 165

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 166 TQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPP 224

 Score =  115 bits (289), Expect = 1e-24
 Identities = 46/118 (38%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  
Sbjct: 162 QPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPST 221

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP
Sbjct: 222 QPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPP 279

 Score =  115 bits (288), Expect = 2e-24
 Identities = 46/118 (38%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  
Sbjct: 157 QPPTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTT 216

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P
Sbjct: 217 QPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLP 274

 Score =  115 bits (288), Expect = 2e-24
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVY 171
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P     P  +PP  +PP  +PP  
Sbjct: 372 QPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTT 431

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  
Sbjct: 432 QPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTT 491

Query: 352 KPP 360
            PP
Sbjct: 492 HPP 494

 Score =  115 bits (288), Expect = 2e-24
 Identities = 45/118 (38%), Positives = 66/118 (55%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +P   + P  +PP  +PP  +PP  +PP  +PP   PP  
Sbjct: 387 QPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTT 446

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP
Sbjct: 447 QTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPP 504

 Score =  115 bits (288), Expect = 2e-24
 Identities = 45/110 (40%), Positives = 65/110 (59%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  
Sbjct: 677  QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTT 736

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
            +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP    P   P VE
Sbjct: 737  QPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPPTTPVPCLHPGVE 786

 Score =  115 bits (287), Expect = 2e-24
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 171
           +PP  +PP  +PP  +P     P  +PP  +PP  +PP  +PP  +PP   PP  + P  
Sbjct: 392 QPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTT 451

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  
Sbjct: 452 QPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPST 511

Query: 352 KPP 360
           +PP
Sbjct: 512 EPP 514

 Score =  114 bits (286), Expect = 3e-24
 Identities = 46/118 (38%), Positives = 66/118 (55%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP  
Sbjct: 222 QPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPST 281

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP
Sbjct: 282 LPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPP 339

 Score =  114 bits (286), Expect = 3e-24
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 171
           +PP  +P     P  +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  
Sbjct: 402 QPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPST 461

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 462 QPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTT 521

Query: 352 KPP 360
           +PP
Sbjct: 522 QPP 524

 Score =  114 bits (285), Expect = 3e-24
 Identities = 46/117 (39%), Positives = 66/117 (56%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP  
Sbjct: 212 QPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTS 271

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
             P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P
Sbjct: 272 HLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQP 328

 Score =  114 bits (285), Expect = 3e-24
 Identities = 46/118 (38%), Positives = 66/118 (55%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  
Sbjct: 227 QPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTT 286

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP
Sbjct: 287 QPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPP 344

 Score =  114 bits (285), Expect = 3e-24
 Identities = 47/123 (38%), Positives = 69/123 (56%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  KP   +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  
Sbjct: 312 QPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTT 371

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVY 351
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P     P  +PP  +PP  +PP  
Sbjct: 372 QPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTT 431

Query: 352 KPP 360
           +PP
Sbjct: 432 QPP 434

 Score =  114 bits (284), Expect = 4e-24
 Identities = 46/118 (38%), Positives = 67/118 (56%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 172 QPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPST 231

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP
Sbjct: 232 QPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPP 289

 Score =  114 bits (284), Expect = 4e-24
 Identities = 46/118 (38%), Positives = 67/118 (56%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 182 QPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTT 241

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP
Sbjct: 242 QPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPP 299

 Score =  114 bits (284), Expect = 4e-24
 Identities = 47/122 (38%), Positives = 68/122 (55%), Gaps = 5/122 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  K
Sbjct: 303 PPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTK 362

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYK 354
           PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P     P  +PP  +
Sbjct: 363 PPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQ 422

Query: 355 PP 360
           PP
Sbjct: 423 PP 424

 Score =  114 bits (284), Expect = 4e-24
 Identities = 47/123 (38%), Positives = 69/123 (56%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  KP   +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  
Sbjct: 307 QPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPST 366

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVY 351
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P     P  +PP  +PP  
Sbjct: 367 QPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTT 426

Query: 352 KPP 360
           +PP
Sbjct: 427 QPP 429

 Score =  113 bits (283), Expect = 6e-24
 Identities = 46/118 (38%), Positives = 67/118 (56%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 167 QPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTT 226

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP
Sbjct: 227 QPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPP 284

 Score =  113 bits (283), Expect = 6e-24
 Identities = 46/118 (38%), Positives = 67/118 (56%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 177 QPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTT 236

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP
Sbjct: 237 QPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPP 294

 Score =  113 bits (283), Expect = 6e-24
 Identities = 46/118 (38%), Positives = 66/118 (55%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  
Sbjct: 217 QPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTT 276

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP
Sbjct: 277 QPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPP 334

 Score =  113 bits (283), Expect = 6e-24
 Identities = 47/123 (38%), Positives = 69/123 (56%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP  +PP  +PP  
Sbjct: 297 QPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTT 356

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVY 351
           +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P     P  
Sbjct: 357 QPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTT 416

Query: 352 KPP 360
           +PP
Sbjct: 417 QPP 419

 Score =  108 bits (269), Expect = 2e-22
 Identities = 44/115 (38%), Positives = 64/115 (55%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 682  QPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTT 741

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
            +PP  +PP  KPP  +PP  +PP  +PP  +PP    P   P V       P +Y
Sbjct: 742  QPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPPTTPVPCLHPGVEVCGTSLPGLY 796

[48][TOP]
>UniRef100_A9VJK7 NEAr transporter n=1 Tax=Bacillus weihenstephanensis KBAB4
           RepID=A9VJK7_BACWK
          Length = 1147

 Score =  130 bits (328), Expect = 3e-29
 Identities = 69/102 (67%), Positives = 70/102 (68%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           +EKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP 
Sbjct: 458 EEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPE 517

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 306
           VEKP V KP VEKP V KP VEKP V KP VEKP V  P  E
Sbjct: 518 VEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENPDAE 559

 Score =  130 bits (326), Expect = 6e-29
 Identities = 69/101 (68%), Positives = 69/101 (68%)
 Frame = +1

Query: 34  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 213
           EKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP V
Sbjct: 459 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEV 518

Query: 214 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
           EKP V KP VEKP V KP VEKP V KP VEKP V  P  E
Sbjct: 519 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENPDAE 559

 Score =  129 bits (324), Expect = 1e-28
 Identities = 68/97 (70%), Positives = 68/97 (70%)
 Frame = +1

Query: 22  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 201
           KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V 
Sbjct: 460 KPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVE 519

Query: 202 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 312
           KP VEKP V KP VEKP V KP VEKP V KP VE P
Sbjct: 520 KPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENP 556

 Score =  129 bits (324), Expect = 1e-28
 Identities = 68/97 (70%), Positives = 68/97 (70%)
 Frame = +1

Query: 52  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 231
           KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V 
Sbjct: 460 KPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVE 519

Query: 232 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
           KP VEKP V KP VEKP V KP VEKP V KP VE P
Sbjct: 520 KPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENP 556

 Score =  128 bits (322), Expect = 2e-28
 Identities = 68/98 (69%), Positives = 68/98 (69%)
 Frame = +1

Query: 64  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 243
           EKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP V
Sbjct: 459 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEV 518

Query: 244 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           EKP V KP VEKP V KP VEKP V KP VEKP V  P
Sbjct: 519 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENP 556

[49][TOP]
>UniRef100_Q94G50 Proline-rich protein-2 n=1 Tax=Gossypium hirsutum
           RepID=Q94G50_GOSHI
          Length = 310

 Score =  130 bits (328), Expect = 3e-29
 Identities = 74/150 (49%), Positives = 96/150 (64%), Gaps = 30/150 (20%)
 Frame = +1

Query: 1   QEKPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE--- 126
           + KP VY+PP +     KPPVY PP +     KPP+Y+PP +     KP VY PP +   
Sbjct: 137 EPKPLVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPMYEPPKKEKLEPKPLVYAPPKKEKP 196

Query: 127 --KPPVYKPPVEKPPVYKPPVEKPPVY-----KPPVEKPPVYKPPVEKPPVYKPPVEKPP 285
             KPPVY+PP +KPPVY+P   KPPVY     + P  KPP+Y+PP  KPP+Y+P  +K P
Sbjct: 197 EPKPPVYEPP-KKPPVYEPKPPKPPVYASPKKEKPEPKPPMYEPP-NKPPMYEPKPQKSP 254

Query: 286 VYKPPVE-----KPPVYKPPVEKPPVYKPP 360
           VY PP +     KPP+Y+PP +KPPV+KPP
Sbjct: 255 VYVPPKKEKPEPKPPMYEPP-KKPPVHKPP 283

 Score =  124 bits (311), Expect = 3e-27
 Identities = 69/155 (44%), Positives = 89/155 (57%), Gaps = 35/155 (22%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE--- 156
           + KPPVY+PP ++ P  KP V  PP  + P  KP VY+PP +     KPPVY PP +   
Sbjct: 107 EPKPPVYEPPKKEKPKPKPSVYTPPKKEKPEPKPLVYEPPKKEKPEPKPPVYTPPKKEKP 166

Query: 157 --KPPVYKPPVE--------------------KPPVYKPPVEKPPVYKPPVEKPPVY--- 261
             KPP+Y+PP +                    KPPVY+PP +KPPVY+P   KPPVY   
Sbjct: 167 EPKPPMYEPPKKEKLEPKPLVYAPPKKEKPEPKPPVYEPP-KKPPVYEPKPPKPPVYASP 225

Query: 262 --KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             + P  KPP+Y+PP  KPP+Y+P  +K PVY PP
Sbjct: 226 KKEKPEPKPPMYEPP-NKPPMYEPKPQKSPVYVPP 259

 Score =  122 bits (306), Expect = 1e-26
 Identities = 71/150 (47%), Positives = 89/150 (59%), Gaps = 30/150 (20%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE--- 156
           + KPPVY+PP ++ P  K PV  PP  + P  KPPVY+PP +     KP VY PP +   
Sbjct: 77  EPKPPVYEPPKKEKPEPKSPVYTPPKKERPEPKPPVYEPPKKEKPKPKPSVYTPPKKEKP 136

Query: 157 --KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE--- 276
             KP VY+PP +     KPPVY PP +     KPP+Y+PP +     KP VY PP +   
Sbjct: 137 EPKPLVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPMYEPPKKEKLEPKPLVYAPPKKEKP 196

Query: 277 --KPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             KPPVY+PP +KPPVY+P   KPPVY  P
Sbjct: 197 EPKPPVYEPP-KKPPVYEPKPPKPPVYASP 225

 Score =  121 bits (303), Expect = 3e-26
 Identities = 66/128 (51%), Positives = 78/128 (60%), Gaps = 12/128 (9%)
 Frame = +1

Query: 13  PVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPV-EKP-- 162
           PVYKPP  KPP Y  KPPV +PP  + P  KPPVY  P +     KPPVY+PP  EKP  
Sbjct: 34  PVYKPPKVKPPPYEHKPPVYEPPKKEKPEPKPPVYTSPKKDKPEPKPPVYEPPKKEKPEP 93

Query: 163 --PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
             PVY PP ++ P  KPPV +PP  + P  KP VY PP ++ P  KP V +PP  + P  
Sbjct: 94  KSPVYTPPKKERPEPKPPVYEPPKKEKPKPKPSVYTPPKKEKPEPKPLVYEPPKKEKPEP 153

Query: 337 KPPVYKPP 360
           KPPVY PP
Sbjct: 154 KPPVYTPP 161

 Score =  121 bits (303), Expect = 3e-26
 Identities = 63/130 (48%), Positives = 79/130 (60%), Gaps = 10/130 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKP----PVYKPPVE--- 156
           + KPPVY+PP ++ P  KPPV   P    P  KPPVY+PP  EKP    PVY PP +   
Sbjct: 47  EHKPPVYEPPKKEKPEPKPPVYTSPKKDKPEPKPPVYEPPKKEKPEPKSPVYTPPKKERP 106

Query: 157 --KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 330
             KPPVY+PP ++ P  KP V  PP  + P  KP VY+PP ++ P  KPPV  PP  + P
Sbjct: 107 EPKPPVYEPPKKEKPKPKPSVYTPPKKEKPEPKPLVYEPPKKEKPEPKPPVYTPPKKEKP 166

Query: 331 VEKPPVYKPP 360
             KPP+Y+PP
Sbjct: 167 EPKPPMYEPP 176

[50][TOP]
>UniRef100_B4H1H8 GL22613 n=1 Tax=Drosophila persimilis RepID=B4H1H8_DROPE
          Length = 346

 Score =  128 bits (322), Expect = 2e-28
 Identities = 57/119 (47%), Positives = 81/119 (68%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+P   +PP E+PP  +P  E+PP  +PP E+PP  +PP E+PP   PP+E+PP   PP 
Sbjct: 213 EEPQQVEPPKEEPPKEEPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPPK 272

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+PP  KPP E+PP  +PP E+PP  +PP E+P   +PP E+ P  +PP+E+PP+ +PP
Sbjct: 273 EEPPKEKPPKEEPPKEEPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPPMEEPP 331

 Score =  125 bits (315), Expect = 1e-27
 Identities = 55/116 (47%), Positives = 80/116 (68%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           Q +PP  +PP E+P   +PP E+PP  +PP E+PP  +PP + PP+ +PP E PP  +PP
Sbjct: 217 QVEPPKEEPPKEEPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPPKEEPP 276

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            EKPP  +PP E+PP  +PP E+PP  +P  E+PP  + P E+PP+ +PP+E+PP+
Sbjct: 277 KEKPPKEEPPKEEPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPPMEEPPM 332

 Score =  123 bits (308), Expect = 7e-27
 Identities = 54/113 (47%), Positives = 79/113 (69%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           +E+PP  +P  E+PP  +PP E+PP  +PP E+PP   PP+E+PP   PP E+PP  KPP
Sbjct: 222 KEEPPKEEPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPPKEEPPKEKPP 281

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
            E+PP  +PP E+PP  +PP E+P   +PP E+ P  +PP+E+PP+ +PP+E+
Sbjct: 282 KEEPPKEEPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPPMEEPPMEE 334

 Score =  118 bits (295), Expect = 2e-25
 Identities = 53/115 (46%), Positives = 76/115 (66%)
 Frame = +1

Query: 16  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 195
           V +P   +PP  +PP E+P   +PP E+PP  +PP E+PP  +PP + PP+ +PP E PP
Sbjct: 212 VEEPQQVEPPKEEPPKEEPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPP 271

Query: 196 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             +PP EKPP  +PP E+PP  +PP E+PP  +P  E+PP  + P E+PP+ +PP
Sbjct: 272 KEEPPKEKPPKEEPPKEEPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPP 326

[51][TOP]
>UniRef100_Q6PCS2 Zgc:64189 n=1 Tax=Danio rerio RepID=Q6PCS2_DANRE
          Length = 690

 Score =  128 bits (321), Expect = 2e-28
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 156 ERPPVSAPATERPPVSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAP 215

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 216 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 273

 Score =  127 bits (319), Expect = 4e-28
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 166 ERPPVSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 225

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 226 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 283

 Score =  126 bits (317), Expect = 7e-28
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 176 ERPPVSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 235

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 236 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 293

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 186 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 245

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 246 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 303

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 196 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 255

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 256 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 313

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 206 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 265

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 266 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 323

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 216 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 275

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 276 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 333

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 226 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 285

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 286 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 343

 Score =  120 bits (302), Expect = 4e-26
 Identities = 58/118 (49%), Positives = 71/118 (60%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 236 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 295

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+ P+  P
Sbjct: 296 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVP 353

 Score =  119 bits (299), Expect = 8e-26
 Identities = 56/111 (50%), Positives = 67/111 (60%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  
Sbjct: 153 PAPERPPVSAPATERPPVSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERPPVSA 212

Query: 205 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 213 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 263

 Score =  100 bits (250), Expect = 4e-20
 Identities = 52/118 (44%), Positives = 63/118 (53%), Gaps = 14/118 (11%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 246 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 305

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP--------------VEKPP 315
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P               +  PP
Sbjct: 306 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVPVWLLALPAPP 363

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 55/135 (40%), Positives = 67/135 (49%), Gaps = 19/135 (14%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPV--------------EKPPVYKPPVEKPPVYKPPV-----EKP 132
           PPV  P  E+ P     V              + P   +PPV  P   +PPV     E+P
Sbjct: 119 PPVSAPVPEQAPSPDDTVLTSQTTRRGRRRRRKAPAPERPPVSAPATERPPVSAPATERP 178

Query: 133 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 312
           PV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+P
Sbjct: 179 PVSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERP 238

Query: 313 PVYKPPVEKPPVYKP 357
           PV  P  E+PPV  P
Sbjct: 239 PVSAPAPERPPVSAP 253

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 50/120 (41%), Positives = 63/120 (52%), Gaps = 3/120 (2%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   P +  PV   P + 
Sbjct: 493 PPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPAPAQL 552

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE---KPPVYKPP 360
            PV   P +  PV   P + PPV   P + PPV   P + PPV   PV+   +P + KPP
Sbjct: 553 LPVPPAPAQLLPVPPAPAQLPPVPPVPAQLPPVPPAPAQLPPVPPAPVQLPLQPALLKPP 612

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 47/111 (42%), Positives = 58/111 (52%)
 Frame = +1

Query: 28  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 207
           PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   P +  PV   
Sbjct: 489 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPA 548

Query: 208 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P +  PV   P +  PV   P + PPV   P + PPV   P + PPV   P
Sbjct: 549 PAQLLPVPPAPAQLLPVPPAPAQLPPVPPVPAQLPPVPPAPAQLPPVPPAP 599

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 49/115 (42%), Positives = 49/115 (42%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   P    PV   
Sbjct: 489 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPA 548

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P    PV   P    PV   P   PPV   P   PPV   P   PPV   PV  P
Sbjct: 549 PAQLLPVPPAPAQLLPVPPAPAQLPPVPPVPAQLPPVPPAPAQLPPVPPAPVQLP 603

[52][TOP]
>UniRef100_Q2TCK9 Foot protein 1 variant 2 n=1 Tax=Mytilus californianus
           RepID=Q2TCK9_MYTCA
          Length = 672

 Score =  127 bits (319), Expect = 4e-28
 Identities = 56/116 (48%), Positives = 60/116 (51%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYK  +  PP YKP +  PP YKP    PP YKP    PP YK     P  YKP    
Sbjct: 129 PPVYKHKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSY 188

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP +  PP YKP    PP YK     P  YKP    PP YKP +  PP YKP
Sbjct: 189 PPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKP 244

 Score =  125 bits (315), Expect = 1e-27
 Identities = 55/116 (47%), Positives = 60/116 (51%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YK     PP YKP +  PP YKP    P  YK     
Sbjct: 229 PPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTY 288

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P
Sbjct: 289 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQP 344

 Score =  124 bits (312), Expect = 2e-27
 Identities = 55/115 (47%), Positives = 59/115 (51%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YKP    PP YKP +  PP YKP    PP YK     PP YKP +  PP YKP    
Sbjct: 219 PSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSY 278

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK
Sbjct: 279 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYK 333

 Score =  124 bits (311), Expect = 3e-27
 Identities = 55/115 (47%), Positives = 58/115 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YKP    PP YK     P  YKP    PP YKP +  
Sbjct: 139 PPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITY 198

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK
Sbjct: 199 PPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYK 253

 Score =  124 bits (311), Expect = 3e-27
 Identities = 55/116 (47%), Positives = 59/116 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    
Sbjct: 189 PPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSY 248

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP
Sbjct: 249 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKP 304

 Score =  123 bits (309), Expect = 6e-27
 Identities = 55/116 (47%), Positives = 58/116 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 159 PPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSY 218

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P  YKP    PP YKP +  PP YKP    PP YK     PP YKP +  PP YKP
Sbjct: 219 PSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKP 274

 Score =  123 bits (309), Expect = 6e-27
 Identities = 55/116 (47%), Positives = 59/116 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     P  YKP    PP YKP +  PP YKP    PP YK     PP YKP +  
Sbjct: 209 PPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITY 268

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP    P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP
Sbjct: 269 PPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKP 324

 Score =  120 bits (300), Expect = 6e-26
 Identities = 53/116 (45%), Positives = 58/116 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  P  YK     PP YK     PP YKP +  PP YKP    P  YK     
Sbjct: 399 PPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTY 458

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P
Sbjct: 459 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQP 514

 Score =  119 bits (298), Expect = 1e-25
 Identities = 54/116 (46%), Positives = 58/116 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP    PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  
Sbjct: 239 PPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITY 298

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P     P YKP
Sbjct: 299 PPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKP 354

 Score =  118 bits (295), Expect = 2e-25
 Identities = 53/115 (46%), Positives = 58/115 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP YKP +  
Sbjct: 259 PPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITY 318

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP    PP YK     PP Y+P     P YKP    PP YK  +  PP YK
Sbjct: 319 PPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYK 373

 Score =  118 bits (295), Expect = 2e-25
 Identities = 53/115 (46%), Positives = 58/115 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP YKP +  
Sbjct: 429 PPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITY 488

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP    PP YK     PP Y+P     P YKP    PP YK  +  PP YK
Sbjct: 489 PPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYK 543

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/115 (46%), Positives = 56/115 (48%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     P  YKP    PP YKP +  PP YKP    PP YK     P  YKP    
Sbjct: 169 PPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSY 228

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP +  PP YKP    PP YK     PP YKP +  PP YKP    P  YK
Sbjct: 229 PPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYK 283

 Score =  116 bits (290), Expect = 9e-25
 Identities = 53/115 (46%), Positives = 57/115 (49%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    
Sbjct: 249 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSY 308

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP +  PP YKP    PP YK     PP Y+P     P YKP    PP YK
Sbjct: 309 PPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYK 363

 Score =  116 bits (290), Expect = 9e-25
 Identities = 52/115 (45%), Positives = 56/115 (48%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YKP +  P  YK     PP YK     PP YKP +  PP YKP    
Sbjct: 389 PSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSY 448

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK
Sbjct: 449 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYK 503

 Score =  116 bits (290), Expect = 9e-25
 Identities = 53/115 (46%), Positives = 57/115 (49%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    
Sbjct: 419 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSY 478

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP +  PP YKP    PP YK     PP Y+P     P YKP    PP YK
Sbjct: 479 PPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYK 533

 Score =  114 bits (286), Expect = 3e-24
 Identities = 55/126 (43%), Positives = 60/126 (47%), Gaps = 10/126 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPP----------VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 159
           PP+YKP  +K            VYK     PPVYK  +  PP YKP +  PP YKP    
Sbjct: 99  PPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSY 158

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 159 PPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSY 218

Query: 340 PPVYKP 357
           P  YKP
Sbjct: 219 PSTYKP 224

 Score =  112 bits (280), Expect = 1e-23
 Identities = 51/116 (43%), Positives = 55/116 (47%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     P  YK     PP YKP +  P  YK     PP YK     PP YKP +  
Sbjct: 379 PSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITY 438

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP    P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP
Sbjct: 439 PPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKP 494

 Score =  111 bits (277), Expect = 3e-23
 Identities = 51/116 (43%), Positives = 55/116 (47%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P    
Sbjct: 289 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTY 348

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            P YKP    PP YK  +  PP YK     P  YK     P  YK     PP YKP
Sbjct: 349 LPSYKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKP 404

 Score =  111 bits (277), Expect = 3e-23
 Identities = 51/116 (43%), Positives = 55/116 (47%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P    
Sbjct: 459 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTY 518

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            P YKP    PP YK  +  PP YK     P  YK     P  YK     PP YKP
Sbjct: 519 LPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKP 574

 Score =  109 bits (273), Expect = 8e-23
 Identities = 51/115 (44%), Positives = 56/115 (48%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P Y      PP+YKP  +K   YK       VYK     PPVYK  +  PP YKP +  P
Sbjct: 90  PTYGSKTNYPPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYP 149

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P YKP    PP YKP    PP YK     P  YKP    PP YKP +  PP YKP
Sbjct: 150 PTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKP 204

 Score =  109 bits (273), Expect = 8e-23
 Identities = 49/116 (42%), Positives = 55/116 (47%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     P  YK     PP YKP +  P  YK     PP YKP       YKP +  
Sbjct: 549 PASYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKPKPSYASSYKPKIRY 608

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP       YKP +  PP YKP +  PP YKP +  PP YKP +   P YKP
Sbjct: 609 PPTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKPKISYLPAYKP 664

 Score =  109 bits (273), Expect = 8e-23
 Identities = 48/114 (42%), Positives = 55/114 (48%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YKP +  P  YK     PP YKP       YKP +  PP YKP    
Sbjct: 559 PSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSY 618

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
              YKP +  PP YKP +  PP YKP +  PP YKP +   P YKP +  P  Y
Sbjct: 619 ASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKPKISYLPAYKPKISYPSQY 672

 Score =  108 bits (270), Expect = 2e-22
 Identities = 49/116 (42%), Positives = 54/116 (46%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     P  YK     P  YK     PP YKP +  P  YK     PP YKP    
Sbjct: 539 PPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKPKPSY 598

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
              YKP +  PP YKP       YKP +  PP YKP +  PP YKP +  PP YKP
Sbjct: 599 ASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKP 654

 Score =  107 bits (266), Expect = 5e-22
 Identities = 49/116 (42%), Positives = 53/116 (45%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK  +  PP YK     P  YK     P  YK     PP YKP +  P  YK     
Sbjct: 359 PPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSY 418

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP
Sbjct: 419 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKP 474

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/115 (42%), Positives = 53/115 (46%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 279 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASY 338

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP Y+P     P YKP    PP YK  +  PP YK     P  YK     P  YK
Sbjct: 339 PPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYK 393

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/115 (42%), Positives = 53/115 (46%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 449 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASY 508

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP Y+P     P YKP    PP YK  +  PP YK     P  YK     P  YK
Sbjct: 509 PPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYK 563

 Score =  102 bits (255), Expect = 1e-20
 Identities = 50/117 (42%), Positives = 54/117 (46%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KP  Y P     P Y      PP+YKP  +K   YK       VYK     PPVYK  + 
Sbjct: 78  KPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKIT 137

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            PP YKP +  PP YKP    PP YKP    PP YK     P  YKP    PP YKP
Sbjct: 138 NPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKP 194

 Score =  102 bits (253), Expect = 2e-20
 Identities = 51/125 (40%), Positives = 56/125 (44%), Gaps = 10/125 (8%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P YKP    PP YK  +  PP YK     P  YK     P  YK     PP YKP +  P
Sbjct: 520 PSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYP 579

Query: 193 PVYK-----PPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
             YK     PP  KP       YKP +  PP YKP       YKP +  PP YKP +  P
Sbjct: 580 STYKTKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYP 639

Query: 343 PVYKP 357
           P YKP
Sbjct: 640 PTYKP 644

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 54/145 (37%), Positives = 58/145 (40%), Gaps = 30/145 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 174
           PP YKP +  PP YKP    PP YK     PP Y+P     P YKP    PP YK     
Sbjct: 309 PPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISY 368

Query: 175 PPVEK-------------------------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 279
           PP  K                         PP YKP +  P  YK     PP YK     
Sbjct: 369 PPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKAKKTY 428

Query: 280 PPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP +  PP YKP    P  YK
Sbjct: 429 PPTYKPKITYPPTYKPKPSYPTSYK 453

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 56/146 (38%), Positives = 60/146 (41%), Gaps = 30/146 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKP-----PVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 159
           PP YKP    PP YKP     P  K     PP YK     PP Y+P     P YKP    
Sbjct: 299 PPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTY 358

Query: 160 PPVYKPPVEKPPVYK---------------PPVEK-----PPVYKPPVEKPPVYKPPVEK 279
           PP YK  +  PP YK               P   K     PP YKP +  P  YK     
Sbjct: 359 PPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSY 418

Query: 280 PPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YK     PP YKP +  PP YKP
Sbjct: 419 PPTYKAKKTYPPTYKPKITYPPTYKP 444

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 51/126 (40%), Positives = 54/126 (42%), Gaps = 10/126 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKP-----PVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 159
           PP YKP    PP YKP     P  K     PP YK     PP Y+P     P YKP    
Sbjct: 469 PPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTY 528

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           PP YK  +  PP YK     P  YK     P  YK     PP YKP +  P  YK     
Sbjct: 529 PPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSY 588

Query: 340 PPVYKP 357
           PP YKP
Sbjct: 589 PPTYKP 594

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/111 (41%), Positives = 50/111 (45%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           P   KP  Y P     P Y      PP+YKP  +K   YK       VYK     PPVYK
Sbjct: 74  PAPYKPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYK 133

Query: 205 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
             +  PP YKP +  PP YKP    PP YKP    PP YK     P  YKP
Sbjct: 134 HKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKP 184

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 48/124 (38%), Positives = 52/124 (41%), Gaps = 10/124 (8%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKP 177
           PVYKP  + P  Y      P  YKP    P     P Y      PP+YKP  +K   YK 
Sbjct: 55  PVYKPMNKIPTSYISKKSYPAPYKPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKA 114

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKP 342
                 VYK     PPVYK  +  PP YKP          P YKP    PP YKP    P
Sbjct: 115 IKTTYLVYKAKTSYPPVYKHKITNPPTYKP-----KITYPPTYKPKPSYPPTYKPKPSYP 169

Query: 343 PVYK 354
           P YK
Sbjct: 170 PTYK 173

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 37/75 (49%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KP +  P     P YKP       YKP +  PP YKP +  PP YKP +  PP YKP + 
Sbjct: 603 KPKIRYP-----PTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKPKIS 657

Query: 187 KPPVYKPPVEKPPVY 231
             P YKP +  P  Y
Sbjct: 658 YLPAYKPKISYPSQY 672

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 38/106 (35%), Positives = 43/106 (40%)
 Frame = +1

Query: 43  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 222
           PVYKP  + P  Y      P  YKP       Y P     P Y      PP+YKP  +K 
Sbjct: 55  PVYKPMNKIPTSYISKKSYPAPYKPKG-----YHPTNSYQPTYGSKTNYPPIYKPVAKKL 109

Query: 223 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             YK       VYK     PPVYK  +  PP YKP      +  PP
Sbjct: 110 SSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKP-----KITYPP 150

[53][TOP]
>UniRef100_Q9LZJ7 Proline-rich protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9LZJ7_ARATH
          Length = 313

 Score =  126 bits (316), Expect = 9e-28
 Identities = 73/135 (54%), Positives = 75/135 (55%), Gaps = 18/135 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKP----PVYKPPVEKP----PVYKPPVEKPPVYKPPVEK----PPVYK--- 144
           PPVYK P  KP    PVY PPV KP    PVY  P   PPVY PPV K    PPVY    
Sbjct: 30  PPVYKSPEHKPTLPSPVYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPT 89

Query: 145 --PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPP 315
             PPV  PPVYKP +  PPVY  P   PPVY PPV KP PVY  P   PPVY PPV KP 
Sbjct: 90  IPPPVYTPPVYKPTL-SPPVYTKPTIPPPVYTPPVYKPTPVYTKPTIPPPVYTPPVYKPT 148

Query: 316 VYKPPVEKPPVYKPP 360
              P  +K P Y  P
Sbjct: 149 PSPPVYKKSPSYSSP 163

 Score =  113 bits (282), Expect = 8e-24
 Identities = 65/126 (51%), Positives = 67/126 (53%), Gaps = 10/126 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEK----PPVYK-----PPVEKPPVYKPPVEKPPVYKPPVEKP 162
           PPVY  P   PPVY PPV K    PPVY      PPV  PPVYKP +  PPVY  P   P
Sbjct: 58  PPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTL-SPPVYTKPTIPP 116

Query: 163 PVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           PVY PPV KP PVY  P   PPVY PPV KP    P  +K P Y  P   PP Y P    
Sbjct: 117 PVYTPPVYKPTPVYTKPTIPPPVYTPPVYKPTPSPPVYKKSPSYSSP---PPPYVPKPTY 173

Query: 340 PPVYKP 357
            P  KP
Sbjct: 174 TPTTKP 179

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 51/98 (52%), Positives = 51/98 (52%), Gaps = 10/98 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKP-PVYK-----PPVEKPPVYKPPVEK 159
           PPVY PPV KP    PVY  P   PPVY PPV KP PVY      PPV  PPVYK P   
Sbjct: 92  PPVYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKPTPVYTKPTIPPPVYTPPVYK-PTPS 150

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 273
           PPVYK    K P Y  P   PP Y P     P  KP V
Sbjct: 151 PPVYK----KSPSYSSP---PPPYVPKPTYTPTTKPYV 181

[54][TOP]
>UniRef100_UPI00017611C2 PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI00017611C2
          Length = 653

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 159 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 218

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 219 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 276

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 169 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 228

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 229 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 286

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 179 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 238

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 239 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 296

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 189 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 248

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 249 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 306

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 199 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 258

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 259 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 316

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 209 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 268

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 269 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 326

 Score =  124 bits (312), Expect = 2e-27
 Identities = 60/118 (50%), Positives = 71/118 (60%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 139 ERPPVSAPAPEHPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 198

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 199 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 256

 Score =  124 bits (312), Expect = 2e-27
 Identities = 60/118 (50%), Positives = 71/118 (60%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 149 EHPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 208

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 209 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 266

 Score =  120 bits (302), Expect = 4e-26
 Identities = 58/118 (49%), Positives = 71/118 (60%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 219 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 278

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+ P+  P
Sbjct: 279 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVP 336

 Score =  100 bits (250), Expect = 4e-20
 Identities = 52/118 (44%), Positives = 63/118 (53%), Gaps = 14/118 (11%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 229 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 288

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP--------------VEKPP 315
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P               +  PP
Sbjct: 289 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVPVWLLALPAPP 346

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/153 (35%), Positives = 66/153 (43%), Gaps = 39/153 (25%)
 Frame = +1

Query: 16  VYKPPVEKP----------PVYKPPVEKPPVYKPPVEKPPV------------------- 108
           V +PP  +P          PV  P  E PPV  P  E+ P                    
Sbjct: 74  VRRPPFSEPLESLLELCGTPVSAPAPECPPVSAPAPEQDPSPDHNTLPSQTTRRRRHRKR 133

Query: 109 -----YKPPVEKPPVYKPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPV 258
                 +PPV  P    PPV  P   +PPV     E+PPV  P  E+PPV  P  E+PPV
Sbjct: 134 TAHVPERPPVSAPAPEHPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 193

Query: 259 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
             P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 194 SAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 226

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 49/115 (42%), Positives = 60/115 (52%), Gaps = 4/115 (3%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           PV  PPV   PV  P    PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   P
Sbjct: 463 PVQLPPVPPAPVQLPVPPDPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAP 522

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
            +  PV   P +  PV   P + PPV   P + PPV   PV+ P   +P + KPP
Sbjct: 523 AQLLPVPPAPAQLLPVPPAPAQLPPVPPAPAQLPPVPPAPVQLP--LQPALLKPP 575

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 44/101 (43%), Positives = 54/101 (53%)
 Frame = +1

Query: 58  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 237
           PV+ PPV   PV+ P V   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   
Sbjct: 463 PVQLPPVPPAPVQLP-VPPDPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPA 521

Query: 238 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P +  PV   P +  PV   P + PPV   P + PPV   P
Sbjct: 522 PAQLLPVPPAPAQLLPVPPAPAQLPPVPPAPAQLPPVPPAP 562

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/105 (43%), Positives = 47/105 (44%)
 Frame = +1

Query: 43  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 222
           PV  PPV   PV + PV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   
Sbjct: 463 PVQLPPVPPAPV-QLPVPPDPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPA 521

Query: 223 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P    PV   P    PV   P   PPV   P   PPV   PV  P
Sbjct: 522 PAQLLPVPPAPAQLLPVPPAPAQLPPVPPAPAQLPPVPPAPVQLP 566

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 47/111 (42%), Positives = 50/111 (45%), Gaps = 4/111 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           PPV   PV+ P    PV  PPV   PV  PPV   PV  PPV   PV  PPV   P    
Sbjct: 467 PPVPPAPVQLPVPPDPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLL 526

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 330
           PV   P    PV   P   PPV   P   PPV   PV  P   +P + KPP
Sbjct: 527 PVPPAPAQLLPVPPAPAQLPPVPPAPAQLPPVPPAPVQLP--LQPALLKPP 575

[55][TOP]
>UniRef100_UPI000175F23A PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI000175F23A
          Length = 661

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 193 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 252

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 253 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 310

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 203 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 262

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 263 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 320

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 213 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 272

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 273 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 330

 Score =  120 bits (302), Expect = 4e-26
 Identities = 58/118 (49%), Positives = 71/118 (60%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 223 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 282

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+ P+  P
Sbjct: 283 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVP 340

 Score =  100 bits (250), Expect = 4e-20
 Identities = 52/118 (44%), Positives = 63/118 (53%), Gaps = 14/118 (11%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 233 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 292

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP--------------VEKPP 315
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P               +  PP
Sbjct: 293 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVPVWLLALPAPP 350

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 52/120 (43%), Positives = 64/120 (53%), Gaps = 3/120 (2%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   P + 
Sbjct: 464 PPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQL 523

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE---KPPVYKPP 360
            PV   P + PP    P + PPV   P + PPV   P + PPV   PV+   +P   KPP
Sbjct: 524 LPVPPAPAQLPPASPVPAQLPPVPPAPAQLPPVPPAPAQLPPVPPAPVQLPLQPAFLKPP 583

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 56/153 (36%), Positives = 68/153 (44%), Gaps = 39/153 (25%)
 Frame = +1

Query: 16  VYKPPVEKP----------PVYKPPVEKPPVYKPPVEKPPV------------------- 108
           V +PP  +P          PV  P  E PPV  P  E+ P                    
Sbjct: 128 VRRPPFSEPLESLLELCGTPVSAPAPECPPVSAPAPEQDPSPDDNTLPSQTTRRRRHRKR 187

Query: 109 -----YKPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 258
                 +PPV  P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 188 TAHVPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 247

Query: 259 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
             P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 248 SAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 280

[56][TOP]
>UniRef100_UPI0000F1E1DC PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI0000F1E1DC
          Length = 665

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 193 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 252

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 253 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 310

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 203 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 262

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 263 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 320

 Score =  125 bits (315), Expect = 1e-27
 Identities = 60/118 (50%), Positives = 72/118 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 213 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 272

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 273 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 330

 Score =  116 bits (291), Expect = 7e-25
 Identities = 56/111 (50%), Positives = 67/111 (60%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 223 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 282

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E
Sbjct: 283 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPE 333

 Score =  114 bits (285), Expect = 3e-24
 Identities = 59/117 (50%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ 
Sbjct: 443 PPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPAPVQL 502

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   P
Sbjct: 503 PPVPPAPVQLPPVTPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAP 559

 Score =  114 bits (285), Expect = 3e-24
 Identities = 59/117 (50%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ 
Sbjct: 453 PPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPAPVQLPPVPPAPVQL 512

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   P
Sbjct: 513 PPVTPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAP 569

 Score =  112 bits (279), Expect = 2e-23
 Identities = 59/120 (49%), Positives = 72/120 (60%), Gaps = 3/120 (2%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ 
Sbjct: 463 PPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPAPVQLPPVPPAPVQLPPVTPAPVQL 522

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE---KPPVYKPP 360
           PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+   +P + KPP
Sbjct: 523 PPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLHLQPALLKPP 582

 Score =  110 bits (275), Expect = 5e-23
 Identities = 59/116 (50%), Positives = 59/116 (50%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   
Sbjct: 439 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPA 498

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PV  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PP
Sbjct: 499 PVQLPPVPPAPVQLPPVTPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPP 554

 Score =  110 bits (275), Expect = 5e-23
 Identities = 59/116 (50%), Positives = 59/116 (50%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   
Sbjct: 449 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPAPVQLPPVPPA 508

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PV  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PP
Sbjct: 509 PVQLPPVTPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPP 564

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 55/153 (35%), Positives = 68/153 (44%), Gaps = 39/153 (25%)
 Frame = +1

Query: 16  VYKPPVEKP----------PVYKPPVEKPPVYKPPVEKPPV------------------- 108
           V +PP  +P          PV  P  + PPV  P  E+ P                    
Sbjct: 128 VRRPPFSEPLESLLELCGTPVSAPVPQCPPVSAPAPEQAPSPDDNTLPSQTPRRRRHRRR 187

Query: 109 -----YKPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 258
                 +PPV  P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 188 TAHVPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 247

Query: 259 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
             P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 248 SAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 280

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 48/139 (34%), Positives = 61/139 (43%), Gaps = 29/139 (20%)
 Frame = +1

Query: 28  PVEKPPVYKPPVEKP----------PVYKPPVEKPPVYKPPVEKPPVYKP---PVEKPP- 165
           P  +  V +PP  +P          PV  P  + PPV  P  E+ P       P + P  
Sbjct: 122 PYPRRAVRRPPFSEPLESLLELCGTPVSAPVPQCPPVSAPAPEQAPSPDDNTLPSQTPRR 181

Query: 166 ----------VYKPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPP 300
                       +PPV  P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P 
Sbjct: 182 RRHRRRTAHVPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 241

Query: 301 VEKPPVYKPPVEKPPVYKP 357
            E+PPV  P  E+PPV  P
Sbjct: 242 PERPPVSAPAPERPPVSAP 260

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 38/115 (33%), Positives = 50/115 (43%)
 Frame = +3

Query: 6   EASSVQTSC*ETPSVQAPS*EAPSLQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS* 185
           E   V     E P V AP+ E P +     E   V  P  E P +     E   V AP+ 
Sbjct: 223 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 282

Query: 186 ETPSLQAPGREAPSLQAPS*ETTSVQAPSREATGVQASS*EATRVQAPS*EATCL 350
           E P + AP  E P + AP+ E   V AP+ E   V A + E   V AP+ E + +
Sbjct: 283 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPECSSM 337

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 35/108 (32%), Positives = 46/108 (42%)
 Frame = +3

Query: 6   EASSVQTSC*ETPSVQAPS*EAPSLQTSGREATSVQTPG*EAPSLQTSGGEATSVQAPS* 185
           E   V     E P V AP+ E P +     E   V  P  E P +     E   V AP+ 
Sbjct: 233 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 292

Query: 186 ETPSLQAPGREAPSLQAPS*ETTSVQAPSREATGVQASS*EATRVQAP 329
           E P + AP  E P + AP+ E   V AP+ E   V A + E + +  P
Sbjct: 293 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPECSSMPVP 340

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 37/123 (30%), Positives = 50/123 (40%), Gaps = 5/123 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  P  +  V +PP  +P      +   PV  P    PPV  P   + P           
Sbjct: 119 ELRPYPRRAVRRPPFSEPLESLLELCGTPVSAPVPQCPPVSAPAPEQAPSPDDNTLPSQT 178

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPV 348
            +   ++      P  +PPV  P   +PPV     E+PPV  P  E+PPV  P  E+PPV
Sbjct: 179 PRRRRHRRRTAHVPE-RPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 237

Query: 349 YKP 357
             P
Sbjct: 238 SAP 240

[57][TOP]
>UniRef100_Q2TCL0 Foot protein 1 variant 1 n=1 Tax=Mytilus californianus
           RepID=Q2TCL0_MYTCA
          Length = 732

 Score =  125 bits (315), Expect = 1e-27
 Identities = 55/116 (47%), Positives = 60/116 (51%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YK     PP YKP +  PP YKP    P  YK     
Sbjct: 289 PPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTY 348

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P
Sbjct: 349 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQP 404

 Score =  124 bits (312), Expect = 2e-27
 Identities = 55/115 (47%), Positives = 59/115 (51%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YKP    PP YKP +  PP YKP    PP YK     PP YKP +  PP YKP    
Sbjct: 279 PSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSY 338

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK
Sbjct: 339 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYK 393

 Score =  124 bits (311), Expect = 3e-27
 Identities = 55/116 (47%), Positives = 59/116 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    
Sbjct: 249 PPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSY 308

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP
Sbjct: 309 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKP 364

 Score =  123 bits (309), Expect = 6e-27
 Identities = 55/116 (47%), Positives = 59/116 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     P  YKP    PP YKP +  PP YKP    PP YK     PP YKP +  
Sbjct: 269 PPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITY 328

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP    P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP
Sbjct: 329 PPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKP 384

 Score =  120 bits (301), Expect = 5e-26
 Identities = 54/116 (46%), Positives = 57/116 (49%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 219 PSTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSY 278

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P  YKP    PP YKP +  PP YKP    PP YK     PP YKP +  PP YKP
Sbjct: 279 PSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKP 334

 Score =  120 bits (300), Expect = 6e-26
 Identities = 59/136 (43%), Positives = 63/136 (46%), Gaps = 20/136 (14%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYK  +  PP YKP +  PP YKP    PP YKP    PP YK     P  YKP    
Sbjct: 129 PPVYKHKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSY 188

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYK---------------PPVEK-----PPVYKPPVEK 309
           PP YKP +  PP YKP    PP YK               PP  K     P  YKP    
Sbjct: 189 PPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKAKKTYPSTYKPKPSY 248

Query: 310 PPVYKPPVEKPPVYKP 357
           PP YKP +  PP YKP
Sbjct: 249 PPTYKPKITYPPTYKP 264

 Score =  120 bits (300), Expect = 6e-26
 Identities = 54/116 (46%), Positives = 57/116 (49%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YK     P  YKP    PP YK     P  YKP    
Sbjct: 189 PPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKAKKTYPSTYKPKPSY 248

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP +  PP YKP    PP YK     P  YKP    PP YKP +  PP YKP
Sbjct: 249 PPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKP 304

 Score =  120 bits (300), Expect = 6e-26
 Identities = 53/116 (45%), Positives = 58/116 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  P  YK     PP YK     PP YKP +  PP YKP    P  YK     
Sbjct: 459 PPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTY 518

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P
Sbjct: 519 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQP 574

 Score =  119 bits (298), Expect = 1e-25
 Identities = 54/116 (46%), Positives = 58/116 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP    PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  
Sbjct: 299 PPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITY 358

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P     P YKP
Sbjct: 359 PPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKP 414

 Score =  118 bits (295), Expect = 2e-25
 Identities = 53/115 (46%), Positives = 58/115 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP YKP +  
Sbjct: 319 PPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITY 378

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP    PP YK     PP Y+P     P YKP    PP YK  +  PP YK
Sbjct: 379 PPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYK 433

 Score =  118 bits (295), Expect = 2e-25
 Identities = 53/115 (46%), Positives = 58/115 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP YKP +  
Sbjct: 489 PPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITY 548

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP    PP YK     PP Y+P     P YKP    PP YK  +  PP YK
Sbjct: 549 PPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYK 603

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/113 (46%), Positives = 56/113 (49%)
 Frame = +1

Query: 16  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 195
           VYK     PPVYK  +  PP YKP +  PP YKP    PP YKP    PP YK     P 
Sbjct: 121 VYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPS 180

Query: 196 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
            YKP    PP YKP +  PP YKP    PP YK     P  YKP    PP YK
Sbjct: 181 TYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYK 233

 Score =  117 bits (292), Expect = 5e-25
 Identities = 53/115 (46%), Positives = 56/115 (48%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     P  YKP    PP YKP +  PP YKP    PP YK     P  YKP    
Sbjct: 229 PPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSY 288

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP +  PP YKP    PP YK     PP YKP +  PP YKP    P  YK
Sbjct: 289 PPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYK 343

 Score =  116 bits (290), Expect = 9e-25
 Identities = 53/115 (46%), Positives = 57/115 (49%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    
Sbjct: 309 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSY 368

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP +  PP YKP    PP YK     PP Y+P     P YKP    PP YK
Sbjct: 369 PPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYK 423

 Score =  116 bits (290), Expect = 9e-25
 Identities = 52/115 (45%), Positives = 56/115 (48%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YKP +  P  YK     PP YK     PP YKP +  PP YKP    
Sbjct: 449 PSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSY 508

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK
Sbjct: 509 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYK 563

 Score =  116 bits (290), Expect = 9e-25
 Identities = 53/115 (46%), Positives = 57/115 (49%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    
Sbjct: 479 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSY 538

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP +  PP YKP    PP YK     PP Y+P     P YKP    PP YK
Sbjct: 539 PPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYK 593

 Score =  115 bits (288), Expect = 2e-24
 Identities = 53/115 (46%), Positives = 55/115 (47%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 159 PPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSY 218

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK
Sbjct: 219 PSTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYK 273

 Score =  114 bits (286), Expect = 3e-24
 Identities = 55/126 (43%), Positives = 60/126 (47%), Gaps = 10/126 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPP----------VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 159
           PP+YKP  +K            VYK     PPVYK  +  PP YKP +  PP YKP    
Sbjct: 99  PPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSY 158

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 159 PPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSY 218

Query: 340 PPVYKP 357
           P  YKP
Sbjct: 219 PSTYKP 224

 Score =  112 bits (280), Expect = 1e-23
 Identities = 51/116 (43%), Positives = 55/116 (47%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     P  YK     PP YKP +  P  YK     PP YK     PP YKP +  
Sbjct: 439 PSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITY 498

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP    P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP
Sbjct: 499 PPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKP 554

 Score =  111 bits (277), Expect = 3e-23
 Identities = 51/116 (43%), Positives = 55/116 (47%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P    
Sbjct: 349 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTY 408

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            P YKP    PP YK  +  PP YK     P  YK     P  YK     PP YKP
Sbjct: 409 LPSYKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKP 464

 Score =  111 bits (277), Expect = 3e-23
 Identities = 51/116 (43%), Positives = 55/116 (47%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P    
Sbjct: 519 PPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTY 578

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            P YKP    PP YK  +  PP YK     P  YK     P  YK     PP YKP
Sbjct: 579 LPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKP 634

 Score =  109 bits (273), Expect = 8e-23
 Identities = 51/115 (44%), Positives = 56/115 (48%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P Y      PP+YKP  +K   YK       VYK     PPVYK  +  PP YKP +  P
Sbjct: 90  PTYGSKTNYPPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYP 149

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P YKP    PP YKP    PP YK     P  YKP    PP YKP +  PP YKP
Sbjct: 150 PTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKP 204

 Score =  109 bits (273), Expect = 8e-23
 Identities = 49/116 (42%), Positives = 55/116 (47%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     P  YK     PP YKP +  P  YK     PP YKP       YKP +  
Sbjct: 609 PASYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKPKPSYASSYKPKIRY 668

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP       YKP +  PP YKP +  PP YKP +  PP YKP +   P YKP
Sbjct: 669 PPTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKPKISYLPAYKP 724

 Score =  109 bits (273), Expect = 8e-23
 Identities = 48/114 (42%), Positives = 55/114 (48%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YKP +  P  YK     PP YKP       YKP +  PP YKP    
Sbjct: 619 PSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSY 678

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
              YKP +  PP YKP +  PP YKP +  PP YKP +   P YKP +  P  Y
Sbjct: 679 ASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKPKISYLPAYKPKISYPSQY 732

 Score =  108 bits (270), Expect = 2e-22
 Identities = 49/116 (42%), Positives = 54/116 (46%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     P  YK     P  YK     PP YKP +  P  YK     PP YKP    
Sbjct: 599 PPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKPKPSY 658

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
              YKP +  PP YKP       YKP +  PP YKP +  PP YKP +  PP YKP
Sbjct: 659 ASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKP 714

 Score =  107 bits (266), Expect = 5e-22
 Identities = 49/116 (42%), Positives = 53/116 (45%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK  +  PP YK     P  YK     P  YK     PP YKP +  P  YK     
Sbjct: 419 PPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSY 478

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP
Sbjct: 479 PPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKP 534

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/115 (42%), Positives = 53/115 (46%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 339 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASY 398

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP Y+P     P YKP    PP YK  +  PP YK     P  YK     P  YK
Sbjct: 399 PPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYK 453

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/115 (42%), Positives = 53/115 (46%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     
Sbjct: 509 PTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASY 568

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP Y+P     P YKP    PP YK  +  PP YK     P  YK     P  YK
Sbjct: 569 PPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYK 623

 Score =  102 bits (255), Expect = 1e-20
 Identities = 50/117 (42%), Positives = 54/117 (46%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KP  Y P     P Y      PP+YKP  +K   YK       VYK     PPVYK  + 
Sbjct: 78  KPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKIT 137

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            PP YKP +  PP YKP    PP YKP    PP YK     P  YKP    PP YKP
Sbjct: 138 NPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKP 194

 Score =  102 bits (253), Expect = 2e-20
 Identities = 51/125 (40%), Positives = 56/125 (44%), Gaps = 10/125 (8%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P YKP    PP YK  +  PP YK     P  YK     P  YK     PP YKP +  P
Sbjct: 580 PSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYP 639

Query: 193 PVYK-----PPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
             YK     PP  KP       YKP +  PP YKP       YKP +  PP YKP +  P
Sbjct: 640 STYKTKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYP 699

Query: 343 PVYKP 357
           P YKP
Sbjct: 700 PTYKP 704

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 54/145 (37%), Positives = 58/145 (40%), Gaps = 30/145 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 174
           PP YKP +  PP YKP    PP YK     PP Y+P     P YKP    PP YK     
Sbjct: 369 PPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISY 428

Query: 175 PPVEK-------------------------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 279
           PP  K                         PP YKP +  P  YK     PP YK     
Sbjct: 429 PPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKAKKTY 488

Query: 280 PPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP +  PP YKP    P  YK
Sbjct: 489 PPTYKPKITYPPTYKPKPSYPTSYK 513

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 56/146 (38%), Positives = 60/146 (41%), Gaps = 30/146 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKP-----PVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 159
           PP YKP    PP YKP     P  K     PP YK     PP Y+P     P YKP    
Sbjct: 359 PPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTY 418

Query: 160 PPVYKPPVEKPPVYK---------------PPVEK-----PPVYKPPVEKPPVYKPPVEK 279
           PP YK  +  PP YK               P   K     PP YKP +  P  YK     
Sbjct: 419 PPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSY 478

Query: 280 PPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YK     PP YKP +  PP YKP
Sbjct: 479 PPTYKAKKTYPPTYKPKITYPPTYKP 504

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 51/126 (40%), Positives = 54/126 (42%), Gaps = 10/126 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKP-----PVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 159
           PP YKP    PP YKP     P  K     PP YK     PP Y+P     P YKP    
Sbjct: 529 PPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTY 588

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           PP YK  +  PP YK     P  YK     P  YK     PP YKP +  P  YK     
Sbjct: 589 PPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSY 648

Query: 340 PPVYKP 357
           PP YKP
Sbjct: 649 PPTYKP 654

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/111 (41%), Positives = 50/111 (45%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           P   KP  Y P     P Y      PP+YKP  +K   YK       VYK     PPVYK
Sbjct: 74  PAPYKPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYK 133

Query: 205 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
             +  PP YKP +  PP YKP    PP YKP    PP YK     P  YKP
Sbjct: 134 HKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKP 184

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 48/124 (38%), Positives = 52/124 (41%), Gaps = 10/124 (8%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKP 177
           PVYKP  + P  Y      P  YKP    P     P Y      PP+YKP  +K   YK 
Sbjct: 55  PVYKPMNKIPTSYISKKSYPAPYKPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKA 114

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKP 342
                 VYK     PPVYK  +  PP YKP          P YKP    PP YKP    P
Sbjct: 115 IKTTYLVYKAKTSYPPVYKHKITNPPTYKP-----KITYPPTYKPKPSYPPTYKPKPSYP 169

Query: 343 PVYK 354
           P YK
Sbjct: 170 PTYK 173

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 37/75 (49%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KP +  P     P YKP       YKP +  PP YKP +  PP YKP +  PP YKP + 
Sbjct: 663 KPKIRYP-----PTYKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKPKIS 717

Query: 187 KPPVYKPPVEKPPVY 231
             P YKP +  P  Y
Sbjct: 718 YLPAYKPKISYPSQY 732

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 38/106 (35%), Positives = 43/106 (40%)
 Frame = +1

Query: 43  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 222
           PVYKP  + P  Y      P  YKP       Y P     P Y      PP+YKP  +K 
Sbjct: 55  PVYKPMNKIPTSYISKKSYPAPYKPKG-----YHPTNSYQPTYGSKTNYPPIYKPVAKKL 109

Query: 223 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             YK       VYK     PPVYK  +  PP YKP      +  PP
Sbjct: 110 SSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKP-----KITYPP 150

[58][TOP]
>UniRef100_B9RUF0 Extensin, proline-rich protein, putative n=1 Tax=Ricinus communis
           RepID=B9RUF0_RICCO
          Length = 234

 Score =  125 bits (313), Expect = 2e-27
 Identities = 66/116 (56%), Positives = 68/116 (58%), Gaps = 4/116 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKP-PVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PPV KP    PPVYKPP     PV KPP    PPV KPP   PPVYKPP    PV KPP 
Sbjct: 47  PPVVKPTPTTPPVYKPPATPTTPVVKPPTSPAPPVVKPPTPSPPVYKPPTT--PVIKPPN 104

Query: 184 EKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPP 345
              PV KPP V  PPV KPP   PPV KPP   PPV KPP    PP++KPP   PP
Sbjct: 105 APSPVVKPPTVPAPPVVKPPTYSPPVAKPPTPAPPVVKPPSTPAPPMFKPPTPLPP 160

 Score =  124 bits (311), Expect = 3e-27
 Identities = 66/115 (57%), Positives = 68/115 (59%), Gaps = 4/115 (3%)
 Frame = +1

Query: 28  PVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVY 201
           PV  PPV KP    PPVYKPP     PV KPP    PPV KPP   PPVYKPP    PV 
Sbjct: 43  PVPAPPVVKPTPTTPPVYKPPATPTTPVVKPPTSPAPPVVKPPTPSPPVYKPPTT--PVI 100

Query: 202 KPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP 360
           KPP    PV KPP V  PPV KPP   PPV KPP   PPV KPP    PP++KPP
Sbjct: 101 KPPNAPSPVVKPPTVPAPPVVKPPTYSPPVAKPPTPAPPVVKPPSTPAPPMFKPP 155

 Score =  118 bits (295), Expect = 2e-25
 Identities = 65/117 (55%), Positives = 68/117 (58%), Gaps = 4/117 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKP-PVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP- 180
           PPVYKPP     PV KPP    PPV KPP   PPVYKPP    PV KPP    PV KPP 
Sbjct: 57  PPVYKPPATPTTPVVKPPTSPAPPVVKPPTPSPPVYKPPTT--PVIKPPNAPSPVVKPPT 114

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPV 348
           V  PPV KPP   PPV KPP   PPV KPP    PP++KPP   PP    P+  PPV
Sbjct: 115 VPAPPVVKPPTYSPPVAKPPTPAPPVVKPPSTPAPPMFKPPTPLPPPSGTPL--PPV 169

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/95 (52%), Positives = 53/95 (55%), Gaps = 1/95 (1%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPV 183
           KPP   PPV KPP    PV KPP    PV KPP V  PPV KPP Y PPV KPP   PPV
Sbjct: 83  KPPTPSPPVYKPPT--TPVIKPPNAPSPVVKPPTVPAPPVVKPPTYSPPVAKPPTPAPPV 140

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 288
            KP    P    PP++KPP   PP    P+  PPV
Sbjct: 141 VKP----PSTPAPPMFKPPTPLPPPSGTPL--PPV 169

[59][TOP]
>UniRef100_Q9FUR7 ENOD2 (Fragment) n=1 Tax=Styphnolobium japonicum RepID=Q9FUR7_SOPJA
          Length = 269

 Score =  124 bits (311), Expect = 3e-27
 Identities = 72/140 (51%), Positives = 91/140 (65%), Gaps = 23/140 (16%)
 Frame = +1

Query: 10  PPVYKPPVEK--PPVYKPPVEK--PPVYKPP--VEKPPVYKPP--VEKPPVYKPPVEK-- 159
           PPVY PP  +  PPV++PP  +  PP Y+PP  V+ PPVY+PP  V+ PPVY+PP     
Sbjct: 114 PPVYPPPHHEKPPPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEI 173

Query: 160 -PPVYKPP--VEKPPVYKPPVEK--PPVYKPPVEK--PPVYKPPVEK--PPVYKPP--VE 306
            PP Y+PP  V+ PPVY+PP  +  PPVY+PP  +  PPVY PP E   PP Y+PP  V+
Sbjct: 174 PPPEYQPPHHVKPPPVYQPPPHEKPPPVYQPPHHEIPPPVYPPPRENKPPPEYQPPPHVK 233

Query: 307 KPPVYKPPVEK--PPVYKPP 360
            PP Y+PP  +  PPVY PP
Sbjct: 234 PPPAYQPPPHEKPPPVYPPP 253

 Score =  123 bits (309), Expect = 6e-27
 Identities = 71/143 (49%), Positives = 92/143 (64%), Gaps = 23/143 (16%)
 Frame = +1

Query: 1   QEKPPVYKPPVEK--PPVYKPP--VEKPPVYKPP--VEKPPVYKPPVEK---PPVYKPP- 150
           ++ PPV++PP  +  PP Y+PP  V+ PPVY+PP  V+ PPVY+PP      PP Y+PP 
Sbjct: 123 EKPPPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPH 182

Query: 151 -VEKPPVYKPPVEK--PPVYKPPVEK--PPVYKPPVEK--PPVYKPP--VEKPPVYKPPV 303
            V+ PPVY+PP  +  PPVY+PP  +  PPVY PP E   PP Y+PP  V+ PP Y+PP 
Sbjct: 183 HVKPPPVYQPPPHEKPPPVYQPPHHEIPPPVYPPPRENKPPPEYQPPPHVKPPPAYQPPP 242

Query: 304 EK--PPVYKPP--VEKPPVYKPP 360
            +  PPVY PP   + PP Y PP
Sbjct: 243 HEKPPPVYPPPHHEKPPPAYPPP 265

 Score =  121 bits (304), Expect = 2e-26
 Identities = 73/143 (51%), Positives = 94/143 (65%), Gaps = 23/143 (16%)
 Frame = +1

Query: 1   QEKPPVYKPPVEK--PPVYKPP--VEKPPVYKPPVEK--PPVYKP-PVEK-PPVYKPP-- 150
           ++ PP Y+PP  +  PP Y+PP  V+ PPVY PP  +  PPV++P P EK PP Y+PP  
Sbjct: 87  EKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHEKPPPVHQPPPHEKPPPEYQPPPH 146

Query: 151 VEKPPVYKPP--VEKPPVYKPPVE---KPPVYKPP--VEKPPVYKPPVEK--PPVYKPPV 303
           V+ PPVY+PP  V+ PPVY+PP      PP Y+PP  V+ PPVY+PP  +  PPVY+PP 
Sbjct: 147 VKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHHVKPPPVYQPPPHEKPPPVYQPPH 206

Query: 304 EK--PPVYKPPVEK--PPVYKPP 360
            +  PPVY PP E   PP Y+PP
Sbjct: 207 HEIPPPVYPPPRENKPPPEYQPP 229

 Score =  117 bits (292), Expect = 5e-25
 Identities = 72/148 (48%), Positives = 92/148 (62%), Gaps = 28/148 (18%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYK--------PPVEK-PPVYKPP--VEKPPVYKPP--VEKPPVY 141
           Q  P V  PPV +PP ++        PP EK PP Y+PP  V+ PPVY PP   + PPV+
Sbjct: 70  QPPPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHEKPPPVH 129

Query: 142 KPPVEK--PPVYKPP--VEKPPVYKPP--VEKPPVYKPPVE---KPPVYKPP--VEKPPV 288
           +PP  +  PP Y+PP  V+ PPVY+PP  V+ PPVY+PP      PP Y+PP  V+ PPV
Sbjct: 130 QPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHHVKPPPV 189

Query: 289 YKPPVEK--PPVYKPPVEK--PPVYKPP 360
           Y+PP  +  PPVY+PP  +  PPVY PP
Sbjct: 190 YQPPPHEKPPPVYQPPHHEIPPPVYPPP 217

 Score =  115 bits (289), Expect = 1e-24
 Identities = 68/138 (49%), Positives = 88/138 (63%), Gaps = 21/138 (15%)
 Frame = +1

Query: 10  PPVYKPP--VEKPPVYKPPVEK--PPVYKPPVEK-PPVYKPPVEK--PPVYKPP--VEKP 162
           PPVY+PP   + PP Y PP  +  PPVY  P EK PP Y+PP  +  PP Y+PP  V+ P
Sbjct: 7   PPVYQPPHHEKPPPAYPPPHHEIPPPVYPSPHEKPPPEYQPPPHEKPPPEYQPPPHVKPP 66

Query: 163 PVYKPP--VEKPPVYKPP--VEKPPVYKPPVEK--PPVYKPP--VEKPPVYKPP--VEKP 312
           P Y+PP  V+ PPVY+PP   + PP Y+PP  +  PP Y+PP  V+ PPVY PP   + P
Sbjct: 67  PAYQPPPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHEKPP 126

Query: 313 PVYKPPVEK--PPVYKPP 360
           PV++PP  +  PP Y+PP
Sbjct: 127 PVHQPPPHEKPPPEYQPP 144

 Score =  111 bits (278), Expect = 2e-23
 Identities = 64/126 (50%), Positives = 79/126 (62%), Gaps = 15/126 (11%)
 Frame = +1

Query: 10  PPVYKPP--VEKPPVYKPPVEK---PPVYKPP--VEKPPVYKPPVEK--PPVYKPPVEK- 159
           PPVY+PP  V+ PPVY+PP      PP Y+PP  V+ PPVY+PP  +  PPVY+PP  + 
Sbjct: 150 PPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHHVKPPPVYQPPPHEKPPPVYQPPHHEI 209

Query: 160 -PPVYKPPVEK--PPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 324
            PPVY PP E   PP Y+PP  V+ PP Y+PP  + P   PPV  PP ++ P   PP Y 
Sbjct: 210 PPPVYPPPRENKPPPEYQPPPHVKPPPAYQPPPHEKP---PPVYPPPHHEKP---PPAYP 263

Query: 325 PPVEKP 342
           PP EKP
Sbjct: 264 PPHEKP 269

 Score =  109 bits (273), Expect = 8e-23
 Identities = 64/129 (49%), Positives = 83/129 (64%), Gaps = 19/129 (14%)
 Frame = +1

Query: 31  VEKPPVYKPPVEK--PPVYKPPVEK--PPVYKPPVEKPPV-YKPPVEK--PPVYKPP--V 183
           V+ PPVY+PP  +  PP Y PP  +  PPVY  P EKPP  Y+PP  +  PP Y+PP  V
Sbjct: 4   VKPPPVYQPPHHEKPPPAYPPPHHEIPPPVYPSPHEKPPPEYQPPPHEKPPPEYQPPPHV 63

Query: 184 EKPPVYKPP--VEKPPVYKPP--VEKPPVYKPPVEK--PPVYKPP--VEKPPVYKPP--V 333
           + PP Y+PP  V+ PPVY+PP   + PP Y+PP  +  PP Y+PP  V+ PPVY PP   
Sbjct: 64  KPPPAYQPPPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHE 123

Query: 334 EKPPVYKPP 360
           + PPV++PP
Sbjct: 124 KPPPVHQPP 132

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 39/80 (48%), Positives = 49/80 (61%), Gaps = 6/80 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEK--PPVYKPPVEK--PPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKP 162
           ++ PPVY+PP  +  PPVY PP E   PP Y+PP  V+ PP Y+PP  + P   PPV  P
Sbjct: 196 EKPPPVYQPPHHEIPPPVYPPPRENKPPPEYQPPPHVKPPPAYQPPPHEKP---PPVYPP 252

Query: 163 PVYKPPVEKPPVYKPPVEKP 222
           P ++ P   PP Y PP EKP
Sbjct: 253 PHHEKP---PPAYPPPHEKP 269

[60][TOP]
>UniRef100_Q5DNZ7 Putative proline-rich protein (Fragment) n=1 Tax=Nicotiana tabacum
           RepID=Q5DNZ7_TOBAC
          Length = 195

 Score =  124 bits (311), Expect = 3e-27
 Identities = 60/110 (54%), Positives = 69/110 (62%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 2   PPVVKPPINLPPVV-PPVIKPPIGIPPVTVPPVVKPPINLPPVV-PPVIKPPIGIPPVTV 59

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           PPV KPP+  PP+ KPP+  PP+  PPV  PPV  P  +  P   PP  K
Sbjct: 60  PPVLKPPIGLPPIVKPPINLPPIGIPPVTVPPVITPSPKGKPCPPPPTTK 109

 Score =  122 bits (307), Expect = 9e-27
 Identities = 59/107 (55%), Positives = 68/107 (63%)
 Frame = +1

Query: 40  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 219
           PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 2   PPVVKPPINLPPVV-PPVIKPPIGIPPVTVPPVVKPPINLPPVV-PPVIKPPIGIPPVTV 59

Query: 220 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV KPP+  PP+ KPP+  PP+  PPV  PPV  P  +  P   PP
Sbjct: 60  PPVLKPPIGLPPIVKPPINLPPIGIPPVTVPPVITPSPKGKPCPPPP 106

 Score =  102 bits (254), Expect = 1e-20
 Identities = 48/91 (52%), Positives = 56/91 (61%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PP+ KPP+ 
Sbjct: 20  KPPIGIPPVTVPPVVKPPINLPPVV-PPVIKPPIGIPPVTVPPVLKPPIGLPPIVKPPIN 78

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 279
            PP+  PPV  PPV  P  +  P   PP  K
Sbjct: 79  LPPIGIPPVTVPPVITPSPKGKPCPPPPTTK 109

[61][TOP]
>UniRef100_Q9M7N9 Proline-rich protein 3 n=1 Tax=Arabidopsis thaliana
           RepID=Q9M7N9_ARATH
          Length = 313

 Score =  123 bits (309), Expect = 6e-27
 Identities = 72/135 (53%), Positives = 74/135 (54%), Gaps = 18/135 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKP----PVYKPPVEKP----PVYKPPVEKPPVYKPPVEK----PPVYK--- 144
           PPVYK P  KP    PVY PPV KP    PVY  P   PPVY PPV K    PPVY    
Sbjct: 30  PPVYKSPEHKPTLPSPVYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPT 89

Query: 145 --PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPP 315
             PPV  PPVYKP +  PPVY  P   PPVY PPV KP P Y  P   PPVY PPV KP 
Sbjct: 90  IPPPVYTPPVYKPTL-SPPVYTKPTIPPPVYTPPVYKPTPDYTKPTIPPPVYTPPVYKPT 148

Query: 316 VYKPPVEKPPVYKPP 360
              P  +K P Y  P
Sbjct: 149 PSPPVYKKSPSYSSP 163

 Score =  110 bits (275), Expect = 5e-23
 Identities = 64/126 (50%), Positives = 66/126 (52%), Gaps = 10/126 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEK----PPVYK-----PPVEKPPVYKPPVEKPPVYKPPVEKP 162
           PPVY  P   PPVY PPV K    PPVY      PPV  PPVYKP +  PPVY  P   P
Sbjct: 58  PPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTL-SPPVYTKPTIPP 116

Query: 163 PVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           PVY PPV KP P Y  P   PPVY PPV KP    P  +K P Y  P   PP Y P    
Sbjct: 117 PVYTPPVYKPTPDYTKPTIPPPVYTPPVYKPTPSPPVYKKSPSYSSP---PPPYVPKPTY 173

Query: 340 PPVYKP 357
            P  KP
Sbjct: 174 TPTTKP 179

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 49/98 (50%), Positives = 49/98 (50%), Gaps = 10/98 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKP------PVYKPPVEKPPVYKPPVEK 159
           PPVY PPV KP    PVY  P   PPVY PPV KP      P   PPV  PPVYK P   
Sbjct: 92  PPVYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKPTPDYTKPTIPPPVYTPPVYK-PTPS 150

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 273
           PPVYK    K P Y  P   PP Y P     P  KP V
Sbjct: 151 PPVYK----KSPSYSSP---PPPYVPKPTYTPTTKPYV 181

[62][TOP]
>UniRef100_Q9M7P1 Proline-rich protein 1 n=1 Tax=Arabidopsis thaliana
           RepID=Q9M7P1_ARATH
          Length = 335

 Score =  122 bits (307), Expect = 9e-27
 Identities = 70/137 (51%), Positives = 73/137 (53%), Gaps = 21/137 (15%)
 Frame = +1

Query: 10  PPVYKPPVEKP----PVYKPPVEKP----PVYKPPVEK----PPVYKPPVEKPPVYKPPV 153
           PPVY  PV KP    PVY PPV KP    PVY PPV K    PPVY  P   PP Y PPV
Sbjct: 30  PPVYTSPVNKPTLPPPVYTPPVHKPTLPPPVYTPPVHKPTLSPPVYTKPTLPPPAYTPPV 89

Query: 154 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-- 327
              P    PV  PPVYKP +  PPVY  P   PPV+KP +  PPVY  P   P VYKP  
Sbjct: 90  YNKPTLPAPVYTPPVYKPTL-SPPVYTKPTLLPPVFKPTL-SPPVYTKPTLSPTVYKPTL 147

Query: 328 -------PVEKPPVYKP 357
                  P   PPVYKP
Sbjct: 148 SPPVNNKPSLSPPVYKP 164

 Score =  101 bits (252), Expect = 2e-20
 Identities = 60/130 (46%), Positives = 64/130 (49%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           PPVY  P    PVY PPV KP    PVY  P   PPV+KP +  PPVY  P   P VYKP
Sbjct: 87  PPVYNKPTLPAPVYTPPVYKPTLSPPVYTKPTLLPPVFKPTLS-PPVYTKPTLSPTVYKP 145

Query: 178 ---------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 330
                    P   PPVYKP +  PPVY  P   PPVYK    K P+Y PP        PP
Sbjct: 146 TLSPPVNNKPSLSPPVYKPTL-SPPVYTKPTLPPPVYK----KSPIYSPP--------PP 192

Query: 331 VEKPPVYKPP 360
               P Y PP
Sbjct: 193 FAPKPTYTPP 202

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 41/77 (53%), Positives = 45/77 (58%)
 Frame = +1

Query: 130 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 309
           PPVY  PV KP +  PPV  PPV+KP +  PPVY PPV KP +  PPV   P   PP   
Sbjct: 30  PPVYTSPVNKPTL-PPPVYTPPVHKPTLP-PPVYTPPVHKPTL-SPPVYTKPTLPPPAYT 86

Query: 310 PPVYKPPVEKPPVYKPP 360
           PPVY  P    PVY PP
Sbjct: 87  PPVYNKPTLPAPVYTPP 103

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 43/99 (43%), Positives = 46/99 (46%), Gaps = 9/99 (9%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKP---------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 162
           PPVY  P   P VYKP         P   PPVYKP +  PPVY  P   PPVYK    K 
Sbjct: 130 PPVYTKPTLSPTVYKPTLSPPVNNKPSLSPPVYKPTLS-PPVYTKPTLPPPVYK----KS 184

Query: 163 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 279
           P+Y PP        PP    P Y PP  KP  Y P + K
Sbjct: 185 PIYSPP--------PPFAPKPTYTPPT-KP--YVPEIIK 212

[63][TOP]
>UniRef100_Q9FZ35 Proline-rich protein 1 n=1 Tax=Arabidopsis thaliana
           RepID=Q9FZ35_ARATH
          Length = 335

 Score =  122 bits (307), Expect = 9e-27
 Identities = 70/137 (51%), Positives = 73/137 (53%), Gaps = 21/137 (15%)
 Frame = +1

Query: 10  PPVYKPPVEKP----PVYKPPVEKP----PVYKPPVEK----PPVYKPPVEKPPVYKPPV 153
           PPVY  PV KP    PVY PPV KP    PVY PPV K    PPVY  P   PP Y PPV
Sbjct: 30  PPVYTSPVNKPTLPPPVYTPPVHKPTLPPPVYTPPVHKPTLSPPVYTKPTLPPPAYTPPV 89

Query: 154 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-- 327
              P    PV  PPVYKP +  PPVY  P   PPV+KP +  PPVY  P   P VYKP  
Sbjct: 90  YNKPTLPAPVYTPPVYKPTL-SPPVYTKPTLLPPVFKPTL-SPPVYTKPTLSPTVYKPTL 147

Query: 328 -------PVEKPPVYKP 357
                  P   PPVYKP
Sbjct: 148 SPPVNNKPSLSPPVYKP 164

 Score =  106 bits (265), Expect = 7e-22
 Identities = 70/149 (46%), Positives = 72/149 (48%), Gaps = 32/149 (21%)
 Frame = +1

Query: 10  PPVYKPPVEKP----PVYKPPVEKPPVYKPPV-EKP----PVYKPPVEKP----PVYKPP 150
           PPVY PPV KP    PVY  P   PP Y PPV  KP    PVY PPV KP    PVY  P
Sbjct: 58  PPVYTPPVHKPTLSPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVYKPTLSPPVYTKP 117

Query: 151 VEKPPVYKP---------PVEKPPVYKP---------PVEKPPVYKPPVEKPPVYKPPVE 276
              PPV+KP         P   P VYKP         P   PPVYKP +  PPVY  P  
Sbjct: 118 TLLPPVFKPTLSPPVYTKPTLSPTVYKPTLSPPVNNKPSLSPPVYKPTL-SPPVYTKPTL 176

Query: 277 KPPVY-KPPVEKPPVYKPPVEKPPVYKPP 360
            PPVY K P   PP   PP    P Y PP
Sbjct: 177 PPPVYKKSPSYSPP---PPFAPKPTYTPP 202

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 41/77 (53%), Positives = 45/77 (58%)
 Frame = +1

Query: 130 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 309
           PPVY  PV KP +  PPV  PPV+KP +  PPVY PPV KP +  PPV   P   PP   
Sbjct: 30  PPVYTSPVNKPTL-PPPVYTPPVHKPTLP-PPVYTPPVHKPTL-SPPVYTKPTLPPPAYT 86

Query: 310 PPVYKPPVEKPPVYKPP 360
           PPVY  P    PVY PP
Sbjct: 87  PPVYNKPTLPAPVYTPP 103

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 44/104 (42%), Positives = 46/104 (44%), Gaps = 4/104 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           PPVY  P   P VYKP    PV   P   PPV KP +       PPVY  P   PPVYK 
Sbjct: 130 PPVYTKPTLSPTVYKPTLSPPVNNKPSLSPPVYKPTL------SPPVYTKPTLPPPVYK- 182

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 309
              K P Y PP        PP    P Y PP  KP  Y P + K
Sbjct: 183 ---KSPSYSPP--------PPFAPKPTYTPPT-KP--YVPEIIK 212

[64][TOP]
>UniRef100_Q40336 Proline-rich cell wall protein n=1 Tax=Medicago sativa
           RepID=Q40336_MEDSA
          Length = 381

 Score =  121 bits (304), Expect = 2e-26
 Identities = 76/143 (53%), Positives = 85/143 (59%), Gaps = 25/143 (17%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYK----PPVEKPPVYKPP--------------VEKPP-VYKPPVE- 126
           KPP + PP+ KPPV+K     P  KPPV+KPP                KPP V KPP   
Sbjct: 34  KPPTHHPPIVKPPVHKRRKYSPTPKPPVHKPPRYPPKPSPCPPPSSTPKPPHVPKPPHHP 93

Query: 127 KPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVY--KPPVEKPP-VY 291
           KPPV  PP V KPPV+ P V KPP+ KPP+  PP V KPPV KPP Y  KPPV +PP V 
Sbjct: 94  KPPVVHPPHVPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPPYVP 153

Query: 292 KPPVEKPPVYKPPVEKPPVYKPP 360
           KPPV   PV  P V KPPV +PP
Sbjct: 154 KPPV--VPVTPPYVPKPPVVRPP 174

 Score =  113 bits (283), Expect = 6e-24
 Identities = 72/157 (45%), Positives = 82/157 (52%), Gaps = 39/157 (24%)
 Frame = +1

Query: 7   KPPVYKPPVEKPP-VYKPPVEKPPVY--KPPVEKPP-VYKPPV--------EKPPVYKPP 150
           KPP+ KPP+  PP V KPPV KPP Y  KPPV +PP V KPPV         KPPV +PP
Sbjct: 115 KPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPVVRPP 174

Query: 151 -VEKPPVY--------KPPVEKPPVYKPP-------VEKPPVY--KPPVEKPPVYKP--- 267
            V KPPV         KPP+ KPP+  PP       V  PP Y   PP+ KPP+  P   
Sbjct: 175 YVPKPPVVPVTPPYVPKPPIVKPPIVFPPHVPLPPVVPSPPPYVPSPPIVKPPIVFPPHV 234

Query: 268 ------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
                 PV  P V  PP+  PP   PP+  PPV  PP
Sbjct: 235 PLPPVVPVTPPYVQPPPIVTPPTPTPPIVTPPVVSPP 271

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 59/120 (49%), Positives = 67/120 (55%), Gaps = 29/120 (24%)
 Frame = +1

Query: 88  PVEKPPVYKPPVEKPPVYK----PPVEKPPVYKPP--------------------VEKPP 195
           P  KPP + PP+ KPPV+K     P  KPPV+KPP                    V KPP
Sbjct: 31  PSPKPPTHHPPIVKPPVHKRRKYSPTPKPPVHKPPRYPPKPSPCPPPSSTPKPPHVPKPP 90

Query: 196 VY-KPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPP 360
            + KPPV  PP V KPPV  P V KPP+ KPP+  PP V KPPV KPP  V KPPV +PP
Sbjct: 91  HHPKPPVVHPPHVPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPP 150

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 67/166 (40%), Positives = 76/166 (45%), Gaps = 48/166 (28%)
 Frame = +1

Query: 7   KPPVYKPP--VEKPPVYKPP--------------VEKPPVYKPP-VEKPPVY-------- 111
           KPPV KPP  V KPPV +PP              V KPPV +PP V KPPV         
Sbjct: 131 KPPVVKPPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPVVRPPYVPKPPVVPVTPPYVP 190

Query: 112 KPPVEKPPVYKPP-------VEKPPVY--KPPVEKPPVYKPP--------------VEKP 222
           KPP+ KPP+  PP       V  PP Y   PP+ KPP+  PP              V+ P
Sbjct: 191 KPPIVKPPIVFPPHVPLPPVVPSPPPYVPSPPIVKPPIVFPPHVPLPPVVPVTPPYVQPP 250

Query: 223 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P+  PP   PP+  PPV  PP   PP E P    P V  PP   PP
Sbjct: 251 PIVTPPTPTPPIVTPPVVSPPT--PPSETPCPPPPLVPYPPT--PP 292

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 56/135 (41%), Positives = 66/135 (48%), Gaps = 24/135 (17%)
 Frame = +1

Query: 7   KPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-------VEKPPVY--KPPVE 156
           KPPV +PP V KPPV   PV  P V KPP+ KPP+  PP       V  PP Y   PP+ 
Sbjct: 167 KPPVVRPPYVPKPPVV--PVTPPYVPKPPIVKPPIVFPPHVPLPPVVPSPPPYVPSPPIV 224

Query: 157 KPPVYKPP--------------VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 294
           KPP+  PP              V+ PP+  PP   PP+  PPV  PP   PP E P    
Sbjct: 225 KPPIVFPPHVPLPPVVPVTPPYVQPPPIVTPPTPTPPIVTPPVVSPPT--PPSETPCPPP 282

Query: 295 PPVEKPPVYKPPVEK 339
           P V  PP   PP ++
Sbjct: 283 PLVPYPPT--PPAQQ 295

[65][TOP]
>UniRef100_O82066 Proline-rich protein n=1 Tax=Solanum tuberosum RepID=O82066_SOLTU
          Length = 491

 Score =  121 bits (303), Expect = 3e-26
 Identities = 83/176 (47%), Positives = 92/176 (52%), Gaps = 60/176 (34%)
 Frame = +1

Query: 13  PVYKPPVEKPPV--YKP----PVEKP-----------PVYKPPVEKPPVYKP-PVEKPPV 138
           PVYKP  + PPV  YKP    PV+KP           PV KP   K P YKP P  +PPV
Sbjct: 283 PVYKPKPKPPPVPTYKPKPEPPVKKPCPPSVPKPKPPPVKKPCPPKVPTYKPKPKPEPPV 342

Query: 139 YKPPVEKPPVYKPPVEKP-----PVYKPPVEKP-----PVYKPPVEKP-----PVYK--- 264
            KP     PVYKPPV KP     PVYKPPV KP     PVYKPPV KP     P+YK   
Sbjct: 343 VKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPIYKKPC 402

Query: 265 ---------PPVEKP-----PVYKPPVEKP-----PVYKPPVEKP-----PVYKPP 360
                    PP+ KP     P+Y PPV KP     P+Y+PPV KP     P+YKPP
Sbjct: 403 PPFPHLPPLPPIVKPLPPPVPIYVPPVVKPLPPPVPIYEPPVVKPLPPPVPIYKPP 458

 Score =  120 bits (301), Expect = 5e-26
 Identities = 72/145 (49%), Positives = 79/145 (54%), Gaps = 28/145 (19%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKP--- 162
           PPV KP   K P YKP P  +PPV KP     PVYKPPV KP     PVYKPPV KP   
Sbjct: 319 PPVKKPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPP 378

Query: 163 --PVYKPPVEKP-----PVYKPPVEK-------PPVYKPPVEKPPVYKPPVEKP-----P 285
             PVYKPPV KP     P+YK P          PP+ KP     P+Y PPV KP     P
Sbjct: 379 PVPVYKPPVVKPLPPPVPIYKKPCPPFPHLPPLPPIVKPLPPPVPIYVPPVVKPLPPPVP 438

Query: 286 VYKPPVEKPPVYKPPVEKPPVYKPP 360
           +Y+PPV KP     P+ KPP YK P
Sbjct: 439 IYEPPVVKPLPPPVPIYKPPFYKKP 463

 Score =  116 bits (291), Expect = 7e-25
 Identities = 78/155 (50%), Positives = 85/155 (54%), Gaps = 37/155 (23%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKP--PVYKPPVEKP--PVYKPPVEKPPV--YK----PPVE 156
           +PPV KP     PVYKP  + P  PVYKP  + P  PVYKP  + PPV  YK    PPV+
Sbjct: 247 EPPVVKPLPPPVPVYKPKPKPPPVPVYKPKPKPPPVPVYKPKPKPPPVPTYKPKPEPPVK 306

Query: 157 K-----------PPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKP-----P 285
           K           PPV KP   K P YKP P  +PPV KP     PVYKPPV KP     P
Sbjct: 307 KPCPPSVPKPKPPPVKKPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVP 366

Query: 286 VYKPPVEKP-----PVYKPPVEKP-----PVYKPP 360
           VYKPPV KP     PVYKPPV KP     P+YK P
Sbjct: 367 VYKPPVVKPLPPPVPVYKPPVVKPLPPPVPIYKKP 401

 Score =  112 bits (280), Expect = 1e-23
 Identities = 80/162 (49%), Positives = 86/162 (53%), Gaps = 45/162 (27%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKP---PVEKPPVYKPPVEKPPVYKPPVEKP--PVYKPPVEKP--PV 168
           PP+ KPPV   PVY P   P  +PPV KP     PVYKP  + P  PVYKP  + P  PV
Sbjct: 228 PPLVKPPV---PVYNPTPKPTPEPPVVKPLPPPVPVYKPKPKPPPVPVYKPKPKPPPVPV 284

Query: 169 YKPPVEKPPV--YK----PPVEK-----------PPVYKPPVEKPPVYK------PPVEK 279
           YKP  + PPV  YK    PPV+K           PPV KP   K P YK      PPV K
Sbjct: 285 YKPKPKPPPVPTYKPKPEPPVKKPCPPSVPKPKPPPVKKPCPPKVPTYKPKPKPEPPVVK 344

Query: 280 P-----PVYKPPVEKP-----PVYKPPVEKP-----PVYKPP 360
           P     PVYKPPV KP     PVYKPPV KP     PVYKPP
Sbjct: 345 PLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPP 386

 Score =  101 bits (251), Expect = 3e-20
 Identities = 68/151 (45%), Positives = 77/151 (50%), Gaps = 43/151 (28%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKP-----PVYKPPVEKP-----PVY 141
           +PPV KP     PVYKPPV KP     PVYKPPV KP     PVYKPPV KP     P+Y
Sbjct: 339 EPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPIY 398

Query: 142 K------------PPVEKP-----PVYKPPVEKP-----PVYKPPVEKP-----PVYKPP 240
           K            PP+ KP     P+Y PPV KP     P+Y+PPV KP     P+YKPP
Sbjct: 399 KKPCPPFPHLPPLPPIVKPLPPPVPIYVPPVVKPLPPPVPIYEPPVVKPLPPPVPIYKPP 458

Query: 241 VEKPPVYK-PPVEKPPVYKPPVEKPPVYKPP 330
             K P    PP  K P +  P+  P   K P
Sbjct: 459 FYKKPCPPLPPFPKIPPFHHPLFPPLPPKIP 489

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 61/126 (48%), Positives = 68/126 (53%), Gaps = 10/126 (7%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---PVEKPPVYKPPVEKPPVYKPPV 183
           P   PP+  PP++K P   PP+ KPPV   PVY P   P  +PPV KP     PVYKP  
Sbjct: 212 PFPLPPI--PPLFKKPCP-PPLVKPPV---PVYNPTPKPTPEPPVVKPLPPPVPVYKPKP 265

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKP-----PVEKP 342
           + PPV   PV KP    PPV   PVYKP  + PPV  YKP  E PPV KP     P  KP
Sbjct: 266 KPPPV---PVYKPKPKPPPV---PVYKPKPKPPPVPTYKPKPE-PPVKKPCPPSVPKPKP 318

Query: 343 PVYKPP 360
           P  K P
Sbjct: 319 PPVKKP 324

[66][TOP]
>UniRef100_A7S8Z4 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis
           RepID=A7S8Z4_NEMVE
          Length = 160

 Score =  120 bits (302), Expect = 4e-26
 Identities = 68/119 (57%), Positives = 74/119 (62%), Gaps = 2/119 (1%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KP V KP + KP VYKP V KP V+KP V KP   KP V KP V KP V KP   KP V 
Sbjct: 9   KPRVLKPLLHKPRVYKPCVLKPLVHKPRVLKPRALKPLVHKPRVLKPCVHKPRALKPCVH 68

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           KP V+KP V KP V+KP V  P V+K  P V KP V+KP V KP V KP V KP V KP
Sbjct: 69  KPCVHKPRVHKPRVHKPLVHNPRVHKPRPHVHKPRVHKPRVHKPRVLKPHVHKPRVLKP 127

 Score =  118 bits (295), Expect = 2e-25
 Identities = 66/119 (55%), Positives = 72/119 (60%), Gaps = 2/119 (1%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-- 180
           KP   KP V KP V KP V KP   KP V KP V+KP V KP V+KP V  P V+KP   
Sbjct: 39  KPRALKPLVHKPRVLKPCVHKPRALKPCVHKPCVHKPRVHKPRVHKPLVHNPRVHKPRPH 98

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           V KP V+KP V KP V KP V KP V KP   KP V  P V KP V+KP V KP V+KP
Sbjct: 99  VHKPRVHKPRVHKPRVLKPHVHKPRVLKPLALKPLVNNPRVHKPRVHKPHVHKPSVHKP 157

 Score =  117 bits (294), Expect = 3e-25
 Identities = 65/117 (55%), Positives = 76/117 (64%), Gaps = 2/117 (1%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPP 180
           KP V+KP V KP V+KP   KP V+KP V KP V+KP V KP V+ P V KP   V+KP 
Sbjct: 44  KPLVHKPRVLKPCVHKPRALKPCVHKPCVHKPRVHKPRVHKPLVHNPRVHKPRPHVHKPR 103

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           V KP V+KP V KP V+KP V KP   KP V  P V+KP V KP V+KP V KP V+
Sbjct: 104 VHKPRVHKPRVLKPHVHKPRVLKPLALKPLVNNPRVHKPRVHKPHVHKPSVHKPRVH 160

 Score =  116 bits (291), Expect = 7e-25
 Identities = 66/117 (56%), Positives = 73/117 (62%), Gaps = 2/117 (1%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV+K  V KP V KP + KP VYKP V KP V+KP V KP   KP V KP V KP V KP
Sbjct: 1   PVHKLLVHKPRVLKPLLHKPRVYKPCVLKPLVHKPRVLKPRALKPLVHKPRVLKPCVHKP 60

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKP 357
              KP V KP V+KP V KP V+KP V  P V+K  P V KP V+KP V KP V KP
Sbjct: 61  RALKPCVHKPCVHKPRVHKPRVHKPLVHNPRVHKPRPHVHKPRVHKPRVHKPRVLKP 117

[67][TOP]
>UniRef100_A8DV67 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis
           RepID=A8DV67_NEMVE
          Length = 140

 Score =  120 bits (300), Expect = 6e-26
 Identities = 66/117 (56%), Positives = 75/117 (64%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KP V KP V KP V KP V KP V +P V KP V +P V KP V KP V KP   KP V 
Sbjct: 9   KPRVLKPLVHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPLVH 68

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           KP V+KP V KP V+KP V KP V+KP V KP V+KP V  P V+KP V +P V+KP
Sbjct: 69  KPCVHKPCVHKPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQPHVHKP 125

 Score =  120 bits (300), Expect = 6e-26
 Identities = 66/117 (56%), Positives = 75/117 (64%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KP V KP V KP V +P V KP V +P V KP V KP V KP   KP V KP V+KP V 
Sbjct: 19  KPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPLVHKPCVHKPCVH 78

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           KP V+KP V KP V+KP V KP V+KP V  P V+KP V +P V+KP V KP V KP
Sbjct: 79  KPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQPHVHKPLVNKPRVLKP 135

 Score =  119 bits (298), Expect = 1e-25
 Identities = 66/117 (56%), Positives = 79/117 (67%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KP V+KP V KP V+KP V +P V+KP V +P V+KP V KP V+KP   KP V+KP V 
Sbjct: 14  KPLVHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPLVHKPCVH 73

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           KP V+KP V KP V+KP V KP V+KP V KP V+ P V KP V +P V KP V KP
Sbjct: 74  KPCVHKPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQPHVHKPLVNKP 130

 Score =  117 bits (293), Expect = 4e-25
 Identities = 65/115 (56%), Positives = 73/115 (63%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV+K  V KP V KP V KP V KP V KP V +P V KP V +P V KP V KP V KP
Sbjct: 1   PVHKLLVHKPRVLKPLVHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKP 60

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
              KP V KP V+KP V KP V+KP V KP V+KP V KP V+KP V  P V+KP
Sbjct: 61  RALKPLVHKPCVHKPCVHKPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKP 115

 Score =  116 bits (291), Expect = 7e-25
 Identities = 65/117 (55%), Positives = 77/117 (65%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KP V+KP V +P V+KP V +P V+KP V KP V+KP   KP V+KP V KP V+KP V 
Sbjct: 24  KPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPLVHKPCVHKPCVHKPCVH 83

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           KP V+KP V KP V+KP V KP V+ P V KP V +P V KP V KP V KP   KP
Sbjct: 84  KPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQPHVHKPLVNKPRVLKPLALKP 140

 Score =  116 bits (290), Expect = 9e-25
 Identities = 64/114 (56%), Positives = 78/114 (68%)
 Frame = +1

Query: 16  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 195
           V+KP V KP V+KP V KP V+KP V +P V+KP V +P V+KP V KP V+KP   KP 
Sbjct: 7   VHKPRVLKPLVHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPL 66

Query: 196 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           V+KP V KP V+KP V KP V+KP V KP V+KP V KP V+ P V KP V +P
Sbjct: 67  VHKPCVHKPCVHKPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQP 120

[68][TOP]
>UniRef100_A6LW67 Cytochrome b5 n=1 Tax=Clostridium beijerinckii NCIMB 8052
           RepID=A6LW67_CLOB8
          Length = 325

 Score =  119 bits (299), Expect = 8e-26
 Identities = 60/117 (51%), Positives = 84/117 (71%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           GG  TGG + GG+ TGG + GG+ TGG ++GG+ TGG + GG+ TGG + GG+ TGG + 
Sbjct: 194 GGPSTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTG 253

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
           GG+ TGG + GG+ TGG ++GG+ TGG ++GG+ TGG + GG  TGG + GG+ TGG
Sbjct: 254 GGMGTGGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGGTTGGGMGTGG 310

 Score =  113 bits (283), Expect = 6e-24
 Identities = 56/111 (50%), Positives = 80/111 (72%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           GG+ TGG + GG+ TGG ++GG+ TGG + GG+ TGG + GG+ TGG + GG+ TGG + 
Sbjct: 204 GGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGTGGTTG 263

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTG 27
           GG+ TGG ++GG+ TGG ++GG+ TGG + GG  TGG + GG+ TGG + G
Sbjct: 264 GGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGGTTGGGMGTGGTTRG 314

 Score =  110 bits (275), Expect = 5e-23
 Identities = 58/116 (50%), Positives = 61/116 (52%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           GG   GG  TGG   GG  TGG  +GG  TGG   GG  TGG   GG  TGG   GG  T
Sbjct: 199 GGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGT 258

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           GG   GG  TGG  +GG  TGG  +GG  TGG   GG  TGG   GG  TGG   G
Sbjct: 259 GGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGGTTGGGMGTGGTTRG 314

 Score =  102 bits (255), Expect = 1e-20
 Identities = 55/114 (48%), Positives = 79/114 (69%), Gaps = 1/114 (0%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFST-GGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGL 171
           TG  +  G  + G +T GG+ TGG + GG+ TGG ++GG+ TGG + GG+ TGG + GG+
Sbjct: 187 TGATTLLGGPSTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGM 246

Query: 170 YTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
            TGG + GG+ TGG + GG+ TGG ++GG+ TGG ++GG+ TGG + GG  TGG
Sbjct: 247 GTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGG 300

[69][TOP]
>UniRef100_UPI00019859A1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019859A1
          Length = 377

 Score =  119 bits (298), Expect = 1e-25
 Identities = 62/121 (51%), Positives = 62/121 (51%), Gaps = 4/121 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKP 177
           P  YK P   PPVYK   P   PPVY PP   P  YK P   PPV  YK P   PPVY P
Sbjct: 42  PYYYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSP 101

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P   P  YK P   PPVY PP   P  YK P   PPVY PP   P  YK P   PPVY P
Sbjct: 102 PHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSP 161

Query: 358 P 360
           P
Sbjct: 162 P 162

 Score =  116 bits (291), Expect = 7e-25
 Identities = 64/129 (49%), Positives = 64/129 (49%), Gaps = 14/129 (10%)
 Frame = +1

Query: 10  PPVYK-------PPVEKPP-----VYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKP 147
           PPVYK       PPV  PP      YK P   PPV  YK P   PPVY PP   P  YK 
Sbjct: 52  PPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKS 111

Query: 148 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 327
           P   PPVY PP   P  YK P   PPVY PP   P  YK P   PPVY PP   P  YK 
Sbjct: 112 PPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKS 171

Query: 328 PVEKPPVYK 354
           P   PPVYK
Sbjct: 172 PPPPPPVYK 180

 Score =  116 bits (291), Expect = 7e-25
 Identities = 65/134 (48%), Positives = 66/134 (49%), Gaps = 17/134 (12%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK-----PPVEK-------PPVYKPPVEKPPVYKPPVEKPPVYKPPV 153
           PPVY PP   P  YK     PPV K       PPVY PP   P  YK P   PPVY PP 
Sbjct: 64  PPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPH 123

Query: 154 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--- 324
             P  YK P   PPVY PP   P  YK P   PPVY PP   P  YK P   PPVYK   
Sbjct: 124 HPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKS 183

Query: 325 --PPVEKPPVYKPP 360
             PP +KP  YK P
Sbjct: 184 PPPPHKKPYKYKSP 197

 Score =  113 bits (283), Expect = 6e-24
 Identities = 62/124 (50%), Positives = 63/124 (50%), Gaps = 7/124 (5%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PPVYK   P   PPVY PP   P  YK P   PPVY PP   P  YK P   PPVY PP 
Sbjct: 84  PPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPH 143

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKPPVYKPPVEKPPV 348
             P  YK P   PPVY PP   P  YK P   PPVYK     PP +KP  YK P   PP 
Sbjct: 144 HPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSP--PPPP 201

Query: 349 YKPP 360
           Y  P
Sbjct: 202 YNLP 205

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 59/124 (47%), Positives = 61/124 (49%), Gaps = 9/124 (7%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPV-YKPPVEKPPVYK----PPVEKPPVYKPPVEKPPV 168
           PPVYK   P   PPV+ PP   PP  YK P   PPVYK    PP   P  YK P   P  
Sbjct: 230 PPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYK 289

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKP 342
           YK P   P  YK P   P  YK P   PPVYK     PPV  YK P   P +YK P   P
Sbjct: 290 YKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPYMYKSPPPPP 349

Query: 343 PVYK 354
           PVYK
Sbjct: 350 PVYK 353

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 65/158 (41%), Positives = 68/158 (43%), Gaps = 42/158 (26%)
 Frame = +1

Query: 7   KPPVYKPPVEKPP-----VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 171
           K P   PPV  PP      YK P   PPVY PP   P  YK P   PPVY PP   P  Y
Sbjct: 110 KSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKY 169

Query: 172 KPPVEKPPVYK-----PPVEKPPVYKPP-----------------VEKPPVYK------- 264
           K P   PPVYK     PP +KP  YK P                  + PP YK       
Sbjct: 170 KSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPPP 229

Query: 265 PPVEK-------PPVYKPPVEKPPV-YKPPVEKPPVYK 354
           PPV K       PPV+ PP   PP  YK P   PPVYK
Sbjct: 230 PPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYK 267

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 59/129 (45%), Positives = 61/129 (47%), Gaps = 12/129 (9%)
 Frame = +1

Query: 10  PPVYKPPVEKPPV-YKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 174
           PPV+ PP   PP  YK P   PPVYK    PP   P  YK P   P  YK P   P  YK
Sbjct: 242 PPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYK 301

Query: 175 PPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYK---PPVEK 339
            P   P  YK P   PPVYK     PPV  YK P   P +YK P   PPVYK   PP   
Sbjct: 302 SPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPYMYKSPPPPPPVYKYKSPPPPP 361

Query: 340 PPVY--KPP 360
           P  Y   PP
Sbjct: 362 PKYYYSSPP 370

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 62/148 (41%), Positives = 65/148 (43%), Gaps = 31/148 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKPPVYKPP-----------------V 123
           PPVY PP   P  YK P   PPVYK     PP +KP  YK P                  
Sbjct: 156 PPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEY 215

Query: 124 EKPPVYK--PPVEKPPVYK--PPVEKPPVYKPPVEKPPV-YKPPVEKPPVYK----PPVE 276
           + PP YK   P   PPVYK   P   PPV+ PP   PP  YK P   PPVYK    PP  
Sbjct: 216 KSPPPYKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPS 275

Query: 277 KPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            P  YK P   P  YK P   P  YK P
Sbjct: 276 PPYKYKSPPPPPYKYKSPPPPPLQYKSP 303

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 56/119 (47%), Positives = 57/119 (47%), Gaps = 7/119 (5%)
 Frame = +1

Query: 19  YKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYK----P 177
           YK P   P  YK P   PPV  YK P   PPV+ PP   PP  YK P   PPVYK    P
Sbjct: 215 YKSP--PPYKYKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPP 272

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P   P  YK P   P  YK P   P  YK P   P  YK P   PPVYK     PPVYK
Sbjct: 273 PPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYK 331

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 61/146 (41%), Positives = 64/146 (43%), Gaps = 31/146 (21%)
 Frame = +1

Query: 10  PPVYK-----PPVEKPPVYKPP-----------------VEKPPVYK--PPVEKPPVYK- 114
           PPVYK     PP +KP  YK P                  + PP YK   P   PPVYK 
Sbjct: 176 PPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPPPPPVYKY 235

Query: 115 -PPVEKPPVYKPPVEKPPV-YKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYKPPVE 276
             P   PPV+ PP   PP  YK P   PPVYK    PP   P  YK P   P  YK P  
Sbjct: 236 KSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPP 295

Query: 277 KPPVYKPPVEKPPVYKPPVEKPPVYK 354
            P  YK P   P  YK P   PPVYK
Sbjct: 296 PPLQYKSPPPPPYKYKSPPPPPPVYK 321

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 53/123 (43%), Positives = 54/123 (43%), Gaps = 9/123 (7%)
 Frame = +1

Query: 10  PPVYK----PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           PPVYK    PP   P  YK P   P  YK P   P  YK P   P  YK P   PPVYK 
Sbjct: 263 PPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKY 322

Query: 178 PVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY---KPPVEKP 342
               PPVYK     PP  +YK P   PPVYK        YK P   PP Y    PP   P
Sbjct: 323 KSPPPPVYKYKSPPPPPYMYKSPPPPPPVYK--------YKSPPPPPPKYYYSSPPPPPP 374

Query: 343 PVY 351
             Y
Sbjct: 375 HHY 377

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 47/117 (40%), Positives = 50/117 (42%), Gaps = 3/117 (2%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           + PP   PP +    YK P   P  YK P   P  YK P   P  YK P   PPVYK   
Sbjct: 269 KSPPPPSPPYK----YKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKS 324

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPPVYKPPVEKPP 345
             PPVYK        YK P   P +YK P   PPVYK   PP   P  Y      PP
Sbjct: 325 PPPPVYK--------YKSPPPPPYMYKSPPPPPPVYKYKSPPPPPPKYYYSSPPPPP 373

[70][TOP]
>UniRef100_Q9LIE9 Similarity to cell wall-plasma membrane linker protein n=1
           Tax=Arabidopsis thaliana RepID=Q9LIE9_ARATH
          Length = 334

 Score =  119 bits (298), Expect = 1e-25
 Identities = 61/129 (47%), Positives = 65/129 (50%), Gaps = 11/129 (8%)
 Frame = +1

Query: 7   KPPVYKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPP---------V 153
           KPP+ KPP + PP   KPP + PP   KPP  KPP   P   KPP +KPP          
Sbjct: 113 KPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPP---PSTPKPPHHKPPPTPCPPPTPT 169

Query: 154 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 333
             PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP 
Sbjct: 170 PTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPT 229

Query: 334 EKPPVYKPP 360
             PPV  PP
Sbjct: 230 PTPPVVTPP 238

 Score =  114 bits (286), Expect = 3e-24
 Identities = 63/136 (46%), Positives = 67/136 (49%), Gaps = 18/136 (13%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVE------KPP 165
           KPP  KP   KPP  KPP  KPP    P  KPP+ KPP + PP   KPP +      KPP
Sbjct: 84  KPPTVKPH-PKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPP 142

Query: 166 VYKPP--VEKPPVYKP---------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 312
             KPP    KPP +KP         P   PPV  PP   PPV  PP   PPV  PP   P
Sbjct: 143 TTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTP 202

Query: 313 PVYKPPVEKPPVYKPP 360
           PV  PP   PPV  PP
Sbjct: 203 PVITPPTPTPPVITPP 218

 Score =  110 bits (276), Expect = 4e-23
 Identities = 65/153 (42%), Positives = 69/153 (45%), Gaps = 35/153 (22%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKP-------------PV----EKPPVYKPPVEKPPVYKPPVEKPP 135
           KPP  KPP  KPP  KP             P      KPP  KPP  KPP    P  KPP
Sbjct: 56  KPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPP 115

Query: 136 VYKPPVEKPP-VYKPPVE------KPPVYKPP--VEKPPVYKP---------PVEKPPVY 261
           + KPP + PP   KPP +      KPP  KPP    KPP +KP         P   PPV 
Sbjct: 116 IVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVV 175

Query: 262 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PPV  PP   PPV  PP   PPV  PP
Sbjct: 176 TPPTPTPPVITPPTPTPPVVTPPTPTPPVITPP 208

 Score =  110 bits (276), Expect = 4e-23
 Identities = 57/120 (47%), Positives = 58/120 (48%), Gaps = 3/120 (2%)
 Frame = +1

Query: 7   KPPVYKPP-VEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           KPP   PP   KPP  KPP    KPP +KPP    P    P   PPV  PP   PPV  P
Sbjct: 129 KPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPP-PTPTPTPPVVTPPTPTPPVITP 187

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PP   P
Sbjct: 188 PTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIP 247

 Score =  109 bits (273), Expect = 8e-23
 Identities = 62/128 (48%), Positives = 67/128 (52%), Gaps = 10/128 (7%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP--------PVEKP 162
           KPP +     KPP  KPP  KPP  KPP  KPP  KP   KPP  KP        P  KP
Sbjct: 38  KPPKHPVKPPKPPAVKPP--KPPAVKPPTPKPPTVKPH-PKPPTVKPHPKPPTVKPHPKP 94

Query: 163 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPVYKPPVE 336
           P  KPP  KPP    P  KPP+ KPP + PP   KPP + PP   KPP  KPP   P   
Sbjct: 95  PTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPP---PSTP 151

Query: 337 KPPVYKPP 360
           KPP +KPP
Sbjct: 152 KPPHHKPP 159

 Score =  100 bits (248), Expect = 7e-20
 Identities = 62/127 (48%), Positives = 66/127 (51%), Gaps = 15/127 (11%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           PP   P  +KPP  K PV KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP  K
Sbjct: 29  PPKPSPAPHKPP--KHPV-KPP--KPPAVKPP--KPPAVKPPTPKPPTVKPH-PKPPTVK 80

Query: 205 P--------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVE------K 339
           P        P  KPP  KPP  KPP    P  KPP+ KPP + PP   KPP +      K
Sbjct: 81  PHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPK 140

Query: 340 PPVYKPP 360
           PP  KPP
Sbjct: 141 PPTTKPP 147

[71][TOP]
>UniRef100_P93705 Hypocotil specific n=1 Tax=Daucus carota RepID=P93705_DAUCA
          Length = 347

 Score =  119 bits (298), Expect = 1e-25
 Identities = 62/120 (51%), Positives = 71/120 (59%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           ++ PP +KP   KPP  KPPV KPP+ KPPV KPPV KPPV KPP+ KPP+ KPP   PP
Sbjct: 17  EKPPPHHKPAPHKPPTVKPPVVKPPIVKPPVVKPPVVKPPVVKPPIVKPPIVKPPGLLPP 76

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +  PP   PP   PP   PP   PP+  PP   PP   PP   PP   PP   PP+ KPP
Sbjct: 77  I-LPPGILPPGVLPPGVLPPGVLPPL--PPGVLPPGILPPGVLPPGVLPPGVVPPI-KPP 132

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 48/118 (40%), Positives = 52/118 (44%), Gaps = 1/118 (0%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   PP   PP   PP   PP   PP++ P    PP   PP   PP   PP+  PP   
Sbjct: 102 PPGVLPPGILPPGVLPPGVLPPGVVPPIKPPGGLLPPGVLPPGVLPPGVLPPL--PPGVL 159

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP   PP+  PP   PP   PP   PP  KPP    PP   PP   PP   PP   PP
Sbjct: 160 PPGVLPPL--PPGVLPPGVLPPGVLPPGIKPPGGLLPPGVLPPGVLPPGILPPGILPP 215

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 52/121 (42%), Positives = 54/121 (44%), Gaps = 4/121 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVE 186
           PP   PP   PP+  PP   PP   PP+  PP   PP   PP   PP  KPP    PP  
Sbjct: 142 PPGVLPPGVLPPL--PPGVLPPGVLPPL--PPGVLPPGVLPPGVLPPGIKPPGGLLPPGV 197

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP---VEKPPVYKP 357
            PP   PP   PP   PP   PP   PP   PP  KPPV  PP  KPP      PP  K 
Sbjct: 198 LPPGVLPPGILPPGILPPGVLPPGILPPGILPPGVKPPV-LPPTTKPPSPGTPCPPGAKT 256

Query: 358 P 360
           P
Sbjct: 257 P 257

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 46/107 (42%), Positives = 47/107 (43%), Gaps = 1/107 (0%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVE 186
           PP   PP+  PP   PP   PP   PP  KPP    PP   PP   PP   PP   PP  
Sbjct: 160 PPGVLPPL--PPGVLPPGVLPPGVLPPGIKPPGGLLPPGVLPPGVLPPGILPPGILPPGV 217

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 327
            PP   PP   PP  KPPV  PP  KPP    P   PP  K P   P
Sbjct: 218 LPPGILPPGILPPGVKPPV-LPPTTKPPSPGTPC--PPGAKTPPSAP 261

[72][TOP]
>UniRef100_UPI000180B733 PREDICTED: similar to cell wall proline-rich protein n=1 Tax=Ciona
            intestinalis RepID=UPI000180B733
          Length = 1425

 Score =  118 bits (296), Expect = 2e-25
 Identities = 58/117 (49%), Positives = 58/117 (49%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV K P   PPV K P   PPV K P   PPV K P   PPV K     PPV K P   
Sbjct: 665  PPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVKSPAGN 724

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV K P   PPV K P   PPV K P   PPV K P   PPV K P    PV K P
Sbjct: 725  PPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNSPVGKSP 781

 Score =  117 bits (294), Expect = 3e-25
 Identities = 57/116 (49%), Positives = 57/116 (49%)
 Frame = +1

Query: 13   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
            P   PP   PPV K P   PPV K P   PPV K P   PPV K P   PPV K     P
Sbjct: 656  PARIPPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSSAGNP 715

Query: 193  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PV K P   PPV K P   PPV K P   PPV K P   PPV K P   PPV K P
Sbjct: 716  PVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSP 771

 Score =  117 bits (294), Expect = 3e-25
 Identities = 58/117 (49%), Positives = 58/117 (49%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV K P   PPV K P   PPV K P   PPV K     PPV K P   PPV K P   
Sbjct: 675  PPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGN 734

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV K P   PPV K P   PPV K P   PPV K P    PV K P   PPV K P
Sbjct: 735  PPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNSPVGKSPAGNPPVVKLP 791

 Score =  116 bits (290), Expect = 9e-25
 Identities = 58/117 (49%), Positives = 58/117 (49%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV K P   PPV K P   PPV K     PPV K P   PPV K P   PPV K P   
Sbjct: 685  PPVVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGN 744

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PPV K P   PPV K P   PPV K P    PV K P   PPV K P E  PV K P
Sbjct: 745  PPVVKSPAGNPPVVKSPAGNPPVVKSPAGNSPVGKSPAGNPPVVKLPAENFPVVKSP 801

 Score =  112 bits (280), Expect = 1e-23
 Identities = 56/113 (49%), Positives = 56/113 (49%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PPV K P   PPV K     PPV K P   PPV K P   PPV K P   PPV K P   
Sbjct: 695  PPVVKSPAGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGN 754

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            PPV K P   PPV K P    PV K P   PPV K P E  PV K P   PPV
Sbjct: 755  PPVVKSPAGNPPVVKSPAGNSPVGKSPAGNPPVVKLPAENFPVVKSPAGNPPV 807

 Score =  110 bits (274), Expect = 6e-23
 Identities = 56/119 (47%), Positives = 56/119 (47%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EK     PP    P   PP   PPV K P   PPV K P   PPV K P   PPV K P 
Sbjct: 643 EKVSNRNPPGLTLPARIPPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPA 702

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV K     PPV K P   PPV K P   PPV K P   PPV K P   PPV K P
Sbjct: 703 GNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSP 761

 Score =  101 bits (252), Expect = 2e-20
 Identities = 52/110 (47%), Positives = 52/110 (47%)
 Frame = +1

Query: 31  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 210
           VEK     PP    P   PP   PPV K P   PPV K P   PPV K P   PPV K P
Sbjct: 642 VEKVSNRNPPGLTLPARIPPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSP 701

Query: 211 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
              PPV K     PPV K P   PPV K P   PPV K P   PPV K P
Sbjct: 702 AGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSP 751

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/119 (42%), Positives = 51/119 (42%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  P    P    P     VEK     PP    P   PP   PPV K P   PPV K P 
Sbjct: 623 ESSPYVSNPTGNLPFTDANVEKVSNRNPPGLTLPARIPPAGNPPVVKSPAGNPPVVKSPA 682

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV K P   PPV K P   PPV K     PPV K P   PPV K P   PPV K P
Sbjct: 683 GNPPVVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSP 741

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 44/94 (46%), Positives = 44/94 (46%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           K P   PP     V K P   PPV K P   PPV K P   PPV K P   PPV K P  
Sbjct: 719 KSPAGNPP-----VVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAG 773

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 288
             PV K P   PPV K P E  PV K P   PPV
Sbjct: 774 NSPVGKSPAGNPPVVKLPAENFPVVKSPAGNPPV 807

[73][TOP]
>UniRef100_UPI000175F187 PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI000175F187
          Length = 557

 Score =  117 bits (294), Expect = 3e-25
 Identities = 57/118 (48%), Positives = 70/118 (59%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 139 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 198

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+  +  P
Sbjct: 199 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSTMPVP 256

 Score =  117 bits (293), Expect = 4e-25
 Identities = 56/111 (50%), Positives = 67/111 (60%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  
Sbjct: 136 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 195

Query: 205 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 196 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 246

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 52/143 (36%), Positives = 63/143 (44%), Gaps = 29/143 (20%)
 Frame = +1

Query: 16  VYKPPVEKP----------PVYKPPVEKPPVYKPPVEKPPVYKPPV-------------- 123
           V KPP  +P          PV     + PPV  P  E+ P                    
Sbjct: 74  VRKPPFSEPLESLLELCDKPVSILVPQSPPVSAPVPEQAPSPDDTALTSKTTRRGRRRKR 133

Query: 124 EKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 288
             P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV
Sbjct: 134 MAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 193

Query: 289 YKPPVEKPPVYKPPVEKPPVYKP 357
             P  E+PPV  P  E+PPV  P
Sbjct: 194 SAPAPERPPVSAPAPERPPVSAP 216

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 46/111 (41%), Positives = 57/111 (51%)
 Frame = +1

Query: 28  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 207
           PV+ PPV   PV+  PV   PV+ PPV   PV+ PPV   P + PP    P + PP    
Sbjct: 373 PVQLPPVPPAPVQLLPVPPAPVQLPPVPPAPVQLPPVPPAPAQLPPA---PAQLPPA--- 426

Query: 208 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P + PP    P + PP    P + PPV   PV+ PPV   PV+ PPV   P
Sbjct: 427 PAQLPPA---PAQLPPA---PAQLPPVPPAPVQLPPVPPAPVQLPPVPSAP 471

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 46/111 (41%), Positives = 57/111 (51%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV   PV+  PV   PV+ PPV   PV+ PPV   P + PP    P + PP    P + 
Sbjct: 377 PPVPPAPVQLLPVPPAPVQLPPVPPAPVQLPPVPPAPAQLPPA---PAQLPPA---PAQL 430

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
           PP    P + PP    P + PPV   PV+ PPV   PV+ PPV   PV+ P
Sbjct: 431 PPA---PAQLPPA---PAQLPPVPPAPVQLPPVPPAPVQLPPVPSAPVQLP 475

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 46/131 (35%), Positives = 58/131 (44%), Gaps = 14/131 (10%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEK-------- 159
           KPP  +P      +   PV       PPV  P P   P  +   +      +        
Sbjct: 76  KPPFSEPLESLLELCDKPVSILVPQSPPVSAPVPEQAPSPDDTALTSKTTRRGRRRKRMA 135

Query: 160 PPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 324
           P   +PPV     E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  
Sbjct: 136 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 195

Query: 325 PPVEKPPVYKP 357
           P  E+PPV  P
Sbjct: 196 PAPERPPVSAP 206

[74][TOP]
>UniRef100_Q39949 Hydroxyproline-rich protein n=1 Tax=Helianthus annuus
           RepID=Q39949_HELAN
          Length = 263

 Score =  117 bits (293), Expect = 4e-25
 Identities = 82/145 (56%), Positives = 88/145 (60%), Gaps = 28/145 (19%)
 Frame = +1

Query: 10  PPVYK---PPVEK---PPVYK---PPVEK---PPVYK--PPVEKPPVYKPPVEKPPVYK- 144
           PPVYK   PPV K   PPV+K   PPV K   PPVYK  PP +KP VYK P   PPV+K 
Sbjct: 60  PPVYKSPPPPVYKSPPPPVHKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKS 119

Query: 145 --PPVEK---PPVYKPPVEKPPVYKPPVEKPPVYK---PPVEK---PPVYK--PPVEKPP 285
             PPV K   PPVY+ P   PPVYK P   PPVYK   PPV K   PPVYK  PP +KP 
Sbjct: 120 PPPPVYKSPPPPVYESP--PPPVYKSP--PPPVYKSPPPPVHKSPPPPVYKSPPPPKKPY 175

Query: 286 VYKPPVEKPPVYKPPVEKPPVYKPP 360
           VYK P   PPV+K P   PPVYK P
Sbjct: 176 VYKSPPPPPPVHKSP--PPPVYKSP 198

 Score =  115 bits (288), Expect = 2e-24
 Identities = 79/143 (55%), Positives = 85/143 (59%), Gaps = 26/143 (18%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEK---PP 165
           PPVYK  PP +KP VYK P   PPV+K P   PPVYK P   PPVY+   PPV K   PP
Sbjct: 92  PPVYKSPPPPKKPYVYKSPPPPPPVHKSP--PPPVYKSP--PPPVYESPPPPVYKSPPPP 147

Query: 166 VYK---PPVEK---PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKP 312
           VYK   PPV K   PPVYK  PP +KP VYK P   PPV+K P   PPVYK   PPV K 
Sbjct: 148 VYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSP--PPPVYKSPTPPVHKS 205

Query: 313 ---PVYKPPV----EKPPVYKPP 360
              PVYK P+      PPVYK P
Sbjct: 206 PPHPVYKSPLPVHKSPPPVYKSP 228

 Score =  112 bits (279), Expect = 2e-23
 Identities = 80/147 (54%), Positives = 86/147 (58%), Gaps = 28/147 (19%)
 Frame = +1

Query: 4   EKPPVYK-----PPVEK---PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PP 150
           +KP VYK     PPV K   PPVYK P   PPVY+ P   PPVYK P   PPVYK   PP
Sbjct: 102 KKPYVYKSPPPPPPVHKSPPPPVYKSP--PPPVYESP--PPPVYKSP--PPPVYKSPPPP 155

Query: 151 VEK---PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKP---PVYKP 297
           V K   PPVYK  PP +KP VYK P   PPV+K P   PPVYK   PPV K    PVYK 
Sbjct: 156 VHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSP--PPPVYKSPTPPVHKSPPHPVYKS 213

Query: 298 PV----EKPPVYK--PPVEKPPVYKPP 360
           P+      PPVYK  PP +KP VYK P
Sbjct: 214 PLPVHKSPPPVYKSPPPPKKPYVYKSP 240

 Score =  108 bits (270), Expect = 2e-22
 Identities = 81/154 (52%), Positives = 91/154 (59%), Gaps = 34/154 (22%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEK---PPVYK---PPVEK---PPVYK 144
           ++ PP   PP ++  VYK P   PPVYK   PPV K   PPV+K   PPV K   PPVYK
Sbjct: 41  KKSPP---PPPKQQYVYKSP-PPPPVYKSPPPPVYKSPPPPVHKSPPPPVHKSPPPPVYK 96

Query: 145 --PPVEKPPVYKPPVEKPPVYK---PPVEK---PPVYK---PPVEK---PPVYK---PPV 273
             PP +KP VYK P   PPV+K   PPV K   PPVY+   PPV K   PPVYK   PPV
Sbjct: 97  SPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPPPPVYESPPPPVYKSPPPPVYKSPPPPV 156

Query: 274 EK---PPVYK--PPVEKPPVYKPPVEKPPVYKPP 360
            K   PPVYK  PP +KP VYK P   PPV+K P
Sbjct: 157 HKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSP 190

 Score =  101 bits (251), Expect = 3e-20
 Identities = 74/141 (52%), Positives = 79/141 (56%), Gaps = 24/141 (17%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK---PPVEK---PPVYK---PPVEK---PPVYK--PPVEKPPVYKP 147
           PPVYK P   PPVY+   PPV K   PPVYK   PPV K   PPVYK  PP +KP VYK 
Sbjct: 122 PPVYKSP--PPPVYESPPPPVYKSPPPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKS 179

Query: 148 PVEKPPVYKPPVEKPPVYK---PPVEKPP---VYKPPV----EKPPVYKPPVEKPPVYKP 297
           P   PPV+K P   PPVYK   PPV K P   VYK P+      PPVYK P        P
Sbjct: 180 PPPPPPVHKSP--PPPVYKSPTPPVHKSPPHPVYKSPLPVHKSPPPVYKSP--------P 229

Query: 298 PVEKPPVYKPPVEKPPVYKPP 360
           P +KP VYK P   PPV K P
Sbjct: 230 PPKKPYVYKSP--PPPVKKHP 248

 Score =  100 bits (248), Expect = 7e-20
 Identities = 72/130 (55%), Positives = 77/130 (59%), Gaps = 16/130 (12%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK---PPVEK---PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPP 165
           PPVYK P   PPVYK   PPV K   PPVYK  PP +KP VYK P   PPV+K P   PP
Sbjct: 138 PPVYKSP--PPPVYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSP--PPP 193

Query: 166 VYK---PPVEKP---PVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVY 321
           VYK   PPV K    PVYK P+   PV+K P   PPVYK  PP +KP VYK P   PPV 
Sbjct: 194 VYKSPTPPVHKSPPHPVYKSPL---PVHKSP---PPVYKSPPPPKKPYVYKSP--PPPVK 245

Query: 322 KPPVEKPPVY 351
           K P   PP Y
Sbjct: 246 KHP---PPHY 252

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 61/116 (52%), Positives = 67/116 (57%), Gaps = 12/116 (10%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPP---VYKPPVEKPP 165
           PPVYK  PP +KP VYK P   PPV+K P   PPVYK   PPV K P   VYK P+   P
Sbjct: 162 PPVYKSPPPPKKPYVYKSPPPPPPVHKSP--PPPVYKSPTPPVHKSPPHPVYKSPL---P 216

Query: 166 VYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVY 321
           V+K P   PPVYK  PP +KP VYK P   PPV K P   PP  +Y  P   PP Y
Sbjct: 217 VHKSP---PPVYKSPPPPKKPYVYKSP--PPPVKKHP---PPHYIYSSP---PPPY 261

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 56/109 (51%), Positives = 61/109 (55%), Gaps = 3/109 (2%)
 Frame = +1

Query: 43  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 222
           P   PP + PP   PP ++  VYK P   PPVYK P   PPVYK P   PPV+K P   P
Sbjct: 35  PPPPPPKKSPP---PPPKQQYVYKSP-PPPPVYKSP--PPPVYKSP--PPPVHKSP--PP 84

Query: 223 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK---PPVYKPP 360
           PV+K P   PPVYK P   PP  KP V K P   PPV K   PPVYK P
Sbjct: 85  PVHKSP--PPPVYKSP---PPPKKPYVYKSPPPPPPVHKSPPPPVYKSP 128

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 52/104 (50%), Positives = 57/104 (54%), Gaps = 18/104 (17%)
 Frame = +1

Query: 4   EKPPVYK-----PPVEK---PPVYK---PPVEKPP---VYKPPVEKPPVYKPPVEKPPVY 141
           +KP VYK     PPV K   PPVYK   PPV K P   VYK P+   PV+K P   PPVY
Sbjct: 172 KKPYVYKSPPPPPPVHKSPPPPVYKSPTPPVHKSPPHPVYKSPL---PVHKSP---PPVY 225

Query: 142 K--PPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVY 261
           K  PP +KP VYK P   PPV K P   PP  +Y  P   PP Y
Sbjct: 226 KSPPPPKKPYVYKSP--PPPVKKHP---PPHYIYSSP---PPPY 261

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 43/90 (47%), Positives = 46/90 (51%), Gaps = 26/90 (28%)
 Frame = +1

Query: 169 YKPPVEKPP------------VYKPPVEKPPVYK---PPVEK---PPVYK---PPVEK-- 279
           Y  P   PP            VYK P   PPVYK   PPV K   PPV+K   PPV K  
Sbjct: 32  YSSPPPPPPKKSPPPPPKQQYVYKSP-PPPPVYKSPPPPVYKSPPPPVHKSPPPPVHKSP 90

Query: 280 -PPVYK--PPVEKPPVYKPPVEKPPVYKPP 360
            PPVYK  PP +KP VYK P   PPV+K P
Sbjct: 91  PPPVYKSPPPPKKPYVYKSPPPPPPVHKSP 120

[75][TOP]
>UniRef100_A8NQG1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130
           RepID=A8NQG1_COPC7
          Length = 418

 Score =  117 bits (293), Expect = 4e-25
 Identities = 91/159 (57%), Positives = 91/159 (57%), Gaps = 41/159 (25%)
 Frame = +1

Query: 7   KPPVY--KPPVE--KPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY-----KP 147
           KPPV   KPPVE  KPPV   KPPVE P   KPPVE P   KPPVE  KPPV      KP
Sbjct: 103 KPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPPVEPPKPPVVPPFPPKP 162

Query: 148 PVEKPPVYKPPVE--KPPVY-----KPPVE--KPPVY-----KPPVEKPPVYKPPVE--K 279
           PVE P   KPPVE  KPPV      KPPVE  KPPV      KPPVE P   KPPVE  K
Sbjct: 163 PVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPK 222

Query: 280 PPVY-----KPPVE--KPPVY-----KPPVEKPPVYKPP 360
           PPV      KPPVE  KPPV      KPPVE P   KPP
Sbjct: 223 PPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPVPPKPP 261

 Score =  117 bits (292), Expect = 5e-25
 Identities = 92/157 (58%), Positives = 92/157 (58%), Gaps = 40/157 (25%)
 Frame = +1

Query: 7   KPPVY--KPPVE--KPPVY--KPPVE--KPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE 156
           KPPV   KPPVE  KPPV   KPPVE  KPPV   KPPVE P   KPPVE P   KPPVE
Sbjct: 89  KPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPPVE 148

Query: 157 --KPPVY-----KPPVEKPPVYKPPVE--KPPVY-----KPPVE--KPPVY-----KPPV 273
             KPPV      KPPVE P   KPPVE  KPPV      KPPVE  KPPV      KPPV
Sbjct: 149 PPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPV 208

Query: 274 EKPPVYKPPVE--KPPVY-----KPPVE--KPPVYKP 357
           E P   KPPVE  KPPV      KPPVE  KPPV  P
Sbjct: 209 EPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPP 245

 Score =  116 bits (291), Expect = 7e-25
 Identities = 89/150 (59%), Positives = 89/150 (59%), Gaps = 33/150 (22%)
 Frame = +1

Query: 7   KPPVY--KPPVEKPPVYKPPVE--KPPVY--KPPVE--KPPVY--KPPVEKPPVYKPPVE 156
           KPPV   KPPVE P   KPPVE  KPPV   KPPVE  KPPV   KPPVE P   KPPVE
Sbjct: 82  KPPVEPPKPPVEPP---KPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPKPPVE 138

Query: 157 KPPVYKPPVE--KPPVY-----KPPVEKPPVYKPPVE--KPPVY-----KPPVE--KPPV 288
            P   KPPVE  KPPV      KPPVE P   KPPVE  KPPV      KPPVE  KPPV
Sbjct: 139 PPVPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPV 198

Query: 289 Y-----KPPVEKPPVYKPPVE--KPPVYKP 357
                 KPPVE P   KPPVE  KPPV  P
Sbjct: 199 VPPFPPKPPVEPPAPPKPPVEPPKPPVVPP 228

 Score =  110 bits (276), Expect = 4e-23
 Identities = 92/157 (58%), Positives = 92/157 (58%), Gaps = 39/157 (24%)
 Frame = +1

Query: 7   KPPVY--KPPVE--KPPVY--KPPVE--KPPVY--KPPVE--KPPVY--KPPVE--KPPV 138
           KPPV   KP VE  KP V   KPPVE  KPPV   KPPVE  KPPV   KPPVE  KPPV
Sbjct: 61  KPPVDPPKPTVEPPKPTVAPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPV 120

Query: 139 Y--KPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY-----KPPVEKPPVYKPPVE--KPP 285
              KPPVE P   KPPVE P   KPPVE  KPPV      KPPVE P   KPPVE  KPP
Sbjct: 121 EPPKPPVEPPKPPKPPVEPPVPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPP 180

Query: 286 VY-----KPPVE--KPPVY-----KPPVEKPPVYKPP 360
           V      KPPVE  KPPV      KPPVE P   KPP
Sbjct: 181 VVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPP 217

 Score =  109 bits (272), Expect = 1e-22
 Identities = 74/129 (57%), Positives = 74/129 (57%), Gaps = 11/129 (8%)
 Frame = +1

Query: 7   KPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVY--KPPVEKPPV 168
           KPPV   KPPV  P   KPPVE P   KPPVE  KPPV  P   KPPV   KPPV  P  
Sbjct: 144 KPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFP 203

Query: 169 YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE 336
            KPPVE P   KPPVE  KPPV  P   KPPV   KPPV  P   KPPVE P   KPPVE
Sbjct: 204 PKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPVPPKPPVE 263

Query: 337 KP-PVYKPP 360
            P P   PP
Sbjct: 264 PPKPTAVPP 272

 Score =  107 bits (267), Expect = 4e-22
 Identities = 74/131 (56%), Positives = 74/131 (56%), Gaps = 14/131 (10%)
 Frame = +1

Query: 7   KPPVY-----KPPVEKPPVYKPPVE--KPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEK 159
           KPPV      KPPVE P   KPPVE  KPPV  P   KPPV   KPPV  P   KPPVE 
Sbjct: 151 KPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEP 210

Query: 160 PPVYKPPVE--KPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYK 324
           P   KPPVE  KPPV  P   KPPV   KPPV  P   KPPVE P   KPPVE P P   
Sbjct: 211 PAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPVPPKPPVEPPKPTAV 270

Query: 325 PPVEKPPVYKP 357
           PP  KPPV  P
Sbjct: 271 PP--KPPVVPP 279

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 66/120 (55%), Positives = 66/120 (55%), Gaps = 3/120 (2%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           KPPV  P   KPPV   KPPV  P   KPPVE P   KPPVE P   KPPV  P   KPP
Sbjct: 178 KPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPP---KPPVVPPFPPKPP 234

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKP 357
           VE P   KPPV  P   KPPVE P   KPPVE P P   PP  KPPV  P   KP V  P
Sbjct: 235 VEPP---KPPVVPPFPPKPPVEPPVPPKPPVEPPKPTAVPP--KPPVVPPLPPKPTVVPP 289

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 79/147 (53%), Positives = 81/147 (55%), Gaps = 32/147 (21%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY---------KPPVE--KPPVY--KP 147
           P   PP   PPV   P + P   KPPV+  KP V          KPPVE  KPPV   KP
Sbjct: 42  PTILPPW--PPVPPQPTDLPT--KPPVDPPKPTVEPPKPTVAPPKPPVEPPKPPVEPPKP 97

Query: 148 PVE--KPPVY--KPPVE--KPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY-- 291
           PVE  KPPV   KPPVE  KPPV   KPPVE P   KPPVE P   KPPVE  KPPV   
Sbjct: 98  PVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPPVEPPKPPVVPP 157

Query: 292 ---KPPVEKPPVYKPPVE--KPPVYKP 357
              KPPVE P   KPPVE  KPPV  P
Sbjct: 158 FPPKPPVEPPAPPKPPVEPPKPPVVPP 184

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 68/131 (51%), Positives = 68/131 (51%), Gaps = 14/131 (10%)
 Frame = +1

Query: 7   KPPVY-----KPPVEKPPVYKPPVE--KPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEK 159
           KPPV      KPPVE P   KPPVE  KPPV  P   KPPV   KPPV  P   KPPVE 
Sbjct: 195 KPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEP 254

Query: 160 PPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPP--VEKPPVYK 324
           P   KPPVE P P   PP  KPPV  P   KP V   KPPV  P   KP     KPPV  
Sbjct: 255 PVPPKPPVEPPKPTAVPP--KPPVVPPLPPKPTVVPPKPPVVPPAPPKPTDVPPKPPVVP 312

Query: 325 PPVEKPPVYKP 357
           P   KP V  P
Sbjct: 313 PAPPKPTVVPP 323

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 68/131 (51%), Positives = 69/131 (52%), Gaps = 14/131 (10%)
 Frame = +1

Query: 7   KPPVY-----KPPVE--KPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEK 159
           KPPV      KPPVE  KPPV  P   KPPV   KPPV  P   KPPVE P   KPPVE 
Sbjct: 205 KPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPVPPKPPVEP 264

Query: 160 P-PVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 330
           P P   PP  KPPV  P   KP V   KPPV  PP    P + PP  KPPV  P   KP 
Sbjct: 265 PKPTAVPP--KPPVVPPLPPKPTVVPPKPPV-VPPAPPKPTDVPP--KPPVVPPAPPKPT 319

Query: 331 V--EKPPVYKP 357
           V   KPPV  P
Sbjct: 320 VVPPKPPVVPP 330

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 63/124 (50%), Positives = 64/124 (51%), Gaps = 7/124 (5%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKP 177
           KPPV  P   KPPV   KPPV  P   KPPVE P   KPPVE P P   PP  KPPV  P
Sbjct: 222 KPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPVPPKPPVEPPKPTAVPP--KPPVVPP 279

Query: 178 PVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPP 345
              KP V   KPPV  PP    P + PP  KPPV  P   KP V   KPPV  P   KP 
Sbjct: 280 LPPKPTVVPPKPPV-VPPAPPKPTDVPP--KPPVVPPAPPKPTVVPPKPPVVPPAPPKPT 336

Query: 346 VYKP 357
           V  P
Sbjct: 337 VAPP 340

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 65/131 (49%), Positives = 66/131 (50%), Gaps = 14/131 (10%)
 Frame = +1

Query: 7   KPPVY-----KPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVY--KPPVEKP 162
           KPPV      KPPVE P   KPPVE P P   PP  KPPV  P   KP V   KPPV  P
Sbjct: 239 KPPVVPPFPPKPPVEPPVPPKPPVEPPKPTAVPP--KPPVVPPLPPKPTVVPPKPPV-VP 295

Query: 163 PVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPPVY--KPPVEKPPVYKPP 330
           P    P + PP  KPPV  P   KP V   KPPV  P   KP V   KPPV  P   KP 
Sbjct: 296 PAPPKPTDVPP--KPPVVPPAPPKPTVVPPKPPVVPPAPPKPTVAPPKPPVVPPAPPKPT 353

Query: 331 V--EKPPVYKP 357
           V   KPPV  P
Sbjct: 354 VVPPKPPVVPP 364

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 61/129 (47%), Positives = 61/129 (47%), Gaps = 12/129 (9%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVY--KPPVEKPPVYKPP--VEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           KPPV  P   KP V   KPPV  P   KP     KPPV  P   KP V   KPPV  P  
Sbjct: 273 KPPVVPPLPPKPTVVPPKPPVVPPAPPKPTDVPPKPPVVPPAPPKPTVVPPKPPVVPPAP 332

Query: 169 YKPPV--EKPPVYKPPVEKPPVY--KPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPP 330
            KP V   KPPV  P   KP V   KPPV  P   KP V   KPPV  P   KP V  P 
Sbjct: 333 PKPTVAPPKPPVVPPAPPKPTVVPPKPPVVPPAPPKPTVAPPKPPVVPPAPPKPTVVPPS 392

Query: 331 VEKPPVYKP 357
             KPPV  P
Sbjct: 393 PPKPPVVPP 401

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 59/127 (46%), Positives = 60/127 (47%), Gaps = 10/127 (7%)
 Frame = +1

Query: 7   KPPVYKP----PVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPPV 168
           KPPV  P    P + PP  KPPV  P   KP V   KPPV  P   KP V  P   KPPV
Sbjct: 290 KPPVVPPAPPKPTDVPP--KPPVVPPAPPKPTVVPPKPPVVPPAPPKPTVAPP---KPPV 344

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
             P   KP V   KPPV  P   KP V   KPPV  P   KP V  P   KPPV  P   
Sbjct: 345 VPPAPPKPTVVPPKPPVVPPAPPKPTVAPPKPPVVPPAPPKPTVVPPSPPKPPVVPPFPP 404

Query: 337 KPPVYKP 357
           KP V  P
Sbjct: 405 KPTVVPP 411

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 54/116 (46%), Positives = 54/116 (46%), Gaps = 4/116 (3%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYK 174
           KPPV  P   KP V   KPPV  P   KP V   KPPV  P   KP V  P   KPPV  
Sbjct: 307 KPPVVPPAPPKPTVVPPKPPVVPPAPPKPTVAPPKPPVVPPAPPKPTVVPP---KPPVVP 363

Query: 175 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
           P   KP V  P   KPPV  P   KP V  P   KPPV  PP    P   PP  KP
Sbjct: 364 PAPPKPTVAPP---KPPVVPPAPPKPTVVPPSPPKPPVV-PPFPPKPTVVPPKPKP 415

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 65/123 (52%), Positives = 66/123 (53%), Gaps = 28/123 (22%)
 Frame = +1

Query: 73  PVYKPPVEKPPVYKPPVEKPPV---YKPPVE--KPPVY---------KPPVE--KPPVY- 201
           PV   P   PP   PPV   P     KPPV+  KP V          KPPVE  KPPV  
Sbjct: 37  PVPGQPTILPPW--PPVPPQPTDLPTKPPVDPPKPTVEPPKPTVAPPKPPVEPPKPPVEP 94

Query: 202 -KPPVE--KPPVY--KPPVE--KPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE--KPPV 348
            KPPVE  KPPV   KPPVE  KPPV   KPPVE P   KPPVE P   KPPVE  KPPV
Sbjct: 95  PKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPPVEPPKPPV 154

Query: 349 YKP 357
             P
Sbjct: 155 VPP 157

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 60/119 (50%), Positives = 62/119 (52%), Gaps = 23/119 (19%)
 Frame = +1

Query: 73  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY---------KPPVE- 216
           P    PV   P   PP   PPV   P + P   KPPV+  KP V          KPPVE 
Sbjct: 32  PTLVIPVPGQPTILPPW--PPVPPQPTDLPT--KPPVDPPKPTVEPPKPTVAPPKPPVEP 87

Query: 217 -KPPVY--KPPVE--KPPVY--KPPVE--KPPVY--KPPVEKPPVYKPPVEKPPVYKPP 360
            KPPV   KPPVE  KPPV   KPPVE  KPPV   KPPVE P   KPPVE P   KPP
Sbjct: 88  PKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPP 146

[76][TOP]
>UniRef100_C5Z6N9 Putative uncharacterized protein Sb10g025210 n=1 Tax=Sorghum
           bicolor RepID=C5Z6N9_SORBI
          Length = 309

 Score =  116 bits (291), Expect = 7e-25
 Identities = 60/118 (50%), Positives = 68/118 (57%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           K P Y PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+  PPV +PPV  PPV 
Sbjct: 90  KSPSY-PPVTRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVT 146

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP+  PP        PPV  PPV  PP+  PP   PP+  PP   PPV  PPV  PP
Sbjct: 147 YPPITGPPTT------PPVVGPPVTYPPITGPPSTTPPITGPPSTTPPVTGPPVTYPP 198

 Score =  105 bits (261), Expect = 2e-21
 Identities = 57/124 (45%), Positives = 65/124 (52%), Gaps = 7/124 (5%)
 Frame = +1

Query: 7   KPPVYKPP---VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           +PPV  PP   V +PPV +PPV  PPV  PP+  PPV +PPV  PPV  PP+  PP   P
Sbjct: 99  RPPVVGPPKGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVTYPPITGPPT-TP 157

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP----VEKPPVYKPPVEKPP 345
           PV  PPV  PP+  PP   PP+  PP   PPV  PPV  PP        P   PP    P
Sbjct: 158 PVVGPPVTYPPITGPPSTTPPITGPPSTTPPVTGPPVTYPPGGGGGSSTPCPPPPPPSTP 217

Query: 346 VYKP 357
              P
Sbjct: 218 TPTP 221

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 55/120 (45%), Positives = 65/120 (54%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           +KP   KP    PP  KP    P P  KP   KPP  K P    P ++ P + P    PP
Sbjct: 41  DKPKAPKPSHSHPPKTKPSHPSPSPSPKPKNPKPP--KGPAYPAPGHQQPPKSPSY--PP 96

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           V +PPV  PP  K PV +PPV +PPV  PPV  PP+  PPV +PPV  PPV  PP+  PP
Sbjct: 97  VTRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVTYPPITGPP 154

[77][TOP]
>UniRef100_B4I114 GM12332 n=1 Tax=Drosophila sechellia RepID=B4I114_DROSE
          Length = 1214

 Score =  116 bits (291), Expect = 7e-25
 Identities = 45/110 (40%), Positives = 64/110 (58%)
 Frame = +1

Query: 13   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
            P  +PP E PP Y PP  +PP  +PP  +PP  +PP  +PP ++PP  +PP  +PP  +P
Sbjct: 1075 PPTQPPTE-PPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQP 1133

Query: 193  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
            P  +PP  +PP  +PP  +PP  +PP   PP  +PP  + P  +PP   P
Sbjct: 1134 PTVQPPTVQPPTNQPPTVQPPTVQPPTHHPPTNEPPTNRSPTKRPPSPSP 1183

 Score =  115 bits (287), Expect = 2e-24
 Identities = 44/106 (41%), Positives = 63/106 (59%)
 Frame = +1

Query: 43   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 222
            P  +PP E PP Y PP  +PP  +PP  +PP  +PP  +PP ++PP  +PP  +PP  +P
Sbjct: 1075 PPTQPPTE-PPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQP 1133

Query: 223  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            P  +PP  +PP  +PP  +PP  +PP   PP  +PP  + P  +PP
Sbjct: 1134 PTVQPPTVQPPTNQPPTVQPPTVQPPTHHPPTNEPPTNRSPTKRPP 1179

 Score =  112 bits (281), Expect = 1e-23
 Identities = 41/102 (40%), Positives = 60/102 (58%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            +PP Y PP  +PP  +PP  +PP  +PP  +PP ++PP  +PP  +PP  +PP  +PP  
Sbjct: 1082 EPPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQPPTVQPPTV 1141

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 312
            +PP  +PP  +PP  +PP   PP  +PP  + P  +PP   P
Sbjct: 1142 QPPTNQPPTVQPPTVQPPTHHPPTNEPPTNRSPTKRPPSPSP 1183

 Score =  112 bits (280), Expect = 1e-23
 Identities = 43/111 (38%), Positives = 65/111 (58%)
 Frame = +1

Query: 25   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
            PP + P   +PP   PP  +PP  +PP ++PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 1075 PPTQPPT--EPPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQ 1132

Query: 205  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            PP  +PP  +PP  +PP  +PP  +PP + PP  +PP  + P ++PP   P
Sbjct: 1133 PPTVQPPTVQPPTNQPPTVQPPTVQPPTHHPPTNEPPTNRSPTKRPPSPSP 1183

[78][TOP]
>UniRef100_Q39614 Cuscuta reflexa proline-rich protein n=1 Tax=Cuscuta reflexa
           RepID=Q39614_CUSRE
          Length = 329

 Score =  116 bits (290), Expect = 9e-25
 Identities = 64/128 (50%), Positives = 76/128 (59%), Gaps = 10/128 (7%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKP 177
           KPPVY P V  PPV  PP     PP+  PPV K PP+ +PPV  PP + PP  +PPVY P
Sbjct: 83  KPPVYPPHVPNPPVVTPPTVPRLPPIVTPPVVKPPPIVEPPVVIPPPHIPP--QPPVYPP 140

Query: 178 PVEKPPVYKPPV--EKPPVYKPPVEK-PPVYKPPVE-KPPVYKPPVE---KPPVYKPPVE 336
            +  PPV  PP   + PP+  PPV K PP+ +PPV   PPV KPP     +PPVY P + 
Sbjct: 141 YIPNPPVVTPPTVPKLPPIVTPPVVKPPPIVEPPVVIPPPVVKPPPHIQPQPPVYPPYIP 200

Query: 337 KPPVYKPP 360
            PPV  PP
Sbjct: 201 NPPVVTPP 208

 Score =  115 bits (289), Expect = 1e-24
 Identities = 66/128 (51%), Positives = 76/128 (59%), Gaps = 10/128 (7%)
 Frame = +1

Query: 7   KPPVYKPP-VEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEK-PPV 168
           KPP  KPP   KPP  KPP    KPPVY P V  PPV  PP     PP+  PPV K PP+
Sbjct: 60  KPPTVKPPHFPKPPTVKPPHLPPKPPVYPPHVPNPPVVTPPTVPRLPPIVTPPVVKPPPI 119

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEK-PPVYKPPVE- 336
            +PPV  PP + PP  +PPVY P +  PPV  PP   + PP+  PPV K PP+ +PPV  
Sbjct: 120 VEPPVVIPPPHIPP--QPPVYPPYIPNPPVVTPPTVPKLPPIVTPPVVKPPPIVEPPVVI 177

Query: 337 KPPVYKPP 360
            PPV KPP
Sbjct: 178 PPPVVKPP 185

 Score =  108 bits (271), Expect = 1e-22
 Identities = 63/125 (50%), Positives = 76/125 (60%), Gaps = 8/125 (6%)
 Frame = +1

Query: 10  PPVY-KPPVEKPPVY-KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKP 177
           PP + KPP  KPP + KPP  KPP + PP  KPPVY P V  PPV  PP     PP+  P
Sbjct: 55  PPHFPKPPTVKPPHFPKPPTVKPP-HLPP--KPPVYPPHVPNPPVVTPPTVPRLPPIVTP 111

Query: 178 PVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEK-PP 345
           PV K PP+ +PPV  PP + PP  +PPVY P +  PPV  PP   + PP+  PPV K PP
Sbjct: 112 PVVKPPPIVEPPVVIPPPHIPP--QPPVYPPYIPNPPVVTPPTVPKLPPIVTPPVVKPPP 169

Query: 346 VYKPP 360
           + +PP
Sbjct: 170 IVEPP 174

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 56/117 (47%), Positives = 64/117 (54%), Gaps = 13/117 (11%)
 Frame = +1

Query: 49  YKPPVEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPV 213
           + P   KPP  KPP   KPP  KPP    KPPVY P V  PPV  PP     PP+  PPV
Sbjct: 54  FPPHFPKPPTVKPPHFPKPPTVKPPHLPPKPPVYPPHVPNPPVVTPPTVPRLPPIVTPPV 113

Query: 214 EK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-------PPVEKPPVYKPP 360
            K PP+ +PPV  PP + PP  +PPVY P +  PPV         PP+  PPV KPP
Sbjct: 114 VKPPPIVEPPVVIPPPHIPP--QPPVYPPYIPNPPVVTPPTVPKLPPIVTPPVVKPP 168

[79][TOP]
>UniRef100_Q1MTH2 Novel protein (Fragment) n=1 Tax=Danio rerio RepID=Q1MTH2_DANRE
          Length = 201

 Score =  115 bits (289), Expect = 1e-24
 Identities = 55/108 (50%), Positives = 66/108 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 61  ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 120

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 327
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 121 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 168

 Score =  115 bits (289), Expect = 1e-24
 Identities = 55/108 (50%), Positives = 66/108 (61%)
 Frame = +1

Query: 34  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 213
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 61  ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 120

Query: 214 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P
Sbjct: 121 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 168

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 54/136 (39%), Positives = 64/136 (47%), Gaps = 21/136 (15%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY----------------KPPVEKPPVYK 144
           PV  P  E PPV  P  E+ P   P     P                  +PPV  P   +
Sbjct: 15  PVSAPAPECPPVSAPAPEQDP--SPDHNTLPSQTTRRRRHRKRTAHVPERPPVSAPAPER 72

Query: 145 PPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 309
           PPV     E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+
Sbjct: 73  PPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPER 132

Query: 310 PPVYKPPVEKPPVYKP 357
           PPV  P  E+PPV  P
Sbjct: 133 PPVSAPAPERPPVSAP 148

[80][TOP]
>UniRef100_Q1XBU0 Foot protein 1 n=1 Tax=Mytilus edulis RepID=Q1XBU0_MYTED
          Length = 565

 Score =  115 bits (288), Expect = 2e-24
 Identities = 55/115 (47%), Positives = 59/115 (51%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYKP +  PP YKP    PP YK      P YKP +  PP YK     PP YKP    
Sbjct: 124 PPVYKPKMTYPPTYKPKPSYPPTYK----SKPTYKPKITCPPTYKAKPSYPPTYKPKKTY 179

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP V  PP YKP    PP+YK      P YKP +  PP YK     PP YK
Sbjct: 180 PPTYKPKVTYPPTYKPKPSYPPIYK----SKPTYKPKITYPPTYKAKPSYPPTYK 230

 Score =  108 bits (271), Expect = 1e-22
 Identities = 52/112 (46%), Positives = 56/112 (50%)
 Frame = +1

Query: 19  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 198
           Y      PPVYKP +  PP YKP    PP YK      P YKP +  PP YK     PP 
Sbjct: 117 YNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYK----SKPTYKPKITCPPTYKAKPSYPPT 172

Query: 199 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           YKP    PP YKP V  PP YKP    PP+YK      P YKP +  PP YK
Sbjct: 173 YKPKKTYPPTYKPKVTYPPTYKPKPSYPPIYK----SKPTYKPKITYPPTYK 220

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/126 (42%), Positives = 57/126 (45%), Gaps = 12/126 (9%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK------ 174
           P YKP +  PP YK     PP YKP    PP YKP V  PP YKP    PP+YK      
Sbjct: 151 PTYKPKITCPPTYKAKPSYPPTYKPKKTYPPTYKPKVTYPPTYKPKPSYPPIYKSKPTYK 210

Query: 175 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEK-----PPVYKPPVEKPPVYKPPVE 336
           P +  PP YK     PP YK     PP YK  P  K     P  YK     PP YK    
Sbjct: 211 PKITYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPPTYKAKPS 270

Query: 337 KPPVYK 354
            PP YK
Sbjct: 271 YPPTYK 276

 Score =  100 bits (250), Expect = 4e-20
 Identities = 53/120 (44%), Positives = 57/120 (47%), Gaps = 7/120 (5%)
 Frame = +1

Query: 19  YKPPVEKPPVYKP-------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           Y P  +K   YKP           PPVYKP +  PP YKP    PP YK      P YKP
Sbjct: 100 YLPLAKKLSSYKPIKTTYNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYK----SKPTYKP 155

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            +  PP YK     PP YKP    PP YKP V  PP YKP    PP+YK      P YKP
Sbjct: 156 KITCPPTYKAKPSYPPTYKPKKTYPPTYKPKVTYPPTYKPKPSYPPIYK----SKPTYKP 211

 Score =  100 bits (250), Expect = 4e-20
 Identities = 54/138 (39%), Positives = 56/138 (40%), Gaps = 22/138 (15%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-------------- 147
           PP YKP +  PP YK     P  YK     PP YK     PP YK               
Sbjct: 390 PPTYKPKISYPPTYKAKPSYPSTYKAKSSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTY 449

Query: 148 ---PVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 303
              P  K     PP YK     PP YKP    PP YK     P  YKP    PP YKP +
Sbjct: 450 KAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKL 509

Query: 304 EKPPVYKPPVEKPPVYKP 357
             PP YKP    PP YKP
Sbjct: 510 TYPPTYKPKPSYPPSYKP 527

 Score =  100 bits (248), Expect = 7e-20
 Identities = 47/113 (41%), Positives = 50/113 (44%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P YK     PP YK     PP YKP    PP YK     P  YKP    PP YKP +  P
Sbjct: 453 PTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYP 512

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           P YKP    PP YKP +  P  YK     PP YK     PP Y   +  P  Y
Sbjct: 513 PTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTSYPPTYNKKISYPSQY 565

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 49/117 (41%), Positives = 53/117 (45%), Gaps = 2/117 (1%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PP YK  P  +  P Y    +  P YK     PP YK     PP YKP    PP YK   
Sbjct: 430 PPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKS 489

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
             P  YKP    PP YKP +  PP YKP    PP YKP +  P  YK     PP YK
Sbjct: 490 SYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYK 546

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 47/113 (41%), Positives = 50/113 (44%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P Y    +  P YK     PP YK     PP YKP    PP YK     P  YKP    P
Sbjct: 443 PTYPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYP 502

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           P YKP +  PP YKP    PP YKP +  P  YK     PP YK     PP Y
Sbjct: 503 PTYKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTSYPPTY 555

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 54/130 (41%), Positives = 61/130 (46%), Gaps = 13/130 (10%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYK------PPVEKPPVYKP-------PVEKPPVYKP 147
           KPP Y+  ++K   Y+P    PP Y       P  +K   YKP           PPVYKP
Sbjct: 71  KPPTYQQ-LKKKVDYRPTKSYPPTYGSKTNYLPLAKKLSSYKPIKTTYNAKTNYPPVYKP 129

Query: 148 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 327
            +  PP YKP    PP YK      P YKP +  PP YK     PP YKP    PP YKP
Sbjct: 130 KMTYPPTYKPKPSYPPTYK----SKPTYKPKITCPPTYKAKPSYPPTYKPKKTYPPTYKP 185

Query: 328 PVEKPPVYKP 357
            V  PP YKP
Sbjct: 186 KVTYPPTYKP 195

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 44/104 (42%), Positives = 47/104 (45%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    
Sbjct: 462 PPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSY 521

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 321
           PP YKP +  P  YK     PP YK     PP Y   +  P  Y
Sbjct: 522 PPSYKPKITYPSTYKLKPSYPPTYKSKTSYPPTYNKKISYPSQY 565

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 59/163 (36%), Positives = 61/163 (37%), Gaps = 48/163 (29%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK------PPVEKPPVYKPPVEKPPVY 171
           PP YKP    PP YKP V  PP YKP    PP+YK      P +  PP YK     PP Y
Sbjct: 170 PPTYKPKKTYPPTYKPKVTYPPTYKPKPSYPPIYKSKPTYKPKITYPPTYKAKPSYPPTY 229

Query: 172 K-----PPVEK---------------------PPVYKPPVEKPPVYK-----PPVEK--- 249
           K     PP  K                     PP YK     PP YK     PP  K   
Sbjct: 230 KAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPPTYKAKPSYPPTYKAKPSYPPTYKAKP 289

Query: 250 --------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
                   PP YK     PP YK     PP YK     PP YK
Sbjct: 290 TYIAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKSSYPPTYK 332

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/128 (38%), Positives = 52/128 (40%), Gaps = 12/128 (9%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPV 183
           P  YK     PP YKP +  PP YK     P  YK     PP YK     PP YK  P  
Sbjct: 380 PSTYKAKPSYPPTYKPKISYPPTYKAKPSYPSTYKAKSSYPPTYKAKPSYPPTYKAKPTY 439

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKP-----PVYKPPVEKPPVYKPPV 333
           +  P Y    +  P YK     PP YK     PP  KP     P YK     P  YKP  
Sbjct: 440 KAKPTYPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKK 499

Query: 334 EKPPVYKP 357
             PP YKP
Sbjct: 500 TYPPTYKP 507

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 43/117 (36%), Positives = 47/117 (40%), Gaps = 2/117 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PP YK     PP YK  P  +  P Y    +  P Y P  +  P YK     P  YK   
Sbjct: 318 PPTYKAKSSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKP 377

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
             P  YK     PP YKP +  PP YK     P  YK     PP YK     PP YK
Sbjct: 378 TYPSTYKAKPSYPPTYKPKISYPPTYKAKPSYPSTYKAKSSYPPTYKAKPSYPPTYK 434

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 45/123 (36%), Positives = 48/123 (39%), Gaps = 7/123 (5%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P YK     P  YK     P  YK     PP YKP +  PP YK     P  YK     P
Sbjct: 361 PTYKAKPTYPSTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYKAKPSYPSTYKAKSSYP 420

Query: 193 PVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKPPVY 351
           P YK     PP YK  P  +  P Y    +  P YK     PP YK     PP  KP   
Sbjct: 421 PTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPS 480

Query: 352 KPP 360
            PP
Sbjct: 481 YPP 483

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 50/130 (38%), Positives = 58/130 (44%), Gaps = 15/130 (11%)
 Frame = +1

Query: 13  PVYKPPVE------KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-- 168
           PVYKP         KPP Y+  ++K   Y+P    PP Y       P+ K      P+  
Sbjct: 57  PVYKPVKTSYSAPYKPPTYQQ-LKKKVDYRPTKSYPPTYGSKTNYLPLAKKLSSYKPIKT 115

Query: 169 -YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEK-----PPVYKP 327
            Y      PPVYKP +  PP YKP    PP YK  P  KP +  PP  K     PP YKP
Sbjct: 116 TYNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYKSKPTYKPKITCPPTYKAKPSYPPTYKP 175

Query: 328 PVEKPPVYKP 357
               PP YKP
Sbjct: 176 KKTYPPTYKP 185

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 48/127 (37%), Positives = 50/127 (39%), Gaps = 12/127 (9%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEK-----PPVYKPPVEKPPVY 171
           PP YK     PP YK     PP YK     PP YK  P  K     P  YK     PP Y
Sbjct: 298 PPTYKAKPSYPPTYKAKPSYPPTYKAKSSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTY 357

Query: 172 K--PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 333
           K  P  +     P  YK     P  YK     PP YKP +  PP YK     P  YK   
Sbjct: 358 KAKPTYKAKPTYPSTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYKAKPSYPSTYKAKS 417

Query: 334 EKPPVYK 354
             PP YK
Sbjct: 418 SYPPTYK 424

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 62/179 (34%), Positives = 64/179 (35%), Gaps = 64/179 (35%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK------PPVEKPPVYK-----PPVEK-----PPVY 141
           PP YKP V  PP YKP    PP+YK      P +  PP YK     PP  K     PP Y
Sbjct: 180 PPTYKPKVTYPPTYKPKPSYPPIYKSKPTYKPKITYPPTYKAKPSYPPTYKAKPSYPPTY 239

Query: 142 K---------------------PPVEK-----PPVYK-----PPVEK-----------PP 195
           K                     PP  K     PP YK     PP  K           PP
Sbjct: 240 KAKPTYKAKPTYPSTYKAKPTYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYIAKPSYPP 299

Query: 196 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEK-----PPVYKPPVEKPPVYK 354
            YK     PP YK     PP YK     PP YK  P  K     P  YK     PP YK
Sbjct: 300 TYKAKPSYPPTYKAKPSYPPTYKAKSSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYK 358

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/134 (35%), Positives = 50/134 (37%), Gaps = 18/134 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK-----------PPVEK-----PPVYKPPVEKPPVY 141
           PP YK     PP YK     PP YK           PP  K     PP YK     PP Y
Sbjct: 262 PPTYKAKPSYPPTYKAKPSYPPTYKAKPTYIAKPSYPPTYKAKPSYPPTYKAKPSYPPTY 321

Query: 142 KPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
           K     PP YK  P  +  P Y    +  P Y P  +  P YK     P  YK     P 
Sbjct: 322 KAKSSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPS 381

Query: 316 VYKPPVEKPPVYKP 357
            YK     PP YKP
Sbjct: 382 TYKAKPSYPPTYKP 395

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 42/118 (35%), Positives = 47/118 (39%), Gaps = 4/118 (3%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PP YK  P  +  P Y    +  P Y P  +  P YK     P  YK     P  YK   
Sbjct: 328 PPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPSTYKAKP 387

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVY 351
             PP YKP +  PP YK     P  YK     PP YK     PP Y  KP  +  P Y
Sbjct: 388 SYPPTYKPKISYPPTYKAKPSYPSTYKAKSSYPPTYKAKPSYPPTYKAKPTYKAKPTY 445

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 46/131 (35%), Positives = 48/131 (36%), Gaps = 16/131 (12%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P Y P  +  P YK     P  YK     P  YK     PP YKP +  PP YK     P
Sbjct: 351 PSYPPTYKAKPTYKAKPTYPSTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYKAKPSYP 410

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK-----------PPVYK 324
             YK     PP YK     PP YK      P YK     P   K           PP YK
Sbjct: 411 STYKAKSSYPPTYKAKPSYPPTYK----AKPTYKAKPTYPSTYKAKPTYKAKPTYPPTYK 466

Query: 325 PPVEKPPVYKP 357
                PP YKP
Sbjct: 467 AKPSYPPTYKP 477

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 28/75 (37%), Positives = 31/75 (41%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KP    PP  KP      +  PP YKP    PP YKP +  P  YK     PP YK    
Sbjct: 496 KPKKTYPPTYKP-----KLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTS 550

Query: 187 KPPVYKPPVEKPPVY 231
            PP Y   +  P  Y
Sbjct: 551 YPPTYNKKISYPSQY 565

[81][TOP]
>UniRef100_C5V8E8 Iron-sulphur-binding reductase n=1 Tax=Corynebacterium matruchotii
            ATCC 14266 RepID=C5V8E8_9CORY
          Length = 1034

 Score =  115 bits (287), Expect = 2e-24
 Identities = 58/126 (46%), Positives = 65/126 (51%), Gaps = 10/126 (7%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYK-------PPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            PP   PP  +PPV +PP    P          P    P    P   +PPV KPP   PP 
Sbjct: 894  PPKAAPPTAQPPVARPPAATAPTAPAAPGGSVPKTVAPGATIPGTARPPVAKPPAPTPPT 953

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
             KPP   PPV KPP   PP   PP  +P   PV KPP  KPPV +PPV KPPV KPP+ K
Sbjct: 954  AKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVAKPPVAKPPMAK 1013

Query: 340  PPVYKP 357
            PP+  P
Sbjct: 1014 PPMVPP 1019

 Score =  102 bits (255), Expect = 1e-20
 Identities = 63/167 (37%), Positives = 69/167 (41%), Gaps = 50/167 (29%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPP-VYKP--------------PVEKPPVYKPPVEKPPVYK 144
            PP   PP   PP  +P    PP V  P              P   PP   PP  +PPV +
Sbjct: 849  PPAATPPGATPPGGRPATPTPPGVAVPGAAAPGSAVPPAAMPKATPPKAAPPTAQPPVAR 908

Query: 145  PP---------------------------VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 243
            PP                             +PPV KPP   PP  KPP   PPV KPP 
Sbjct: 909  PPAATAPTAPAAPGGSVPKTVAPGATIPGTARPPVAKPPAPTPPTAKPPAAAPPVAKPPT 968

Query: 244  EKPPVYKP--------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
              PP   P        PV KPP  KPPV +PPV KPPV KPP+ KPP
Sbjct: 969  ATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVAKPPVAKPPMAKPP 1015

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 45/80 (56%), Positives = 50/80 (62%), Gaps = 3/80 (3%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKP 177
            +PPV KPP   PP  KPP   PPV KPP   PP   PP  +P   PV KPP  KPPV +P
Sbjct: 940  RPPVAKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQP 999

Query: 178  PVEKPPVYKPPVEKPPVYKP 237
            PV KPPV KPP+ KPP+  P
Sbjct: 1000 PVAKPPVAKPPMAKPPMVPP 1019

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 52/162 (32%), Positives = 56/162 (34%), Gaps = 50/162 (30%)
 Frame = +1

Query: 25   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
            P    PP   PP   PP  +P    PP    P    P    P    P   PP   PP  +
Sbjct: 844  PGAAIPPAATPPGATPPGGRPATPTPPGVAVPGAAAPGSAVPPAAMPKATPPKAAPPTAQ 903

Query: 205  PPV--------------------------------EKPPVYKPPVEKPPVYKPPVEKPPV 288
            PPV                                 +PPV KPP   PP  KPP   PPV
Sbjct: 904  PPVARPPAATAPTAPAAPGGSVPKTVAPGATIPGTARPPVAKPPAPTPPTAKPPAAAPPV 963

Query: 289  YKP------------------PVEKPPVYKPPVEKPPVYKPP 360
             KP                  PV KPP  KPPV +PPV KPP
Sbjct: 964  AKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVAKPP 1005

[82][TOP]
>UniRef100_O24300 PtxA protein n=1 Tax=Pisum sativum RepID=O24300_PEA
          Length = 352

 Score =  115 bits (287), Expect = 2e-24
 Identities = 71/124 (57%), Positives = 77/124 (62%), Gaps = 6/124 (4%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVY-KPPVEKPP-VYKP 177
           KPP +KPP+ KPPV+KPP  KP    PP   P   KPP V KPP Y KPP   PP V KP
Sbjct: 34  KPPTHKPPIVKPPVHKPP--KPQPCPPPSSSP---KPPHVPKPPHYPKPPAVHPPHVPKP 88

Query: 178 PVEKPP-VYKPPVEKPPVYKPP-VEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPV 348
           P   PP V KPPV  PP+  PP V KPPV KPPV KPP V KPPV   PV  P + KPP+
Sbjct: 89  PAVHPPHVPKPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPV--VPVTPPYIPKPPI 146

Query: 349 YKPP 360
             PP
Sbjct: 147 VFPP 150

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 68/124 (54%), Positives = 73/124 (58%), Gaps = 6/124 (4%)
 Frame = +1

Query: 7   KPPVYKPP-VEKPPVYKPPVEKPP-VYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKP 177
           KPP   PP V KPPV  PP+  PP V KPPV KPPV KPP V KPPV   PV  P + KP
Sbjct: 87  KPPAVHPPHVPKPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPVV--PVTPPYIPKP 144

Query: 178 PVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPP-V 348
           P+  PP V  PPV   PV  P V KPP+  PP V  PPV   PV  P V KPP+  PP V
Sbjct: 145 PIVFPPHVPLPPV--VPVTPPYVPKPPIVFPPHVPLPPVV--PVTPPYVPKPPIVFPPHV 200

Query: 349 YKPP 360
             PP
Sbjct: 201 PLPP 204

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 60/170 (35%), Positives = 67/170 (39%), Gaps = 60/170 (35%)
 Frame = +1

Query: 7   KPPVYKPPVEKPP-VYKPPVEKPPVYKPP-VEKPPVYK---PPVEKPPVYKPP------- 150
           KPPV  PP+  PP V KPPV KPPV KPP V KPPV     P + KPP+  PP       
Sbjct: 98  KPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPVVPVTPPYIPKPPIVFPPHVPLPPV 157

Query: 151 -------VEKPPVYKPP--------------VEKPPVYKPP------------------- 210
                  V KPP+  PP              V KPP+  PP                   
Sbjct: 158 VPVTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPLPP 217

Query: 211 --------VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
                   V  PP+  PP    PV  PP E P    PP   P  Y PP +
Sbjct: 218 VVPVTPPFVPTPPIITPPTPTVPVPSPPSETPCPPPPPTVVP--YPPPAQ 265

[83][TOP]
>UniRef100_UPI0001983484 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983484
          Length = 306

 Score =  114 bits (286), Expect = 3e-24
 Identities = 76/131 (58%), Positives = 87/131 (66%), Gaps = 14/131 (10%)
 Frame = +1

Query: 10  PPVYKPPVE-KPPVYKPPVE-KPPVYKPPVEKP-PVYKPPVEKPPVYKPP--VEKPPVYK 174
           PP  KPP E KP V KPP E K P   P  EKP P +KPP    P+ KPP   + PP +K
Sbjct: 28  PPTKKPPPEHKPSVEKPPPEHKSPTKPPKGEKPLPEHKPPT---PIGKPPKGEKPPPEHK 84

Query: 175 PPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKP-PVEKPPVYKPPV-- 333
           PPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KP P+EKPP  + P+  
Sbjct: 85  PPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPTPLEKPPKGEKPLPE 144

Query: 334 EKP--PVYKPP 360
            KP  PV KPP
Sbjct: 145 HKPPTPVGKPP 155

 Score =  112 bits (279), Expect = 2e-23
 Identities = 80/147 (54%), Positives = 94/147 (63%), Gaps = 27/147 (18%)
 Frame = +1

Query: 1   QEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKP-PVEKPP 165
           ++ PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KP P+EKPP
Sbjct: 77  EKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPTPLEKPP 136

Query: 166 VYKPPV--EKP--PVYKPPV-EKPPVY-----KPPVE------KP--PVYKPPV-EKPPV 288
             + P+   KP  PV KPP  EKPP Y      PP E      KP  PV KPP  EKPP 
Sbjct: 137 KGEKPLPEHKPPTPVGKPPKGEKPPHYGHNPGHPPAENAEDSYKPPTPVGKPPKGEKPPE 196

Query: 289 YKPPVEKPPVYKPPVE-KP--PVYKPP 360
           +K P + P   KP +E KP  P+ KPP
Sbjct: 197 HKSPTKPPKGEKPLLEHKPPTPIGKPP 223

 Score =  110 bits (275), Expect = 5e-23
 Identities = 70/122 (57%), Positives = 80/122 (65%), Gaps = 9/122 (7%)
 Frame = +1

Query: 22  KPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKP-PVYKPPVEKPPVYKPP--VEK 189
           KPP  K P   PP  KP V KPP E K P   P  EKP P +KPP    P+ KPP   + 
Sbjct: 26  KPPPTKKP---PPEHKPSVEKPPPEHKSPTKPPKGEKPLPEHKPPT---PIGKPPKGEKP 79

Query: 190 PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKP-PVEKPPVYK 354
           PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KP P+EKPP  +
Sbjct: 80  PPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPTPLEKPPKGE 139

Query: 355 PP 360
            P
Sbjct: 140 KP 141

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 74/214 (34%), Positives = 87/214 (40%), Gaps = 94/214 (43%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKP-PVEKPPV---------- 138
           ++ PP +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KP P+EKPP           
Sbjct: 88  EKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPTPLEKPPKGEKPLPEHKP 147

Query: 139 -------------------------------YKPPV--------EKPPVYKPPVEKP--- 192
                                          YKPP         EKPP +K P + P   
Sbjct: 148 PTPVGKPPKGEKPPHYGHNPGHPPAENAEDSYKPPTPVGKPPKGEKPPEHKSPTKPPKGE 207

Query: 193 ----------------------PVYKPPV--------EKPPVY-----KPPVE-KPPVYK 264
                                 P +KPP         EKPP Y      PPVE K   YK
Sbjct: 208 KPLLEHKPPTPIGKPPKGEKQLPEHKPPTPVGKPPKGEKPPHYGHNPGHPPVESKEDSYK 267

Query: 265 PPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPP 360
           PP +  P   P   + P  KPP    KPP +KPP
Sbjct: 268 PPHKIEPPSAPKKPQAPEKKPPTPPHKPP-HKPP 300

[84][TOP]
>UniRef100_Q39353 Cell wall-plasma membrane linker protein n=1 Tax=Brassica napus
           RepID=Q39353_BRANA
          Length = 376

 Score =  114 bits (286), Expect = 3e-24
 Identities = 61/123 (49%), Positives = 62/123 (50%), Gaps = 5/123 (4%)
 Frame = +1

Query: 7   KPPVYKPP--VEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 171
           KPP  KPP    KPP +KPP   P   P   PPV  PP   PP   PPV  PP   PPV 
Sbjct: 148 KPPTVKPPPSTPKPPTHKPPTVCPPPTPTPTPPVVTPPT--PPTPTPPVVTPPTPAPPVV 205

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
            PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV 
Sbjct: 206 TPPTPTPPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVV 261

Query: 352 KPP 360
            PP
Sbjct: 262 TPP 264

 Score =  113 bits (283), Expect = 6e-24
 Identities = 60/129 (46%), Positives = 61/129 (47%), Gaps = 11/129 (8%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYK-----------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 153
           KPP +KPP   PP              PP   PPV  PP   PPV  PP   PPV  PP 
Sbjct: 160 KPPTHKPPTVCPPPTPTPTPPVVTPPTPPTPTPPVVTPPTPAPPVVTPPTPTPPVVTPPT 219

Query: 154 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 333
             PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP 
Sbjct: 220 PTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PPVVTPPT 273

Query: 334 EKPPVYKPP 360
             PPV  PP
Sbjct: 274 PTPPVVTPP 282

 Score =  110 bits (276), Expect = 4e-23
 Identities = 63/131 (48%), Positives = 64/131 (48%), Gaps = 13/131 (9%)
 Frame = +1

Query: 7   KPPVYKPPVEKP-PVYKPPVEKPPVYKP-PVEKPPVYKPPVE------KPPVYKPP--VE 156
           KPP  KPP   P P  KPP  KPP   P P  KPP  KPP        KPP  KPP    
Sbjct: 100 KPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTP 159

Query: 157 KPPVYKPPVEKP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 327
           KPP +KPP   P   P   PPV  PP   PP   PPV  PP   PPV  PP   PPV  P
Sbjct: 160 KPPTHKPPTVCPPPTPTPTPPVVTPPT--PPTPTPPVVTPPTPAPPVVTPPTPTPPVVTP 217

Query: 328 PVEKPPVYKPP 360
           P   PPV  PP
Sbjct: 218 PTPTPPVVTPP 228

 Score =  110 bits (275), Expect = 5e-23
 Identities = 57/115 (49%), Positives = 57/115 (49%), Gaps = 3/115 (2%)
 Frame = +1

Query: 10  PPVYKPPVEK---PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           PPV  PP      PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP
Sbjct: 179 PPVVTPPTPPTPTPPVVTPPTPAPPVVTPPTPTPPVVTPPTPTPPVVTPPT--PPVVTPP 236

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
              PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 237 TPTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPTPTPP 287

 Score =  106 bits (265), Expect = 7e-22
 Identities = 67/130 (51%), Positives = 70/130 (53%), Gaps = 12/130 (9%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKPP 180
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP P  KPP  +P P  KPP    P
Sbjct: 45  KPP--KPPAAKPP--KPPAVKPP--KPPT-KPPTLKPHPHPKPPTVRPHPHPKPPTKPHP 97

Query: 181 VEKPPVYKPPVE------KPPVYKPPVEKP-PVYKPPVEKPPVYKP-PVEKPPVYKPP-- 330
           + KPP  KPP        KPP  KPP   P P  KPP  KPP   P P  KPP  KPP  
Sbjct: 98  IPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPS 157

Query: 331 VEKPPVYKPP 360
             KPP +KPP
Sbjct: 158 TPKPPTHKPP 167

 Score =  100 bits (248), Expect = 7e-20
 Identities = 65/129 (50%), Positives = 68/129 (52%), Gaps = 12/129 (9%)
 Frame = +1

Query: 10  PPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKP- 177
           P  +KPP    KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP P  KPP  +P 
Sbjct: 34  PRPHKPPKHPVKPP--KPPAAKPP--KPPAVKPP--KPPT-KPPTLKPHPHPKPPTVRPH 86

Query: 178 PVEKPPVYKPPVEKPPVYKPPVE------KPPVYKPPVEKP-PVYKPPVEKPPVYKP-PV 333
           P  KPP    P+ KPP  KPP        KPP  KPP   P P  KPP  KPP   P P 
Sbjct: 87  PHPKPPTKPHPIPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPP 146

Query: 334 EKPPVYKPP 360
            KPP  KPP
Sbjct: 147 TKPPTVKPP 155

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 61/118 (51%), Positives = 64/118 (54%), Gaps = 6/118 (5%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPP 195
           PP   P  +KPP    KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP P  KPP
Sbjct: 29  PPKPSPRPHKPPKHPVKPP--KPPAAKPP--KPPAVKPP--KPPT-KPPTLKPHPHPKPP 81

Query: 196 VYKP-PVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKP-PVEKPPVYKPP 360
             +P P  KPP    P+ KPP  KPP   P P  KPP  KPP   P P  KPP  KPP
Sbjct: 82  TVRPHPHPKPPTKPHPIPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPP 139

[85][TOP]
>UniRef100_B4G234 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4G234_MAIZE
          Length = 304

 Score =  113 bits (283), Expect = 6e-24
 Identities = 63/118 (53%), Positives = 70/118 (59%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           K P Y PPV  PP  K PV +PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+ 
Sbjct: 86  KSPSY-PPVVGPP--KGPVTRPPVMRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPIT 140

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PPV  PPV  PP+  PP   PPV  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 141 GPPT-TPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPPATTPPVTGPPVTYPP 196

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 59/124 (47%), Positives = 67/124 (54%), Gaps = 8/124 (6%)
 Frame = +1

Query: 10  PPVYKP----PVEKPPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 165
           PP  KP    P  KP   KPP        P ++PP  K P Y PPV  PP  K PV +PP
Sbjct: 51  PPKTKPSHPSPSPKPKNPKPPKGSTGYPAPGHQPP--KSPSY-PPVVGPP--KGPVTRPP 105

Query: 166 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           V +PPV  PP  K PV +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP+  PP
Sbjct: 106 VMRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPP 162

Query: 346 VYKP 357
              P
Sbjct: 163 TTPP 166

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/114 (45%), Positives = 58/114 (50%), Gaps = 7/114 (6%)
 Frame = +1

Query: 7   KPPVYKPP---VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           +PPV  PP   V +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP+  PP   P
Sbjct: 108 RPPVVGPPKGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPPT-TP 165

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP----VEKPPVYKPPVEKPPVYKP 327
           PV  PPV  PP+  PP   PPV  PPV  PP        P   PP   P    P
Sbjct: 166 PVVGPPVTYPPITGPPATTPPVTGPPVTYPPGGGGGSSTPCPPPPSPTPTPSSP 219

[86][TOP]
>UniRef100_C9ZT09 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei
           gambiense DAL972 RepID=C9ZT09_TRYBG
          Length = 507

 Score =  113 bits (283), Expect = 6e-24
 Identities = 72/181 (39%), Positives = 89/181 (49%), Gaps = 67/181 (37%)
 Frame = +1

Query: 19  YKPPVEKP--PVYKPPVEKPP--VYKPPVEKPP--VYKPPVEKP--PVYKPPVEKPP--- 165
           YKPPV+KP   VY+PP EKP    Y+PP +KP    YKPP +KP    Y+PP +KP    
Sbjct: 227 YKPPVDKPVSGVYRPPTEKPTSGAYRPPTDKPATGAYKPPTDKPFSGAYRPPADKPSSGA 286

Query: 166 -----------------------------VYKPPVEKPP--VYKPPVEKPP--VYKPPVE 246
                                         Y+PP++KP    YKPPV+KP    YKPP +
Sbjct: 287 YRPTAAKLGEVMAAATARDETSSEKPAVGAYRPPIDKPSSGAYKPPVDKPSSGAYKPPTD 346

Query: 247 KPPV--YKPPVEKPP-----------------VYKPPVEKPP--VYKPPVEKPP--VYKP 357
           KP +  YKPP EKP                   Y+PP +KPP  VYKPPV+KP    Y+P
Sbjct: 347 KPSLGAYKPPSEKPASVPAVPAESSAVKPSTGAYRPPTDKPPTGVYKPPVDKPSTGAYRP 406

Query: 358 P 360
           P
Sbjct: 407 P 407

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 49/122 (40%), Positives = 66/122 (54%), Gaps = 23/122 (18%)
 Frame = +1

Query: 4   EKPP--VYKPPVEKPP--VYKPPVEKPP---VYKPPVEKPPVYKP----PVEKPP--VYK 144
           +KPP  VYKPPV+KP    Y+PP +KP     Y PP E+     P     VEKP    YK
Sbjct: 385 DKPPTGVYKPPVDKPSTGAYRPPTDKPSSGGAYVPPSERLATAAPGEQLSVEKPSAGTYK 444

Query: 145 PPVEK--PPVYKPPVEKPP--VYKPPVEK--PPVYKPPVEKPP--VYKPPVEKP--PVYK 294
           PP ++     YKPP ++P    YKPP +K     Y+PP ++P    Y+PP E+     ++
Sbjct: 445 PPTDRVSSGSYKPPTDRPSAGAYKPPTDKLSSGAYRPPTDRPSSGAYRPPAERSFGSTFR 504

Query: 295 PP 300
           PP
Sbjct: 505 PP 506

[87][TOP]
>UniRef100_Q39835 Extensin n=1 Tax=Glycine max RepID=Q39835_SOYBN
          Length = 432

 Score =  113 bits (282), Expect = 8e-24
 Identities = 72/142 (50%), Positives = 72/142 (50%), Gaps = 27/142 (19%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKP 162
           PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P   P
Sbjct: 235 PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPP 294

Query: 163 PVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPV 288
           PVYK     PPV K    PP YK P   PP YK P   PPVYK     PPV K    PP 
Sbjct: 295 PVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 354

Query: 289 YKPPVEKPPVYKPPVEKPPVYK 354
           YK P   PP YK P   PPVYK
Sbjct: 355 YKYPSPPPPPYKYPSPPPPVYK 376

 Score =  111 bits (277), Expect = 3e-23
 Identities = 68/135 (50%), Positives = 69/135 (51%), Gaps = 18/135 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----P 147
           PP YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     P
Sbjct: 284 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 343

Query: 148 PVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
           PV K    PP YK P   PP YK P   PPVYK     PP YK P   PP YK P   PP
Sbjct: 344 PVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPP 402

Query: 316 VYKPPVEKPPVYKPP 360
           VYK     PPV+ PP
Sbjct: 403 VYKYKSPPPPVHSPP 417

 Score =  109 bits (272), Expect = 1e-22
 Identities = 75/151 (49%), Positives = 75/151 (49%), Gaps = 36/151 (23%)
 Frame = +1

Query: 10  PPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PP 135
           PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PPV K    PP
Sbjct: 255 PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 314

Query: 136 VYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYK-----PPV 273
            YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK     PPV
Sbjct: 315 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPV 374

Query: 274 EK----PPVYKPPVEKPPVYKPPVEKPPVYK 354
            K    PP YK P   PP YK P   PPVYK
Sbjct: 375 YKYKSPPPPYKYPSPPPPPYKYPSPPPPVYK 405

 Score =  106 bits (265), Expect = 7e-22
 Identities = 73/149 (48%), Positives = 73/149 (48%), Gaps = 31/149 (20%)
 Frame = +1

Query: 7   KPPVYKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKP 147
           K P   PPV K    PP YK P   PP YK P   PPVYK     PPV K    PP YK 
Sbjct: 220 KYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKY 279

Query: 148 PVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-- 294
           P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK  
Sbjct: 280 PSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYK 339

Query: 295 ---PPVEK----PPVYKPPVEKPPVYKPP 360
              PPV K    PP YK P   PP YK P
Sbjct: 340 SPPPPVYKYKSPPPPYKYPSPPPPPYKYP 368

 Score =  103 bits (257), Expect = 6e-21
 Identities = 66/132 (50%), Positives = 67/132 (50%), Gaps = 18/132 (13%)
 Frame = +1

Query: 10  PPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PP 135
           PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PPV K    PP
Sbjct: 294 PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 353

Query: 136 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
            YK P   PP YK P   PPVYK     PP YK P   PP YK P   PPVYK     PP
Sbjct: 354 PYKYPSPPPPPYKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 412

Query: 316 VYKPPVEKPPVY 351
           V+ PP   PP Y
Sbjct: 413 VHSPP---PPHY 421

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 59/123 (47%), Positives = 61/123 (49%), Gaps = 9/123 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKP 162
           PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P   P
Sbjct: 313 PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPP 372

Query: 163 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
           PVYK     PP YK P   PP YK P   PPVYK     PPV+ PP   PP Y      P
Sbjct: 373 PVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVHSPP---PPHYIYASPPP 428

Query: 343 PVY 351
           P +
Sbjct: 429 PYH 431

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 62/130 (47%), Positives = 65/130 (50%), Gaps = 15/130 (11%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY----KPPVEKPPVYKPPVEKPPVY 171
           PP + PP   PP Y   PP   PP + PP   PP Y     PP +KP  YK P   PPVY
Sbjct: 181 PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYKSPPPPPKKP--YKYPSPPPPVY 229

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYK 324
           K     PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK
Sbjct: 230 KYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYK 288

Query: 325 PPVEKPPVYK 354
            P   PPVYK
Sbjct: 289 YPSPPPPVYK 298

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 61/135 (45%), Positives = 64/135 (47%), Gaps = 18/135 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY----KPPVEKP 162
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y     PP +KP
Sbjct: 165 PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYKSPPPPPKKP 218

Query: 163 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PP 315
             YK P   PPVYK     PP YK P   PP YK P   PPVYK     PPV K    PP
Sbjct: 219 --YKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPP 275

Query: 316 VYKPPVEKPPVYKPP 360
            YK P   PP YK P
Sbjct: 276 PYKYPSPPPPPYKYP 290

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 57/145 (39%), Positives = 61/145 (42%), Gaps = 30/145 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 133 PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 183

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY-----------------KPPVEK---- 279
           + PP   PP Y   PP   PP + PP   PP Y                  PPV K    
Sbjct: 184 HSPP---PPYYYHSPP---PPKHSPP---PPYYYKSPPPPPKKPYKYPSPPPPVYKYKSP 234

Query: 280 PPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK P   PP YK P   PPVYK
Sbjct: 235 PPPYKYPSPPPPPYKYPSPPPPVYK 259

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 54/135 (40%), Positives = 60/135 (44%), Gaps = 20/135 (14%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 117 PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 167

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPP----VEKPP--- 315
           + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP     + PP   
Sbjct: 168 HSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPPPPYYYKSPPPPP 215

Query: 316 --VYKPPVEKPPVYK 354
              YK P   PPVYK
Sbjct: 216 KKPYKYPSPPPPVYK 230

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 53/130 (40%), Positives = 59/130 (45%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 37  PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 87

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 330
           + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 88  HSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 132

Query: 331 VEKPPVYKPP 360
              PP + PP
Sbjct: 133 ---PPKHSPP 139

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 53/130 (40%), Positives = 59/130 (45%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 69  PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 119

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 330
           + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 120 HSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 164

Query: 331 VEKPPVYKPP 360
              PP + PP
Sbjct: 165 ---PPKHSPP 171

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 53/130 (40%), Positives = 59/130 (45%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 85  PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 135

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 330
           + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 136 HSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 180

Query: 331 VEKPPVYKPP 360
              PP + PP
Sbjct: 181 ---PPKHSPP 187

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 53/130 (40%), Positives = 59/130 (45%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 101 PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 151

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 330
           + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 152 HSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 196

Query: 331 VEKPPVYKPP 360
              PP + PP
Sbjct: 197 ---PPKHSPP 203

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 51/125 (40%), Positives = 58/125 (46%), Gaps = 10/125 (8%)
 Frame = +1

Query: 16  VYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPV 183
           +Y  P   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP 
Sbjct: 31  IYSSP--PPPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP- 75

Query: 184 EKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPP 345
             PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP
Sbjct: 76  --PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PP 118

Query: 346 VYKPP 360
            + PP
Sbjct: 119 KHSPP 123

[88][TOP]
>UniRef100_UPI000198347D PREDICTED: hypothetical protein isoform 2 n=1 Tax=Vitis vinifera
           RepID=UPI000198347D
          Length = 217

 Score =  112 bits (281), Expect = 1e-23
 Identities = 82/143 (57%), Positives = 88/143 (61%), Gaps = 23/143 (16%)
 Frame = +1

Query: 1   QEKPP--VYK-PPVEKPPV-YKPPVEKPPVYKP-PVEKP--PVYK-PPVEK-PPVYKPPV 153
           + KPP  VYK PP+ KPP  YKPP    PVYKP PVEKP  PVY+ PPVEK PP YKPP 
Sbjct: 31  EHKPPLPVYKSPPLGKPPPEYKPPT---PVYKPPPVEKPPTPVYRPPPVEKPPPEYKPPT 87

Query: 154 EKPPVYK-PPVEK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPV----EKPPVYKPP--- 300
              PVYK PPVEK PP YKPP    PVYK PPVEK PP YKPP       PP +K P   
Sbjct: 88  ---PVYKPPPVEKPPPEYKPPT---PVYKPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLP 141

Query: 301 ---VEKPPVYKPPVEKPPVYKPP 360
              V  PP  KPP   P + +PP
Sbjct: 142 PRVVRPPPTPKPPTLPPIIVRPP 164

 Score =  108 bits (271), Expect = 1e-22
 Identities = 81/136 (59%), Positives = 86/136 (63%), Gaps = 18/136 (13%)
 Frame = +1

Query: 7   KPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-KP--PVYK-PPVEKP--PVYK-PPVEK 159
           KPP Y  KPP+   PVYK     PP+ KPP E KP  PVYK PPVEKP  PVY+ PPVEK
Sbjct: 26  KPPPYEHKPPL---PVYK----SPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEK 78

Query: 160 -PPVYKPPVEKPPVYK-PPVEK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPV----EKP 312
            PP YKPP    PVYK PPVEK PP YKPP    PVYK PPVEK PP YKPP       P
Sbjct: 79  PPPEYKPPT---PVYKPPPVEKPPPEYKPPT---PVYKPPPVEKPPPEYKPPTPVKPPPP 132

Query: 313 PVYKPPVEKPPVYKPP 360
           P +K P   P V +PP
Sbjct: 133 PKHKTPTLPPRVVRPP 148

 Score =  100 bits (250), Expect = 4e-20
 Identities = 73/136 (53%), Positives = 78/136 (57%), Gaps = 17/136 (12%)
 Frame = +1

Query: 4   EKPP--VYKPP-VEK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPVEKPPVYK-PPVEK- 159
           EKPP  VY+PP VEK PP YKPP    PVYK PPVEK PP YKPP    PVYK PPVEK 
Sbjct: 64  EKPPTPVYRPPPVEKPPPEYKPPT---PVYKPPPVEKPPPEYKPPT---PVYKPPPVEKP 117

Query: 160 PPVYKPPV----EKPPVYKPPVEKPPVYK-PPVEKPPVYKPPVEKPPVYKPPVEKPPVY- 321
           PP YKPP       PP +K P   P V + PP  KPP   P + +PP  K P      Y 
Sbjct: 118 PPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPTKEPSPPQGHYP 177

Query: 322 -KPPVEKPP--VYKPP 360
             PPVE PP   YK P
Sbjct: 178 GHPPVETPPSTPYKKP 193

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 47/119 (39%), Positives = 59/119 (49%), Gaps = 2/119 (1%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           ++ PP YKPP    PV  PP   PP +K P   P V +P    PP  KPP   P + +PP
Sbjct: 115 EKPPPEYKPPT---PVKPPP---PPKHKTPTLPPRVVRP----PPTPKPPTLPPIIVRPP 164

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP--PVYKPPVEKPPVY 351
             K P   PP    P + PPVE PP    P +KPP    P +KP  P +K     PP++
Sbjct: 165 PTKEP--SPPQGHYPGH-PPVETPP--STPYKKPPT---PEKKPWAPHHKHFKAPPPIH 215

[89][TOP]
>UniRef100_Q9LFR3 Putative uncharacterized protein F2G14_40 n=1 Tax=Arabidopsis
           thaliana RepID=Q9LFR3_ARATH
          Length = 275

 Score =  112 bits (281), Expect = 1e-23
 Identities = 68/135 (50%), Positives = 74/135 (54%), Gaps = 17/135 (12%)
 Frame = +1

Query: 7   KPPV--YKPPVE-----KPPVYKPPVEKPPV----YKPPVEKPPVYKPPVEKPPVYKPPV 153
           KPP   YKPP       KPP  KPPV+ P +     KPPV  PP+  PPV+ PP YKPP 
Sbjct: 53  KPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQ-PPTYKPPT 111

Query: 154 EKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPP 315
              P  KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP
Sbjct: 112 ---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPP 167

Query: 316 VYKPPVEKPPVYKPP 360
              PPV KPP   PP
Sbjct: 168 TTTPPV-KPPTTTPP 181

 Score =  112 bits (281), Expect = 1e-23
 Identities = 66/135 (48%), Positives = 73/135 (54%), Gaps = 18/135 (13%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPV----YKPPVEKPPVYKPPVEKP------PVYKPPVEKPPVYKPPVE 156
           KPP  KPPV+ P +     KPPV  PP+  PPV+ P      P  KPP  +PP YKPP  
Sbjct: 70  KPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTP 129

Query: 157 --KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPV 318
             KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV KPP   PPV+ PP 
Sbjct: 130 TVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPT 186

Query: 319 YKPPVE--KPPVYKP 357
           Y PP    KPP   P
Sbjct: 187 YNPPTTPVKPPTAPP 201

 Score =  108 bits (271), Expect = 1e-22
 Identities = 61/120 (50%), Positives = 66/120 (55%), Gaps = 4/120 (3%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P  KPP    P YKPP       KPP  KPPV  P +   PV KPPV  PP+  PPV+ P
Sbjct: 50  PALKPPT---PSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPVQ-P 104

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPP 360
           P YKPP    P  KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP
Sbjct: 105 PTYKPPT---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPP 160

 Score =  108 bits (269), Expect = 2e-22
 Identities = 67/127 (52%), Positives = 73/127 (57%), Gaps = 10/127 (7%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPV 168
           KPPV  PP++ PPV +PP  KPP    KPP  +PP YKPP    KPP   P  P   PPV
Sbjct: 89  KPPVSTPPIKLPPV-QPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPV 147

Query: 169 YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVE 336
             PPV+ PP YKPP    KPP   PPV KPP   PPV+ PP Y PP    KPP   PPV 
Sbjct: 148 QSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPV- 202

Query: 337 KPPVYKP 357
           KPP   P
Sbjct: 203 KPPTPPP 209

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 62/117 (52%), Positives = 66/117 (56%), Gaps = 8/117 (6%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYK 174
           +PP YKPP    P  KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YK
Sbjct: 103 QPPTYKPPT---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYK 158

Query: 175 PPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPV 333
           PP    KPP   PPV KPP   PPV+ PP Y PP    KPP   PPV KPP   PPV
Sbjct: 159 PPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPV-KPPT-PPPV 210

[90][TOP]
>UniRef100_Q2V375 Putative uncharacterized protein At5g14920.2 n=1 Tax=Arabidopsis
           thaliana RepID=Q2V375_ARATH
          Length = 223

 Score =  112 bits (281), Expect = 1e-23
 Identities = 68/135 (50%), Positives = 74/135 (54%), Gaps = 17/135 (12%)
 Frame = +1

Query: 7   KPPV--YKPPVE-----KPPVYKPPVEKPPV----YKPPVEKPPVYKPPVEKPPVYKPPV 153
           KPP   YKPP       KPP  KPPV+ P +     KPPV  PP+  PPV+ PP YKPP 
Sbjct: 53  KPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQ-PPTYKPPT 111

Query: 154 EKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPP 315
              P  KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP
Sbjct: 112 ---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPP 167

Query: 316 VYKPPVEKPPVYKPP 360
              PPV KPP   PP
Sbjct: 168 TTTPPV-KPPTTTPP 181

 Score =  112 bits (281), Expect = 1e-23
 Identities = 66/135 (48%), Positives = 73/135 (54%), Gaps = 18/135 (13%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPV----YKPPVEKPPVYKPPVEKP------PVYKPPVEKPPVYKPPVE 156
           KPP  KPPV+ P +     KPPV  PP+  PPV+ P      P  KPP  +PP YKPP  
Sbjct: 70  KPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTP 129

Query: 157 --KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPV 318
             KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV KPP   PPV+ PP 
Sbjct: 130 TVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPT 186

Query: 319 YKPPVE--KPPVYKP 357
           Y PP    KPP   P
Sbjct: 187 YNPPTTPVKPPTAPP 201

 Score =  108 bits (271), Expect = 1e-22
 Identities = 61/120 (50%), Positives = 66/120 (55%), Gaps = 4/120 (3%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P  KPP    P YKPP       KPP  KPPV  P +   PV KPPV  PP+  PPV+ P
Sbjct: 50  PALKPPT---PSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPVQ-P 104

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPP 360
           P YKPP    P  KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP
Sbjct: 105 PTYKPPT---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPP 160

 Score =  108 bits (269), Expect = 2e-22
 Identities = 67/127 (52%), Positives = 73/127 (57%), Gaps = 10/127 (7%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPV 168
           KPPV  PP++ PPV +PP  KPP    KPP  +PP YKPP    KPP   P  P   PPV
Sbjct: 89  KPPVSTPPIKLPPV-QPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPV 147

Query: 169 YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVE 336
             PPV+ PP YKPP    KPP   PPV KPP   PPV+ PP Y PP    KPP   PPV 
Sbjct: 148 QSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPV- 202

Query: 337 KPPVYKP 357
           KPP   P
Sbjct: 203 KPPTPPP 209

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 62/117 (52%), Positives = 66/117 (56%), Gaps = 8/117 (6%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYK 174
           +PP YKPP    P  KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YK
Sbjct: 103 QPPTYKPPT---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYK 158

Query: 175 PPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPV 333
           PP    KPP   PPV KPP   PPV+ PP Y PP    KPP   PPV KPP   PPV
Sbjct: 159 PPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPV-KPPT-PPPV 210

[91][TOP]
>UniRef100_A3VGH7 Putative uncharacterized protein n=1 Tax=Rhodobacterales bacterium
            HTCC2654 RepID=A3VGH7_9RHOB
          Length = 7434

 Score =  112 bits (281), Expect = 1e-23
 Identities = 71/117 (60%), Positives = 71/117 (60%)
 Frame = -2

Query: 359  GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  T
Sbjct: 7191 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7250

Query: 179  GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7251 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7307

 Score =  112 bits (281), Expect = 1e-23
 Identities = 71/117 (60%), Positives = 71/117 (60%)
 Frame = -2

Query: 359  GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  T
Sbjct: 7196 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7255

Query: 179  GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7256 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7312

 Score =  112 bits (281), Expect = 1e-23
 Identities = 71/117 (60%), Positives = 71/117 (60%)
 Frame = -2

Query: 359  GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  T
Sbjct: 7201 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7260

Query: 179  GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7261 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7317

 Score =  112 bits (281), Expect = 1e-23
 Identities = 71/117 (60%), Positives = 71/117 (60%)
 Frame = -2

Query: 359  GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  T
Sbjct: 7206 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7265

Query: 179  GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7266 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7322

 Score =  112 bits (281), Expect = 1e-23
 Identities = 71/117 (60%), Positives = 71/117 (60%)
 Frame = -2

Query: 359  GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  T
Sbjct: 7211 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7270

Query: 179  GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7271 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7327

 Score =  112 bits (281), Expect = 1e-23
 Identities = 71/117 (60%), Positives = 71/117 (60%)
 Frame = -2

Query: 359  GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  T
Sbjct: 7216 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7275

Query: 179  GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7276 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7332

 Score =  112 bits (281), Expect = 1e-23
 Identities = 71/117 (60%), Positives = 71/117 (60%)
 Frame = -2

Query: 359  GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  T
Sbjct: 7221 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7280

Query: 179  GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7281 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7337

 Score =  112 bits (281), Expect = 1e-23
 Identities = 71/117 (60%), Positives = 71/117 (60%)
 Frame = -2

Query: 359  GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  T
Sbjct: 7226 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7285

Query: 179  GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7286 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7342

 Score =  111 bits (277), Expect = 3e-23
 Identities = 69/113 (61%), Positives = 69/113 (61%)
 Frame = -2

Query: 347  TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
            TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  
Sbjct: 7190 TGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGD 7249

Query: 167  TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
            TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7250 TGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7302

 Score =  107 bits (266), Expect = 5e-22
 Identities = 67/111 (60%), Positives = 67/111 (60%)
 Frame = -2

Query: 341  GFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLYTG 162
            G  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TG
Sbjct: 7187 GGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTG 7246

Query: 161  GFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
            G  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7247 GGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7297

 Score =  104 bits (259), Expect = 4e-21
 Identities = 66/110 (60%), Positives = 66/110 (60%)
 Frame = -2

Query: 359  GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  T
Sbjct: 7236 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7295

Query: 179  GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFST 30
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  T
Sbjct: 7296 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGRDT 7345

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 63/110 (57%), Positives = 64/110 (58%)
 Frame = -2

Query: 338  FSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLYTGG 159
            F+  G    G  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7178 FNVFGPDGDGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7237

Query: 158  FSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGG 9
              TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7238 GDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7287

[92][TOP]
>UniRef100_A9WG95 Helicase n=2 Tax=Chloroflexus RepID=A9WG95_CHLAA
          Length = 1007

 Score =  112 bits (279), Expect = 2e-23
 Identities = 57/128 (44%), Positives = 83/128 (64%), Gaps = 8/128 (6%)
 Frame = +1

Query: 1    QEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPV-EKPPVYKPPVEKPPV--YKPPVEKPPV 168
            + +PP  +PP   +PP  +PPV +PPV +PPV  +PPV +PP  +PP    +PPV +PP 
Sbjct: 704  EPEPPAREPPARSEPPAREPPVREPPVREPPVRSEPPVREPPAREPPARSAEPPVREPPA 763

Query: 169  YKPPV-EKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPV-YKPPVE 336
             +P V  +PPV +PPV +PP   +PP  +P +  +PP  +PPV +PPV +PPV  +P V 
Sbjct: 764  REPSVRSEPPVREPPVREPPARSEPPAREPSIRSEPPAREPPVREPPVREPPVRSEPSVR 823

Query: 337  KPPVYKPP 360
            +PP  +PP
Sbjct: 824  EPPAREPP 831

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 53/125 (42%), Positives = 74/125 (59%), Gaps = 17/125 (13%)
 Frame = +1

Query: 37   KPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPV-EKPPVYKPPVEKPPV--YK 204
            +PPV +P   +PP  +PP   +PP  +PPV +PPV +PPV  +PPV +PP  +PP    +
Sbjct: 699  EPPVREP---EPPAREPPARSEPPAREPPVREPPVREPPVRSEPPVREPPAREPPARSAE 755

Query: 205  PPVEKPPVYKPPV-EKPPVYKPPVEKPPV------------YKPPVEKPPVYKPPVEKPP 345
            PPV +PP  +P V  +PPV +PPV +PP              +PP  +PPV +PPV +PP
Sbjct: 756  PPVREPPAREPSVRSEPPVREPPVREPPARSEPPAREPSIRSEPPAREPPVREPPVREPP 815

Query: 346  VYKPP 360
            V   P
Sbjct: 816  VRSEP 820

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 53/157 (33%), Positives = 74/157 (47%), Gaps = 39/157 (24%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVY-KPPVEKPPVYKPPVE------------KPPVYKPPVEKPPVYKP 147
            +PPV +PP  +P V  +PPV +PPV +PP              +PP  +PPV +PPV +P
Sbjct: 755  EPPVREPPAREPSVRSEPPVREPPVREPPARSEPPAREPSIRSEPPAREPPVREPPVREP 814

Query: 148  PVE-KPPVYKPPVEKPPVY--KPPVEKPPVYKPPV-EKPPVYKPPV-------------- 273
            PV  +P V +PP  +PP    +PPV +PP  +P V  +PP  +PPV              
Sbjct: 815  PVRSEPSVREPPAREPPARSAEPPVREPPAREPSVRSEPPAREPPVRSERSADAQRGRYN 874

Query: 274  --------EKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
                     + P    P E P V +PP +  P    P
Sbjct: 875  RPGGRHSGRRVPDQPEPPEAPAVPEPPTDDSPAASVP 911

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 46/108 (42%), Positives = 64/108 (59%), Gaps = 5/108 (4%)
 Frame = +1

Query: 52  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPV-EKPP 225
           + P E  P   P   +PPV +P   +PP  +PP   +PP  +PPV +PPV +PPV  +PP
Sbjct: 687 RTPGENRPARTP---EPPVREP---EPPAREPPARSEPPAREPPVREPPVREPPVRSEPP 740

Query: 226 VYKPPVEKPPV--YKPPVEKPPVYKPPV-EKPPVYKPPVEKPPVYKPP 360
           V +PP  +PP    +PPV +PP  +P V  +PPV +PPV +PP    P
Sbjct: 741 VREPPAREPPARSAEPPVREPPAREPSVRSEPPVREPPVREPPARSEP 788

[93][TOP]
>UniRef100_Q8LBI7 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8LBI7_ARATH
          Length = 275

 Score =  112 bits (279), Expect = 2e-23
 Identities = 68/136 (50%), Positives = 75/136 (55%), Gaps = 19/136 (13%)
 Frame = +1

Query: 7   KPPVYKPPVE---------KPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPV 153
           KPP  KPPV+         KPPV  PP++ PPV +PP  KPP    KPP  +PP YKPP 
Sbjct: 70  KPPTTKPPVKPPTTSVTPVKPPVSTPPIKLPPV-QPPTYKPPTPTVKPPSVQPPTYKPPT 128

Query: 154 E--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPP 315
              KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV KPP   PPV+ PP
Sbjct: 129 PTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PP 185

Query: 316 VYKPPVE--KPPVYKP 357
            Y PP    KPP   P
Sbjct: 186 TYNPPTTPVKPPTAPP 201

 Score =  111 bits (278), Expect = 2e-23
 Identities = 66/129 (51%), Positives = 70/129 (54%), Gaps = 11/129 (8%)
 Frame = +1

Query: 7   KPPVY-----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 171
           KPP       KPP  KPPV KPP       KPPV  PP+  PPV+ PP YKPP    P  
Sbjct: 60  KPPTLPTTPIKPPTTKPPV-KPPTTSVTPVKPPVSTPPIKLPPVQ-PPTYKPPT---PTV 114

Query: 172 KPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPV 333
           KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV
Sbjct: 115 KPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV 173

Query: 334 EKPPVYKPP 360
            KPP   PP
Sbjct: 174 -KPPTTTPP 181

 Score =  108 bits (270), Expect = 2e-22
 Identities = 61/120 (50%), Positives = 65/120 (54%), Gaps = 4/120 (3%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P  KPP    P YKPP       KPP  KPPV KPP       KPPV  PP+  PPV+ P
Sbjct: 50  PALKPPT---PSYKPPTLPTTPIKPPTTKPPV-KPPTTSVTPVKPPVSTPPIKLPPVQ-P 104

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPP 360
           P YKPP    P  KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP
Sbjct: 105 PTYKPPT---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPP 160

 Score =  108 bits (269), Expect = 2e-22
 Identities = 67/127 (52%), Positives = 73/127 (57%), Gaps = 10/127 (7%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPV 168
           KPPV  PP++ PPV +PP  KPP    KPP  +PP YKPP    KPP   P  P   PPV
Sbjct: 89  KPPVSTPPIKLPPV-QPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPV 147

Query: 169 YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVE 336
             PPV+ PP YKPP    KPP   PPV KPP   PPV+ PP Y PP    KPP   PPV 
Sbjct: 148 QSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPV- 202

Query: 337 KPPVYKP 357
           KPP   P
Sbjct: 203 KPPTPPP 209

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 62/117 (52%), Positives = 66/117 (56%), Gaps = 8/117 (6%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYK 174
           +PP YKPP    P  KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YK
Sbjct: 103 QPPTYKPPT---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYK 158

Query: 175 PPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPV 333
           PP    KPP   PPV KPP   PPV+ PP Y PP    KPP   PPV KPP   PPV
Sbjct: 159 PPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPV-KPPT-PPPV 210

[94][TOP]
>UniRef100_Q9M4I1 Putative proline-rich cell wall protein n=1 Tax=Vitis vinifera
           RepID=Q9M4I1_VITVI
          Length = 217

 Score =  111 bits (278), Expect = 2e-23
 Identities = 81/143 (56%), Positives = 88/143 (61%), Gaps = 23/143 (16%)
 Frame = +1

Query: 1   QEKPP--VYK-PPVEKPPV-YKPPVEKPPVYKP-PVEKP--PVYK-PPVEK-PPVYKPPV 153
           + KPP  VYK PP+ KPP  YKPP    PVYKP PVEKP  PVY+ PPVEK PP YKPP 
Sbjct: 31  EHKPPLPVYKSPPLGKPPPEYKPPT---PVYKPPPVEKPPTPVYRPPPVEKPPPEYKPPT 87

Query: 154 EKPPVYK-PPVEK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPV----EKPPVYKPP--- 300
              PVYK PPVEK PP YKPP    PVY+ PPVEK PP YKPP       PP +K P   
Sbjct: 88  ---PVYKSPPVEKPPPEYKPPT---PVYRPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLP 141

Query: 301 ---VEKPPVYKPPVEKPPVYKPP 360
              V  PP  KPP   P + +PP
Sbjct: 142 PRVVRPPPTPKPPTLPPIIVRPP 164

 Score =  107 bits (268), Expect = 3e-22
 Identities = 80/136 (58%), Positives = 86/136 (63%), Gaps = 18/136 (13%)
 Frame = +1

Query: 7   KPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-KP--PVYK-PPVEKP--PVYK-PPVEK 159
           KPP Y  KPP+   PVYK     PP+ KPP E KP  PVYK PPVEKP  PVY+ PPVEK
Sbjct: 26  KPPPYEHKPPL---PVYK----SPPLGKPPPEYKPPTPVYKPPPVEKPPTPVYRPPPVEK 78

Query: 160 -PPVYKPPVEKPPVYK-PPVEK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPV----EKP 312
            PP YKPP    PVYK PPVEK PP YKPP    PVY+ PPVEK PP YKPP       P
Sbjct: 79  PPPEYKPPT---PVYKSPPVEKPPPEYKPPT---PVYRPPPVEKPPPEYKPPTPVKPPPP 132

Query: 313 PVYKPPVEKPPVYKPP 360
           P +K P   P V +PP
Sbjct: 133 PKHKTPTLPPRVVRPP 148

 Score =  102 bits (253), Expect = 2e-20
 Identities = 69/127 (54%), Positives = 75/127 (59%), Gaps = 11/127 (8%)
 Frame = +1

Query: 13  PVYKPP-VEKPP--VYKPP-VEKPPV-YKPPV---EKPPVYKPPVEKPPVYKPPVEKPPV 168
           PVYKPP VEKPP  VY+PP VEKPP  YKPP    + PPV KP    PP YKPP    PV
Sbjct: 56  PVYKPPPVEKPPTPVYRPPPVEKPPPEYKPPTPVYKSPPVEKP----PPEYKPPT---PV 108

Query: 169 YK-PPVEK-PPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           Y+ PPVEK PP YKPP   KPP   PP  K P   P V +P    PP  KPP   P + +
Sbjct: 109 YRPPPVEKPPPEYKPPTPVKPP--PPPKHKTPTLPPRVVRP----PPTPKPPTLPPIIVR 162

Query: 340 PPVYKPP 360
           PP  K P
Sbjct: 163 PPPTKEP 169

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 70/143 (48%), Positives = 76/143 (53%), Gaps = 24/143 (16%)
 Frame = +1

Query: 4   EKPP--VYKPP-VEKPPV-YKPPV---EKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEK 159
           EKPP  VY+PP VEKPP  YKPP    + PPV KP    PP YKPP    PVY+ PPVEK
Sbjct: 64  EKPPTPVYRPPPVEKPPPEYKPPTPVYKSPPVEKP----PPEYKPPT---PVYRPPPVEK 116

Query: 160 -PPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--- 324
            PP YKPP   KPP   PP  K P   P V +P    PP  KPP   P + +PP  K   
Sbjct: 117 PPPEYKPPTPVKPP--PPPKHKTPTLPPRVVRP----PPTPKPPTLPPIIVRPPPTKEPS 170

Query: 325 ---------PPVEKPP--VYKPP 360
                    PPVE PP   YK P
Sbjct: 171 PPHGHYPGHPPVETPPSTPYKKP 193

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 47/119 (39%), Positives = 59/119 (49%), Gaps = 2/119 (1%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           ++ PP YKPP    PV  PP   PP +K P   P V +P    PP  KPP   P + +PP
Sbjct: 115 EKPPPEYKPPT---PVKPPP---PPKHKTPTLPPRVVRP----PPTPKPPTLPPIIVRPP 164

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP--PVYKPPVEKPPVY 351
             K P   PP    P + PPVE PP    P +KPP    P +KP  P +K     PP++
Sbjct: 165 PTKEP--SPPHGHYPGH-PPVETPP--STPYKKPPT---PEKKPWAPHHKHFKAPPPIH 215

[95][TOP]
>UniRef100_UPI0001AEEAC9 secreted protein n=1 Tax=Streptomyces albus J1074
           RepID=UPI0001AEEAC9
          Length = 255

 Score =  111 bits (277), Expect = 3e-23
 Identities = 44/86 (51%), Positives = 60/86 (69%)
 Frame = +1

Query: 22  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 201
           KPP  KPP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 202 KPPVEKPPVYKPPVEKPPVYKPPVEK 279
           +PP E+PP  +PP E+PP  +PP E+
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPPTER 214

 Score =  111 bits (277), Expect = 3e-23
 Identities = 44/86 (51%), Positives = 60/86 (69%)
 Frame = +1

Query: 52  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 231
           KPP  KPP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 232 KPPVEKPPVYKPPVEKPPVYKPPVEK 309
           +PP E+PP  +PP E+PP  +PP E+
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPPTER 214

 Score =  111 bits (277), Expect = 3e-23
 Identities = 44/86 (51%), Positives = 60/86 (69%)
 Frame = +1

Query: 82  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 261
           KPP  KPP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 262 KPPVEKPPVYKPPVEKPPVYKPPVEK 339
           +PP E+PP  +PP E+PP  +PP E+
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPPTER 214

 Score =  111 bits (277), Expect = 3e-23
 Identities = 44/83 (53%), Positives = 59/83 (71%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  KPP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 187 KPPVYKPPVEKPPVYKPPVEKPP 255
           +PP  +PP E+PP  +PP E+PP
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPP 211

 Score =  111 bits (277), Expect = 3e-23
 Identities = 44/83 (53%), Positives = 59/83 (71%)
 Frame = +1

Query: 37  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 216
           KPP  KPP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 217 KPPVYKPPVEKPPVYKPPVEKPP 285
           +PP  +PP E+PP  +PP E+PP
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPP 211

 Score =  111 bits (277), Expect = 3e-23
 Identities = 44/83 (53%), Positives = 59/83 (71%)
 Frame = +1

Query: 67  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 246
           KPP  KPP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 247 KPPVYKPPVEKPPVYKPPVEKPP 315
           +PP  +PP E+PP  +PP E+PP
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPP 211

 Score =  111 bits (277), Expect = 3e-23
 Identities = 44/83 (53%), Positives = 59/83 (71%)
 Frame = +1

Query: 97  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 276
           KPP  KPP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 277 KPPVYKPPVEKPPVYKPPVEKPP 345
           +PP  +PP E+PP  +PP E+PP
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPP 211

 Score =  108 bits (270), Expect = 2e-22
 Identities = 43/83 (51%), Positives = 58/83 (69%)
 Frame = +1

Query: 112 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 291
           KPP  KPP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 292 KPPVEKPPVYKPPVEKPPVYKPP 360
           +PP E+PP  +PP E+PP  +PP
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPP 211

 Score =  108 bits (270), Expect = 2e-22
 Identities = 41/81 (50%), Positives = 57/81 (70%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E
Sbjct: 134 KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTEQPPTE 193

Query: 187 KPPVYKPPVEKPPVYKPPVEK 249
           +PP  +PP E+PP  +PP E+
Sbjct: 194 EPPTEEPPTEQPPAEQPPTER 214

 Score =  101 bits (251), Expect = 3e-20
 Identities = 38/74 (51%), Positives = 53/74 (71%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP 
Sbjct: 138 EEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTEQPPTEEPPT 197

Query: 184 EKPPVYKPPVEKPP 225
           E+PP  +PP E+PP
Sbjct: 198 EEPPTEQPPAEQPP 211

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 36/72 (50%), Positives = 51/72 (70%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP 
Sbjct: 143 EQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTEQPPTEEPPTEEPPT 202

Query: 184 EKPPVYKPPVEK 219
           E+PP  +PP E+
Sbjct: 203 EQPPAEQPPTER 214

[96][TOP]
>UniRef100_Q39864 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39864_SOYBN
          Length = 199

 Score =  111 bits (277), Expect = 3e-23
 Identities = 71/142 (50%), Positives = 72/142 (50%), Gaps = 27/142 (19%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKP 162
           PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P   P
Sbjct: 22  PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPP 81

Query: 163 PVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPV 288
           PVYK     PPV K    PP YK P   PP YK P   PPVYK     PPV K    PP 
Sbjct: 82  PVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 141

Query: 289 YKPPVEKPPVYKPPVEKPPVYK 354
           +K P   PP YK P   PPVYK
Sbjct: 142 HKYPSPPPPPYKYPSPPPPVYK 163

 Score =  108 bits (270), Expect = 2e-22
 Identities = 67/133 (50%), Positives = 68/133 (51%), Gaps = 18/133 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKP 162
           PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P   P
Sbjct: 61  PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPP 120

Query: 163 PVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
           PVYK     PPV K    PP +K P   PP YK P   PPVYK     PP YK P   PP
Sbjct: 121 PVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYKYK-SPPPPYKYPSPPPP 179

Query: 316 VYKPPVEKPPVYK 354
            YK P   PPVYK
Sbjct: 180 PYKYPSPPPPVYK 192

 Score =  106 bits (264), Expect = 9e-22
 Identities = 64/124 (51%), Positives = 64/124 (51%), Gaps = 9/124 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYK     PP YK P   PP YK P   PPVYK     PPVYK     PP YK P   
Sbjct: 13  PPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK-SPPPPYKYPSPP 70

Query: 190 PPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
           PP YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     P
Sbjct: 71  PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 130

Query: 343 PVYK 354
           PVYK
Sbjct: 131 PVYK 134

 Score =  102 bits (254), Expect = 1e-20
 Identities = 62/121 (51%), Positives = 62/121 (51%), Gaps = 9/121 (7%)
 Frame = +1

Query: 19  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 198
           YK P   PPVYK     PP YK P   PP YK P   PPVYK     PPVYK     PP 
Sbjct: 6   YKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK-SPPPP 63

Query: 199 YKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVY 351
           YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVY
Sbjct: 64  YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVY 123

Query: 352 K 354
           K
Sbjct: 124 K 124

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 60/121 (49%), Positives = 61/121 (50%), Gaps = 9/121 (7%)
 Frame = +1

Query: 10  PPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 162
           PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PPVYK     P
Sbjct: 81  PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYK-SPP 139

Query: 163 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
           P +K P   PP YK P   PPVYK     PP YK P   PP YK P   PPVYK     P
Sbjct: 140 PPHKYPSPPPPPYKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 198

Query: 343 P 345
           P
Sbjct: 199 P 199

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 60/120 (50%), Positives = 61/120 (50%), Gaps = 9/120 (7%)
 Frame = +1

Query: 28  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 207
           P +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK     PPVYK 
Sbjct: 1   PPKKP--YKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 57

Query: 208 PVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPP 360
               PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P
Sbjct: 58  K-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYP 116

[97][TOP]
>UniRef100_O81765 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=O81765_ARATH
          Length = 699

 Score =  111 bits (277), Expect = 3e-23
 Identities = 63/122 (51%), Positives = 70/122 (57%), Gaps = 6/122 (4%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV  PP   PPVY PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   P
Sbjct: 522 PVNSPP---PPVYSPPPPPPPVHSPP---PPVHSPP--PPPVYSPPPPPPPVHSPP---P 570

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP------VEKPPVYKPPVEKPPVYK 354
           PV+ PP   PPVY PP   PPV+ PP   PPV+ PP         PPV+ PP   PPVY 
Sbjct: 571 PVFSPP---PPVYSPP---PPVHSPP---PPVHSPPPPAPVHSPPPPVHSPP-PPPPVYS 620

Query: 355 PP 360
           PP
Sbjct: 621 PP 622

 Score =  103 bits (257), Expect = 6e-21
 Identities = 65/144 (45%), Positives = 74/144 (51%), Gaps = 25/144 (17%)
 Frame = +1

Query: 4   EKPPVYKPPVEKP-PVYKPPVEKP-----------PVYKPPVEK-------------PPV 108
           E  PV   PV+KP PV   PV+KP           P  + PV K             PPV
Sbjct: 471 EPSPVLATPVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPV 530

Query: 109 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 288
           Y PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV
Sbjct: 531 YSPPPPPPPVHSPP---PPVHSPP--PPPVYSPPPPPPPVHSPP---PPVFSPP---PPV 579

Query: 289 YKPPVEKPPVYKPPVEKPPVYKPP 360
           Y PP   PPV+ PP   PPV+ PP
Sbjct: 580 YSPP---PPVHSPP---PPVHSPP 597

 Score =  102 bits (255), Expect = 1e-20
 Identities = 61/126 (48%), Positives = 70/126 (55%), Gaps = 7/126 (5%)
 Frame = +1

Query: 4   EKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           ++ PV K     P PV  PP   PPVY PP   PPV+ PP   PPV+ PP   PPVY PP
Sbjct: 508 DQSPVTKRRSPPPAPVNSPP---PPVYSPPPPPPPVHSPP---PPVHSPP--PPPVYSPP 559

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP------VEKP 342
              PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP         P
Sbjct: 560 PPPPPVHSPP---PPVFSPP---PPVYSPP---PPVHSPP---PPVHSPPPPAPVHSPPP 607

Query: 343 PVYKPP 360
           PV+ PP
Sbjct: 608 PVHSPP 613

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 56/122 (45%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVY PP   PPV+ PP   PPV+ PP    PV+ PP   PPV+ PP   PPVY PP   
Sbjct: 577 PPVYSPP---PPVHSPP---PPVHSPP-PPAPVHSPP---PPVHSPP-PPPPVYSPP--- 622

Query: 190 PPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEK---PPVYKPPVEKPPVYK 354
           PPV+ PP  + P  VY PP   P +  PPV+ PP    PVEK   PP + P         
Sbjct: 623 PPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPP--PAPVEKKETPPAHAPAPSDDEFII 680

Query: 355 PP 360
           PP
Sbjct: 681 PP 682

[98][TOP]
>UniRef100_B9S3J8 Repetitive proline-rich cell wall protein 2, putative n=1
           Tax=Ricinus communis RepID=B9S3J8_RICCO
          Length = 299

 Score =  111 bits (277), Expect = 3e-23
 Identities = 68/137 (49%), Positives = 79/137 (57%), Gaps = 19/137 (13%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPP------VEKPPVYKPP-VEKPPVYKPP-VEKPPVYKPP--VE 156
           KPP +  P ++PP  KPP      V KPP+ KPP + KPP+ +PP + KPPV  PP  V 
Sbjct: 54  KPPFHPKPPKQPPHVKPPHPKPPHVPKPPIVKPPTIPKPPIVRPPYIPKPPVVNPPPFVP 113

Query: 157 KPPVYKPP--VEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 324
           KPPV  PP  V KPPV  PP  V KPP+  PP   PPV  PP   P + KPPV  PP+ K
Sbjct: 114 KPPVVNPPPFVPKPPVVNPPPFVPKPPIVYPP--NPPV-TPPSSPPYIPKPPVVTPPI-K 169

Query: 325 PPV-----EKPPVYKPP 360
           PP       KPPV  PP
Sbjct: 170 PPTPPTLPPKPPVITPP 186

 Score =  109 bits (273), Expect = 8e-23
 Identities = 67/134 (50%), Positives = 78/134 (58%), Gaps = 17/134 (12%)
 Frame = +1

Query: 10  PPVYKP---PVEKPPVYKPPVEKPPVYKPP------VEKPPVYKPP-VEKPPVYKPP-VE 156
           PP Y P   P  KPP +  P ++PP  KPP      V KPP+ KPP + KPP+ +PP + 
Sbjct: 42  PPKYPPRHPPKVKPPFHPKPPKQPPHVKPPHPKPPHVPKPPIVKPPTIPKPPIVRPPYIP 101

Query: 157 KPPVYKPP--VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPV 318
           KPPV  PP  V KPPV  PP  V KPPV  PP  V KPP+  PP   PPV  PP   P +
Sbjct: 102 KPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFVPKPPIVYPP--NPPV-TPPSSPPYI 158

Query: 319 YKPPVEKPPVYKPP 360
            KPPV  PP+ KPP
Sbjct: 159 PKPPVVTPPI-KPP 171

 Score =  107 bits (267), Expect = 4e-22
 Identities = 65/139 (46%), Positives = 75/139 (53%), Gaps = 23/139 (16%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKP---PVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYKPP 180
           P  KPP   PP Y P   P  KPP +  P ++PP  KPP  KPP V KPP+ KPP     
Sbjct: 33  PPSKPPPGHPPKYPPRHPPKVKPPFHPKPPKQPPHVKPPHPKPPHVPKPPIVKPPT---- 88

Query: 181 VEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP--- 330
           + KPP+ +PP + KPPV  PP  V KPPV  PP  V KPPV  PP  V KPP+  PP   
Sbjct: 89  IPKPPIVRPPYIPKPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFVPKPPIVYPPNPP 148

Query: 331 ---------VEKPPVYKPP 360
                    + KPPV  PP
Sbjct: 149 VTPPSSPPYIPKPPVVTPP 167

 Score =  106 bits (264), Expect = 9e-22
 Identities = 70/144 (48%), Positives = 79/144 (54%), Gaps = 26/144 (18%)
 Frame = +1

Query: 7   KPPVYKPP-VEKPPVYKPP-VEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPP--VEKPP 165
           KPP  KPP V KPP+ KPP + KPP+ +PP + KPPV  PP  V KPPV  PP  V KPP
Sbjct: 69  KPPHPKPPHVPKPPIVKPPTIPKPPIVRPPYIPKPPVVNPPPFVPKPPVVNPPPFVPKPP 128

Query: 166 VYKPP--VEKPPVYKPP------------VEKPPVYKPPVEKPPVY-----KPPVEKPPV 288
           V  PP  V KPP+  PP            + KPPV  PP+ KPP       KPPV  PP 
Sbjct: 129 VVNPPPFVPKPPIVYPPNPPVTPPSSPPYIPKPPVVTPPI-KPPTPPTLPPKPPVITPPT 187

Query: 289 YKPPVEKPPVYKPPVEKPPVYKPP 360
            KPP  + P   PP   PPV  PP
Sbjct: 188 -KPPTPETPC--PPPPPPPVPCPP 208

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 60/131 (45%), Positives = 70/131 (53%), Gaps = 20/131 (15%)
 Frame = +1

Query: 7   KPPVYKPP-VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP----- 150
           KPP+ +PP + KPPV  PP  V KPPV  PP  V KPPV  PP  V KPP+  PP     
Sbjct: 91  KPPIVRPPYIPKPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFVPKPPIVYPPNPPVT 150

Query: 151 -------VEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 306
                  + KPPV  PP++ P P   PP  KPPV  PP  KPP  + P   PP   PPV 
Sbjct: 151 PPSSPPYIPKPPVVTPPIKPPTPPTLPP--KPPVITPPT-KPPTPETPCPPPP--PPPVP 205

Query: 307 KPPVYKPPVEK 339
            PP   PP ++
Sbjct: 206 CPP--PPPKQE 214

[99][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score =  111 bits (277), Expect = 3e-23
 Identities = 63/117 (53%), Positives = 63/117 (53%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP    PV  PPVY PP    PVY PP   PPVY PP   PP   PP   PPVY PP   
Sbjct: 237 PPSPPMPVPSPPVYLPP----PVYSPP-PPPPVYSPP---PP---PPSPPPPVYSPPPPP 285

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPVY PP   PPVY PP   PP   PP   PPVY PP   PP   PP   PPVY PP
Sbjct: 286 PPVYSPP-PPPPVYSPP---PPPPSPPPPPPPVYSPP--PPPSPPPPSPPPPVYSPP 336

 Score =  111 bits (277), Expect = 3e-23
 Identities = 62/121 (51%), Positives = 63/121 (52%), Gaps = 4/121 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           PPVY PP   PPVY PP   P    PVY PP   PPVY PP   PPVY PP   PP   P
Sbjct: 253 PPVYSPP-PPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPP-PPPPVYSPP---PPPPSP 307

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P   PPVY PP   PP   PP   PPVY PP   PP   PP   PP   PP  +PP   P
Sbjct: 308 PPPPPPVYSPP--PPPSPPPPSPPPPVYSPP-PPPPSPPPPSPPPPSPLPPCVRPPPPPP 364

Query: 358 P 360
           P
Sbjct: 365 P 365

 Score =  109 bits (272), Expect = 1e-22
 Identities = 63/125 (50%), Positives = 64/125 (51%), Gaps = 8/125 (6%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           PPVY PP    PVY PP   PPVY     PP   PPVY PP   PPVY PP   PPVY P
Sbjct: 247 PPVYLPP----PVYSPP-PPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPP-PPPPVYSP 300

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----PPVEKPPVYKPPVEKPP 345
           P   PP   PP   PPVY PP   PP   PP   PPVY     PP   PP   PP   PP
Sbjct: 301 P---PPPPSPPPPPPPVYSPP--PPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPP 355

Query: 346 VYKPP 360
             +PP
Sbjct: 356 CVRPP 360

 Score =  107 bits (268), Expect = 3e-22
 Identities = 60/125 (48%), Positives = 63/125 (50%), Gaps = 8/125 (6%)
 Frame = +1

Query: 10  PPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           PPVY PP   P    PVY PP   PPVY PP   PPVY PP   PP   PP   PPVY P
Sbjct: 262 PPVYSPPPPPPSPPPPVYSPPPPPPPVYSPP-PPPPVYSPP---PPPPSPPPPPPPVYSP 317

Query: 178 PVEKPPVYKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           P   PP   PP   PPVY     PP   PP   PP   PP  +PP   PP   PP   PP
Sbjct: 318 P--PPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPP--PPP 373

Query: 346 VYKPP 360
           ++ PP
Sbjct: 374 LFSPP 378

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 53/102 (51%), Positives = 53/102 (51%), Gaps = 4/102 (3%)
 Frame = +1

Query: 67  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----PPVEKPPVYK 234
           KP V   P   PP    PV  PPVY PP    PVY PP   PPVY     PP   PPVY 
Sbjct: 226 KPFVPTLPAPPPPSPPMPVPSPPVYLPP----PVYSPP-PPPPVYSPPPPPPSPPPPVYS 280

Query: 235 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP   PPVY PP   PPVY PP   PP   PP   PPVY PP
Sbjct: 281 PPPPPPPVYSPP-PPPPVYSPP---PPPPSPPPPPPPVYSPP 318

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/129 (40%), Positives = 57/129 (44%), Gaps = 12/129 (9%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKP------PVEK--PPVYK----PPVEKPPVYKPPV 153
           PPVY PP   PP   PP   PPVY P      P     PPVY     PP   PP   PP 
Sbjct: 295 PPVYSPP---PPPPSPPPPPPPVYSPPPPPSPPPPSPPPPVYSPPPPPPSPPPPSPPPPS 351

Query: 154 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 333
             PP  +PP   PP   PP   PP++ PP   P  Y  P    P + PP   PP + PP 
Sbjct: 352 PLPPCVRPPPPPPPNSPPP--PPPLFSPPPPTPYYYSSPPPPSPPHSPP---PPPHSPPP 406

Query: 334 EKPPVYKPP 360
             PP   PP
Sbjct: 407 PSPPHSPPP 415

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 52/127 (40%), Positives = 58/127 (45%), Gaps = 10/127 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           PPVY PP   P    P   PP   PP  +PP   PP   PP   PP++ PP   P  Y  
Sbjct: 330 PPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPP--PPPLFSPPPPTPYYYSS 387

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKP-PVY---KPPVEKPPVYKPPVEK 339
           P    P + PP   PP + PP   PP   PP     P P+Y    PP    PVY PP   
Sbjct: 388 PPPPSPPHSPP---PPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPP--P 442

Query: 340 PPVYKPP 360
           PPVY PP
Sbjct: 443 PPVYSPP 449

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 51/123 (41%), Positives = 55/123 (44%), Gaps = 6/123 (4%)
 Frame = +1

Query: 10  PPVYKP-----PVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 171
           PPVY P          PP   PP   PPVY PP   PP   PP   PPVY PP   PP  
Sbjct: 286 PPVYSPPPPPPVYSPPPPPPSPPPPPPPVYSPP--PPPSPPPPSPPPPVYSPP---PPPP 340

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
            PP   PP   PP   PP  +PP   PP   PP   PP++ PP   P  Y  P    P +
Sbjct: 341 SPPPPSPP---PPSPLPPCVRPPPPPPPNSPPP--PPPLFSPPPPTPYYYSSPPPPSPPH 395

Query: 352 KPP 360
            PP
Sbjct: 396 SPP 398

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 48/123 (39%), Positives = 55/123 (44%), Gaps = 6/123 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP    P   PP++ PP   P  Y  P    P + PP   PP + PP   PP + PP   
Sbjct: 362 PPPPNSPPPPPPLFSPPPPTPYYYSSPPPPSPPHSPP---PPPHSPPPPSPP-HSPP--- 414

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP------VY 351
           PP + PP    P   PP    PVY PP   PPVY PP   PP   PP  +PP       Y
Sbjct: 415 PPPHSPPPPIYPYLSPPPPPHPVYSPP--PPPVYSPP---PPPSPPPCIEPPPPPPCAEY 469

Query: 352 KPP 360
            PP
Sbjct: 470 SPP 472

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/124 (40%), Positives = 56/124 (45%), Gaps = 7/124 (5%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKP-PVY--- 171
           PP++ PP   P  Y  P    P + PP   PP + PP   PP   PP     P P+Y   
Sbjct: 372 PPLFSPPPPTPYYYSSPPPPSPPHSPP---PPPHSPPPPSPPHSPPPPPHSPPPPIYPYL 428

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPV 348
            PP    PVY PP   PPVY PP   PP   PP  +PP   P  E  PP   P    P  
Sbjct: 429 SPPPPPHPVYSPP--PPPVYSPP---PPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQ 483

Query: 349 YKPP 360
           YKPP
Sbjct: 484 YKPP 487

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 52/124 (41%), Positives = 56/124 (45%), Gaps = 7/124 (5%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP + PP   PP + PP   PP + PP    P   PP    PVY PP   PPVY PP   
Sbjct: 399 PPPHSPPPPSPP-HSPP---PPPHSPPPPIYPYLSPPPPPHPVYSPP--PPPVYSPP--- 449

Query: 190 PPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVE----KPPV--YKPPVEKPPV 348
           PP   PP  +PP   P  E  PP   P    P  YKPP       PPV  Y PP   PP 
Sbjct: 450 PPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPP---PPS 506

Query: 349 YKPP 360
             PP
Sbjct: 507 QSPP 510

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 51/124 (41%), Positives = 55/124 (44%), Gaps = 7/124 (5%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   P    PP + PP   PP + PP   PP + PP    P   PP    PVY PP   
Sbjct: 389 PPPSPPHSPPPPPHSPPPPSPP-HSPP---PPPHSPPPPIYPYLSPPPPPHPVYSPP--P 442

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVE----KPPV-- 348
           PPVY PP   PP   PP  +PP   P  E  PP   P    P  YKPP       PPV  
Sbjct: 443 PPVYSPP---PPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHY 499

Query: 349 YKPP 360
           Y PP
Sbjct: 500 YSPP 503

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 49/119 (41%), Positives = 53/119 (44%), Gaps = 2/119 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP + PP    P   PP    PVY PP   PPVY PP   PP   PP  +PP   P  E 
Sbjct: 415 PPPHSPPPPIYPYLSPPPPPHPVYSPP--PPPVYSPP---PPPSPPPCIEPPPPPPCAEY 469

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPP 360
            P   PP   PP   PP +  P   P    PPV  Y PP   PP   PP    PVY+ P
Sbjct: 470 SP--PPPSPSPP---PPTQYKPPPSPSPPPPPVHYYSPP---PPSQSPP-PPAPVYEGP 519

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 50/121 (41%), Positives = 55/121 (45%), Gaps = 8/121 (6%)
 Frame = +1

Query: 10  PPVY---KPPVEKPPVYKPPVEKPPVYKPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY 171
           PP+Y    PP    PVY PP   PPVY PP      P +  PP      Y PP   PP  
Sbjct: 422 PPIYPYLSPPPPPHPVYSPP--PPPVYSPPPPPSPPPCIEPPPPPPCAEYSPP---PPSP 476

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
            PP   P  YKPP    P   PP   PPV  Y PP   PP   PP    PVY+ P+  PP
Sbjct: 477 SPP--PPTQYKPPPSPSP---PP---PPVHYYSPP---PPSQSPP-PPAPVYEGPL--PP 522

Query: 346 V 348
           +
Sbjct: 523 I 523

[100][TOP]
>UniRef100_A5BQP2 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BQP2_VITVI
          Length = 1190

 Score =  111 bits (277), Expect = 3e-23
 Identities = 66/127 (51%), Positives = 82/127 (64%), Gaps = 11/127 (8%)
 Frame = +1

Query: 13  PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKP 177
           P+YK P+  P P+YK P+  P P+YK P+  P PVYK P+  P PVYK P+  P PVYK 
Sbjct: 340 PIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKK 399

Query: 178 PVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP 342
           P+  P P+YK P+  P P+YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P
Sbjct: 400 PLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPP 459

Query: 343 -PVYKPP 360
            PVYK P
Sbjct: 460 VPVYKKP 466

 Score =  110 bits (276), Expect = 4e-23
 Identities = 65/127 (51%), Positives = 82/127 (64%), Gaps = 11/127 (8%)
 Frame = +1

Query: 13  PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKP 177
           P+YK P+  P P+YK P+  P P+YK P+  P P+YK P+  P PVYK P+  P PVYK 
Sbjct: 329 PIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKK 388

Query: 178 PVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP 342
           P+  P PVYK P+  P P+YK P+  P P+YK P+  P PVYK P+  P PVYK P+  P
Sbjct: 389 PLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPP 448

Query: 343 -PVYKPP 360
            PVYK P
Sbjct: 449 VPVYKKP 455

 Score =  110 bits (275), Expect = 5e-23
 Identities = 64/127 (50%), Positives = 82/127 (64%), Gaps = 11/127 (8%)
 Frame = +1

Query: 13  PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKP 177
           P+YK P+  P P+YK P+  P P+YK P+  P P+YK P+  P P+YK P+  P PVYK 
Sbjct: 318 PIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKK 377

Query: 178 PVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP 342
           P+  P PVYK P+  P PVYK P+  P P+YK P+  P P+YK P+  P PVYK P+  P
Sbjct: 378 PLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPP 437

Query: 343 -PVYKPP 360
            PVYK P
Sbjct: 438 VPVYKKP 444

 Score =  108 bits (269), Expect = 2e-22
 Identities = 64/127 (50%), Positives = 81/127 (63%), Gaps = 10/127 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKP 177
           P V+ PPV   P+YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P P+YK 
Sbjct: 266 PKVFPPPV---PIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKK 322

Query: 178 PVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP 342
           P+  P P+YK P+  P P+YK P+  P P+YK P+  P P+YK P+  P PVYK P+  P
Sbjct: 323 PLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPP 382

Query: 343 -PVYKPP 360
            PVYK P
Sbjct: 383 VPVYKKP 389

 Score =  106 bits (264), Expect = 9e-22
 Identities = 65/128 (50%), Positives = 80/128 (62%), Gaps = 12/128 (9%)
 Frame = +1

Query: 13  PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKP 177
           P+YK P+  P P+YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P P+YK 
Sbjct: 351 PIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKK 410

Query: 178 PVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPV--E 336
           P+  P P+YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P PVYK P   E
Sbjct: 411 PLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPCPPE 470

Query: 337 KPPVYKPP 360
            P +  PP
Sbjct: 471 IPKILPPP 478

 Score =  104 bits (259), Expect = 3e-21
 Identities = 64/127 (50%), Positives = 79/127 (62%), Gaps = 11/127 (8%)
 Frame = +1

Query: 13  PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKP 177
           P+YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P P+YK P+  P P+YK 
Sbjct: 362 PIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKK 421

Query: 178 PVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPV--EKPPVYKPPVEK 339
           P+  P PVYK P+  P PVYK P+  P PVYK P+  P PVYK P   E P +  PP+  
Sbjct: 422 PLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPCPPEIPKILPPPI-- 479

Query: 340 PPVYKPP 360
            P+YK P
Sbjct: 480 -PIYKKP 485

 Score =  103 bits (256), Expect = 8e-21
 Identities = 68/141 (48%), Positives = 84/141 (59%), Gaps = 25/141 (17%)
 Frame = +1

Query: 13  PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKP 177
           PVYK P+  P PVYK P+  P PVYK P+  P P+YK P+  P P+YK P+  P PVYK 
Sbjct: 373 PVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKK 432

Query: 178 PVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPV--EKPPVYKPPV---EKP-----PV 318
           P+  P PVYK P+  P PVYK P+  P PVYK P   E P +  PP+   +KP     P+
Sbjct: 433 PLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPCPPEIPKILPPPIPIYKKPLPPFVPI 492

Query: 319 YK--PPVEK-----PPVYKPP 360
           YK  PP+ K     PP+YK P
Sbjct: 493 YKPIPPISKPLPPFPPIYKKP 513

 Score =  102 bits (255), Expect = 1e-20
 Identities = 62/132 (46%), Positives = 80/132 (60%), Gaps = 15/132 (11%)
 Frame = +1

Query: 10  PPVYKPPVEKPP----VYKP---PVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKP- 162
           P +Y PP++ PP    VY P   P   P V+ PPV   P+YK P+  P PVYK P+  P 
Sbjct: 239 PKIYLPPIKFPPLPPKVYPPFTFPPLPPKVFPPPV---PIYKKPLPPPVPVYKKPLPPPV 295

Query: 163 PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKP 327
           PVYK P+  P PVYK P+  P P+YK P+  P P+YK P+  P P+YK P+  P P+YK 
Sbjct: 296 PVYKKPLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKK 355

Query: 328 PVEKP-PVYKPP 360
           P+  P P+YK P
Sbjct: 356 PLPPPVPIYKKP 367

 Score =  101 bits (251), Expect = 3e-20
 Identities = 63/128 (49%), Positives = 78/128 (60%), Gaps = 11/128 (8%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYK 174
           PP   PP   PP+  P V  PPV  YK P+  P PVYK P+  P PVYK P+  P PVYK
Sbjct: 252 PPKVYPPFTFPPL-PPKVFPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYK 310

Query: 175 PPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEK 339
            P+  P P+YK P+  P P+YK P+  P P+YK P+  P P+YK P+  P P+YK P+  
Sbjct: 311 KPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPP 370

Query: 340 P-PVYKPP 360
           P PVYK P
Sbjct: 371 PVPVYKKP 378

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 61/132 (46%), Positives = 79/132 (59%), Gaps = 16/132 (12%)
 Frame = +1

Query: 13  PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKP 177
           P+YK P+  P P+YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P PVYK 
Sbjct: 406 PIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKK 465

Query: 178 PV--EKPPVYKPPVEKPPVYKPPVEK-PPVYK--PPVEK-----PPVYKPPVEKPPVYKP 327
           P   E P +  PP+   P+YK P+    P+YK  PP+ K     PP+YK P   PP+ + 
Sbjct: 466 PCPPEIPKILPPPI---PIYKKPLPPFVPIYKPIPPISKPLPPFPPIYKKP--WPPIPQV 520

Query: 328 PVEK-PPVYKPP 360
           P+ K PPV+K P
Sbjct: 521 PLPKFPPVHKFP 532

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 59/138 (42%), Positives = 70/138 (50%), Gaps = 22/138 (15%)
 Frame = +1

Query: 13   PVYKPPVEKP-PVYK-PPVEK--PPVYKPPVEK----PPVYKPPVEKP-PVYKPPVEKP- 162
            PVYK P+  P P+YK PP+    PPV   PV K    PPV KPP+  P PV + P+  P 
Sbjct: 923  PVYKKPLPPPVPIYKKPPLPSLPPPV---PVHKKSLPPPVPKPPLPPPVPVSQEPLPPPS 979

Query: 163  PVYKPPVEKPPV------YKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEK 309
            PVY  P+   PV        P VEKP     P++K P   PPV   PV K P   PP   
Sbjct: 980  PVYNEPLPPSPVPVLKKPIPPIVEKPLPPPVPIFKKPALPPPV---PVYKKPPLPPPPPP 1036

Query: 310  PPVYKPPVEKP-PVYKPP 360
             PVY  P+  P P +K P
Sbjct: 1037 VPVYGEPLPPPVPAFKKP 1054

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 58/149 (38%), Positives = 70/149 (46%), Gaps = 32/149 (21%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYK-- 174
            P VY  P  +P  Y+P     P+Y  P+  P  VY  P   P PVYK P+  P P+YK  
Sbjct: 880  PQVYDQPSPQPVYYEPHPPPVPIYHKPLPPPVRVYGQPFPSPVPVYKKPLPPPVPIYKKP 939

Query: 175  ------PPVE------KPPVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKPPV------YK 294
                  PPV        PPV KPP+  P PV + P+  P PVY  P+   PV        
Sbjct: 940  PLPSLPPPVPVHKKSLPPPVPKPPLPPPVPVSQEPLPPPSPVYNEPLPPSPVPVLKKPIP 999

Query: 295  PPVEKP-----PVYKPPVEKP--PVYKPP 360
            P VEKP     P++K P   P  PVYK P
Sbjct: 1000 PIVEKPLPPPVPIFKKPALPPPVPVYKKP 1028

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 56/141 (39%), Positives = 64/141 (45%), Gaps = 25/141 (17%)
 Frame = +1

Query: 10   PPVYKPP---VEKPPVYKPPVEKPPVYKPPVEKPPVYK-------PPV---EKPPVYKPP 150
            P  Y PP   V  P  Y  P   PPV  PP   PPVYK       PP      P VY  P
Sbjct: 829  PKFYLPPFSPVPTPITYPAPEADPPVSHPP--PPPVYKQQIPPSVPPYTAPSPPQVYDQP 886

Query: 151  VEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVY-KPPVEK--P 312
              +P  Y+P     P+Y  P+  P  VY  P   P PVYK P+  P P+Y KPP+    P
Sbjct: 887  SPQPVYYEPHPPPVPIYHKPLPPPVRVYGQPFPSPVPVYKKPLPPPVPIYKKPPLPSLPP 946

Query: 313  PV------YKPPVEKPPVYKP 357
            PV        PPV KPP+  P
Sbjct: 947  PVPVHKKSLPPPVPKPPLPPP 967

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 51/134 (38%), Positives = 70/134 (52%), Gaps = 15/134 (11%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYK--PPVEKP-P 165
            +KPP+  PP    PVY  P+  P P +K P   P P+ + P+  P P++K  PP+ KP P
Sbjct: 1026 KKPPLPPPP-PPVPVYGEPLPPPVPAFKKPYPPPLPIVEKPLPPPIPIHKPIPPISKPAP 1084

Query: 166  VYKPPVEKPPVY--KPPVEKP---PVYKPPVEKPPVYKPPVEKP-PVYKP---PVEKPPV 318
              +     PP+Y  KPP+  P   P   PP +  P+ K P+  P P+ KP       PPV
Sbjct: 1085 TPEVLPAPPPIYSPKPPILNPTPKPKVLPPPQPVPITKKPLPPPVPIQKPVPAAQNPPPV 1144

Query: 319  YKPPVEKPPVYKPP 360
            YK P+  PP+ K P
Sbjct: 1145 YKKPL--PPIPKAP 1156

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 56/160 (35%), Positives = 70/160 (43%), Gaps = 43/160 (26%)
 Frame = +1

Query: 10   PPVYKPPVEKP------------PVYKPPVEKPPV------YKPPVEKPPVYKPPVEKPP 135
            PPV KPP+  P            PVY  P+   PV        P VEKP     P+ K P
Sbjct: 957  PPVPKPPLPPPVPVSQEPLPPPSPVYNEPLPPSPVPVLKKPIPPIVEKPLPPPVPIFKKP 1016

Query: 136  VYKPPV---EKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYK- 294
               PPV   +KPP+  PP    PVY  P+  P P +K P   P P+ + P+  P P++K 
Sbjct: 1017 ALPPPVPVYKKPPL-PPPPPPVPVYGEPLPPPVPAFKKPYPPPLPIVEKPLPPPIPIHKP 1075

Query: 295  -PPVEK-----------PPVYKP------PVEKPPVYKPP 360
             PP+ K           PP+Y P      P  KP V  PP
Sbjct: 1076 IPPISKPAPTPEVLPAPPPIYSPKPPILNPTPKPKVLPPP 1115

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 58/154 (37%), Positives = 74/154 (48%), Gaps = 38/154 (24%)
 Frame = +1

Query: 13   PVYK-PPVEKPP----VYKPPVEKP-PVYKPP-------VEKP-----PVYKP--PVEKP 132
            PVYK PP+  PP    VY  P+  P P +K P       VEKP     P++KP  P+ KP
Sbjct: 1023 PVYKKPPLPPPPPPVPVYGEPLPPPVPAFKKPYPPPLPIVEKPLPPPIPIHKPIPPISKP 1082

Query: 133  -----------PVYKPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYK 264
                       P+Y P   KPP+     KP V  PP   P  +KP     P++KP P  +
Sbjct: 1083 APTPEVLPAPPPIYSP---KPPILNPTPKPKVLPPPQPVPITKKPLPPPVPIQKPVPAAQ 1139

Query: 265  PPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPP 360
             P   PPVYK P+  PP+ K P   + PP+ K P
Sbjct: 1140 NP---PPVYKKPL--PPIPKAPALPKLPPLPKTP 1168

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 51/137 (37%), Positives = 68/137 (49%), Gaps = 18/137 (13%)
 Frame = +1

Query: 4    EKP-----PVYKP--PVEKP-PVYKPPVEKPPVY--KPPVEKP---PVYKPPVEKPPVYK 144
            EKP     P++KP  P+ KP P  +     PP+Y  KPP+  P   P   PP +  P+ K
Sbjct: 1063 EKPLPPPIPIHKPIPPISKPAPTPEVLPAPPPIYSPKPPILNPTPKPKVLPPPQPVPITK 1122

Query: 145  PPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVE--K 309
             P+  PPV   P++KP P  + P   PPVYK P+  PP+ K P   + PP+ K P +   
Sbjct: 1123 KPL-PPPV---PIQKPVPAAQNP---PPVYKKPL--PPIPKAPALPKLPPLPKTPPKYFY 1173

Query: 310  PPVYKPPVEKPPVYKPP 360
             P Y     KPP    P
Sbjct: 1174 HPKYGLGNAKPPSSSHP 1190

[101][TOP]
>UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis
           thaliana RepID=Q9XIL9_ARATH
          Length = 727

 Score =  110 bits (276), Expect = 4e-23
 Identities = 65/117 (55%), Positives = 71/117 (60%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   
Sbjct: 582 PPVYSPP--PPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP-PPPPVHSPP--- 626

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPV+ PP   PPVY PP   PPVY PP   PPV  PP   PPVY PP
Sbjct: 627 PPVFSPP---PPVHSPP---PPVYSPP---PPVYSPP--PPPVKSPP--PPPVYSPP 670

 Score =  110 bits (275), Expect = 5e-23
 Identities = 64/117 (54%), Positives = 72/117 (61%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   
Sbjct: 568 PPVHSPP---PPVHSPP---PPVYSPP--PPPVHSPP---PPVHSPP---PPVHSPP--- 610

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPVY PP
Sbjct: 611 PPVYSPP-PPPPVHSPP---PPVFSPP---PPVHSPP---PPVYSPP---PPVYSPP 654

 Score =  110 bits (274), Expect = 6e-23
 Identities = 64/117 (54%), Positives = 72/117 (61%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVY PP   PPVY PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   
Sbjct: 513 PPVYSPP-PPPPVYSPP-PPPPVYSPP-PPPPVHSPP---PPVHSPP---PPVHSPP--- 560

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP
Sbjct: 561 PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP--PPPVHSPP---PPVHSPP 603

 Score =  108 bits (270), Expect = 2e-22
 Identities = 63/117 (53%), Positives = 72/117 (61%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   
Sbjct: 561 PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP--PPPVHSPP---PPVHSPP--- 603

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP
Sbjct: 604 PPVHSPP---PPVYSPP-PPPPVHSPP---PPVFSPP---PPVHSPP---PPVYSPP 647

 Score =  108 bits (269), Expect = 2e-22
 Identities = 63/117 (53%), Positives = 72/117 (61%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVY PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   
Sbjct: 522 PPVYSPP-PPPPVYSPP-PPPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP--- 567

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP
Sbjct: 568 PPVHSPP---PPVHSPP---PPVYSPP--PPPVHSPP---PPVHSPP---PPVHSPP 610

 Score =  108 bits (269), Expect = 2e-22
 Identities = 63/117 (53%), Positives = 72/117 (61%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   
Sbjct: 531 PPVYSPP-PPPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP--- 574

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP
Sbjct: 575 PPVHSPP---PPVYSPP--PPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP 617

 Score =  107 bits (267), Expect = 4e-22
 Identities = 64/124 (51%), Positives = 72/124 (58%), Gaps = 7/124 (5%)
 Frame = +1

Query: 10  PPVYKPPVEKP-------PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           PPV+ PP   P       PVY PP   PPVY PP   PPVY PP   PPV+ PP   PPV
Sbjct: 496 PPVHSPPPPSPIHSPPPPPVYSPP-PPPPVYSPP-PPPPVYSPP-PPPPVHSPP---PPV 549

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           + PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV
Sbjct: 550 HSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP--PPPV 592

Query: 349 YKPP 360
           + PP
Sbjct: 593 HSPP 596

 Score =  107 bits (267), Expect = 4e-22
 Identities = 62/117 (52%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   
Sbjct: 590 PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP-PPPPVHSPP---PPVFSPP--- 633

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPVY PP   PPVY PP   PPV  PP   PPVY PP+  P +  PP
Sbjct: 634 PPVHSPP---PPVYSPP---PPVYSPP--PPPVKSPP--PPPVYSPPLLPPKMSSPP 680

 Score =  106 bits (265), Expect = 7e-22
 Identities = 62/117 (52%), Positives = 72/117 (61%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   
Sbjct: 547 PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP--P 589

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP
Sbjct: 590 PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP-PPPPVHSPP---PPVFSPP 633

 Score =  106 bits (265), Expect = 7e-22
 Identities = 62/117 (52%), Positives = 72/117 (61%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   
Sbjct: 554 PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP--PPPVHSPP--- 596

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP
Sbjct: 597 PPVHSPP---PPVHSPP---PPVYSPP-PPPPVHSPP---PPVFSPP---PPVHSPP 640

 Score =  105 bits (261), Expect = 2e-21
 Identities = 60/117 (51%), Positives = 68/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   
Sbjct: 597 PPVHSPP---PPVHSPP---PPVYSPP-PPPPVHSPP---PPVFSPP---PPVHSPP--- 640

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPVY PP   PPVY PP   PPV  PP   PPVY PP+  P +  PP + P    PP
Sbjct: 641 PPVYSPP---PPVYSPP--PPPVKSPP--PPPVYSPPLLPPKMSSPPTQTPVNSPPP 690

 Score =  100 bits (250), Expect = 4e-20
 Identities = 60/126 (47%), Positives = 70/126 (55%), Gaps = 7/126 (5%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEK-------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 162
           + P  ++     PPV+ PP          PPVY PP   PPVY PP   PPVY PP   P
Sbjct: 484 QSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPP-PPPPVYSPP-PPPPVYSPP-PPP 540

Query: 163 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
           PV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   P
Sbjct: 541 PVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---P 582

Query: 343 PVYKPP 360
           PVY PP
Sbjct: 583 PVYSPP 588

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 60/119 (50%), Positives = 67/119 (56%), Gaps = 2/119 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   
Sbjct: 604 PPVHSPP---PPVYSPP-PPPPVHSPP---PPVFSPP---PPVHSPP---PPVYSPP--- 647

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP--PVYKPP 360
           PPVY PP   PPV  PP   PPVY PP+  P +  PP + P V  PP   P   V  PP
Sbjct: 648 PPVYSPP--PPPVKSPP--PPPVYSPPLLPPKMSSPPTQTP-VNSPPPRTPSQTVEAPP 701

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 63/135 (46%), Positives = 73/135 (54%), Gaps = 19/135 (14%)
 Frame = +1

Query: 13  PVYKP--PVEKP----PVYKPPVE------KPPVYKPPVEK-------PPVYKPPVEKPP 135
           PV+KP  P E P    P  + PV+       PPV+ PP          PPVY PP   PP
Sbjct: 465 PVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPP-PPPP 523

Query: 136 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
           VY PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PP
Sbjct: 524 VYSPP-PPPPVYSPP-PPPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PP 569

Query: 316 VYKPPVEKPPVYKPP 360
           V+ PP   PPV+ PP
Sbjct: 570 VHSPP---PPVHSPP 581

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 60/146 (41%), Positives = 68/146 (46%), Gaps = 31/146 (21%)
 Frame = +1

Query: 16  VYKPPVEKPPVYKPPVEK--PPVYKPPVEK----------------------PPVYKPPV 123
           V+ PP    P   PPV     PV+KP   K                      PPV+ PP 
Sbjct: 444 VHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPP 503

Query: 124 EK-------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 282
                    PPVY PP   PPVY PP   PPVY PP   PPV+ PP   PPV+ PP   P
Sbjct: 504 PSPIHSPPPPPVYSPP-PPPPVYSPP-PPPPVYSPP-PPPPVHSPP---PPVHSPP---P 554

Query: 283 PVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PV+ PP   PPV+ PP   PPV+ PP
Sbjct: 555 PVHSPP---PPVHSPP---PPVHSPP 574

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/119 (42%), Positives = 60/119 (50%), Gaps = 4/119 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPVY PP   PPVY PP   PPV  PP   PPVY PP+  
Sbjct: 627 PPVFSPP---PPVHSPP---PPVYSPP---PPVYSPP--PPPVKSPP--PPPVYSPPLLP 673

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYK 354
           P +  PP +  PV  PP   P      VE PP  +    PP        PP   PP+++
Sbjct: 674 PKMSSPPTQ-TPVNSPPPRTP---SQTVEAPPPSEEFIIPPFIGHQYASPP---PPMFQ 725

[102][TOP]
>UniRef100_B6TWU3 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6TWU3_MAIZE
          Length = 304

 Score =  110 bits (276), Expect = 4e-23
 Identities = 59/112 (52%), Positives = 66/112 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV  PP  K PV +PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+  PP   
Sbjct: 91  PPVVGPP--KGPVTRPPVTRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPTT- 145

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           PPV  PPV  PP+  PP   P V  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 146 PPVVGPPVTYPPITGPPTT-PXVVGPPVTYPPITGPPATTPPVTGPPVTYPP 196

 Score =  110 bits (274), Expect = 6e-23
 Identities = 62/118 (52%), Positives = 69/118 (58%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           K P Y PPV  PP  K PV +PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+ 
Sbjct: 86  KSPSY-PPVVGPP--KGPVTRPPVTRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPIT 140

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PP   PPV  PPV  PP+  PP   P V  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 141 GPPT-TPPVVGPPVTYPPITGPPT-TPXVVGPPVTYPPITGPPATTPPVTGPPVTYPP 196

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 58/120 (48%), Positives = 66/120 (55%), Gaps = 8/120 (6%)
 Frame = +1

Query: 10  PPVYKP----PVEKPPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 165
           PP  KP    P  KP   KPP        P ++PP  K P Y PPV  PP  K PV +PP
Sbjct: 51  PPKTKPSHPSPSPKPKNPKPPRGSTGYPAPGHQPP--KSPSY-PPVVGPP--KGPVTRPP 105

Query: 166 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           V +PPV  PP  K PV +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP+  PP
Sbjct: 106 VTRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPP 162

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 58/125 (46%), Positives = 68/125 (54%), Gaps = 6/125 (4%)
 Frame = +1

Query: 4   EKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPP 165
           +KP   KP  P +  P +  P  KP   KPP        P ++PP  K P Y PPV  PP
Sbjct: 41  DKPKAPKPSHPPKTKPSHPSPSPKPKNPKPPRGSTGYPAPGHQPP--KSPSY-PPVVGPP 97

Query: 166 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
             K PV +PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+  PP   PPV  PP
Sbjct: 98  --KGPVTRPPVTRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPP 152

Query: 346 VYKPP 360
           V  PP
Sbjct: 153 VTYPP 157

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 51/114 (44%), Positives = 57/114 (50%), Gaps = 7/114 (6%)
 Frame = +1

Query: 7   KPPVYKPP---VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           +PPV  PP   V +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP+  PP   P
Sbjct: 108 RPPVVGPPKGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPPT-TP 165

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP----VEKPPVYKPPVEKPPVYKP 327
            V  PPV  PP+  PP   PPV  PPV  PP        P   PP   P    P
Sbjct: 166 XVVGPPVTYPPITGPPATTPPVTGPPVTYPPGGGGGSSTPCPPPPSPTPTPSSP 219

[103][TOP]
>UniRef100_A8XU99 Putative uncharacterized protein (Fragment) n=1 Tax=Caenorhabditis
            briggsae RepID=A8XU99_CAEBR
          Length = 2024

 Score =  110 bits (276), Expect = 4e-23
 Identities = 61/119 (51%), Positives = 68/119 (57%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 695  EEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPV 754

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E+ PV   PVE  PV + PVE  PV   PVEK PV   PVE  PV + PVE  PV  PP
Sbjct: 755  EEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKPVEAAPVEAPP 813

 Score =  110 bits (274), Expect = 6e-23
 Identities = 61/119 (51%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV   PVEK PV   PV
Sbjct: 374 EAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPV 433

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV K PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV + P
Sbjct: 434 EAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKP 492

 Score =  110 bits (274), Expect = 6e-23
 Identities = 61/119 (51%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV + PVE  PV + PVE  PV   PVEK PV   PVE  PV K PV
Sbjct: 384 EEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPV 443

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV   P
Sbjct: 444 EDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 502

 Score =  110 bits (274), Expect = 6e-23
 Identities = 61/119 (51%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV K PVE  PV   PVEK PV   PVE  PV + PVE  PV + PV
Sbjct: 409 EEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPV 468

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 469 EAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAP 527

 Score =  110 bits (274), Expect = 6e-23
 Identities = 63/120 (52%), Positives = 69/120 (57%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV K PVE  PV   PVEK PV   PVE  PV + PVE  PV + PVE  PV   PV
Sbjct: 419 EAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPV 478

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPP 360
           E+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PPV K P
Sbjct: 479 EEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKP 538

 Score =  109 bits (272), Expect = 1e-22
 Identities = 61/119 (51%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PVE  PV + PVE  PV + PVE  PV   PVE  PV   PV
Sbjct: 324 EAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPV 383

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE  PV + PVE  PV + PVE  PV   PVEK PV   PVE  PV K P
Sbjct: 384 EEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKP 442

 Score =  109 bits (272), Expect = 1e-22
 Identities = 61/119 (51%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV + PVE  PV   PVE  PV   PVE+ PV   PVE  PV + PV
Sbjct: 344 EAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPV 403

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PVEK PV   PVE  PV K PVE  PV   PVE+ PV   P
Sbjct: 404 EAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAP 462

 Score =  109 bits (272), Expect = 1e-22
 Identities = 61/119 (51%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PV
Sbjct: 354 EAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPV 413

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVEK PV   PVE  PV K PVE  PV   PVE+ PV   PVE+ PV   P
Sbjct: 414 EAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAP 472

 Score =  109 bits (272), Expect = 1e-22
 Identities = 61/119 (51%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV   PV
Sbjct: 364 EAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPV 423

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EK PV   PVE  PV K PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + P
Sbjct: 424 EKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 482

 Score =  108 bits (271), Expect = 1e-22
 Identities = 62/124 (50%), Positives = 71/124 (57%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV   PV++ PV   PVE+ PV   PVE  PV K PVE  PV   PVEK PV
Sbjct: 384 EEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPV 443

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV
Sbjct: 444 EDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPV 503

Query: 349 YKPP 360
            + P
Sbjct: 504 KEKP 507

 Score =  108 bits (270), Expect = 2e-22
 Identities = 61/119 (51%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE  PV + PVE  PV + PVE  PV   PVE  PV   PVE+ PV   PV
Sbjct: 334 EAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPV 393

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV + PVE  PV   PVEK PV   PVE  PV K PVE  PV   P
Sbjct: 394 EAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAP 452

 Score =  108 bits (270), Expect = 2e-22
 Identities = 60/119 (50%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE+ PV   PVE  PV   PVE  PV + PVE  PV   PV++ PV   PV
Sbjct: 349 EEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPV 408

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE  PV K PVE  PV   PVEK PV   PVE  PV + PVE  PV + P
Sbjct: 409 EEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKP 467

 Score =  108 bits (270), Expect = 2e-22
 Identities = 60/119 (50%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV K PVE  PV   PV
Sbjct: 379 EAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPV 438

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           EK PV   PVE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   P
Sbjct: 439 EKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAP 497

 Score =  108 bits (270), Expect = 2e-22
 Identities = 60/119 (50%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV + PVE  PV   PVEK PV   PVE  PV K PVE  PV   PV
Sbjct: 394 EAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPV 453

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV   PV++ PV   P
Sbjct: 454 EEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 512

 Score =  108 bits (270), Expect = 2e-22
 Identities = 60/119 (50%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           ++ PV   PVE+ PV   PVE  PV K PVE  PV   PVEK PV   PVE  PV + PV
Sbjct: 399 KEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPV 458

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 459 EAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 517

 Score =  108 bits (270), Expect = 2e-22
 Identities = 60/119 (50%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PVEK PV   PVE  PV K PVE  PV   PVE+ PV   PV
Sbjct: 404 EAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPV 463

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + P
Sbjct: 464 EEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 522

 Score =  108 bits (270), Expect = 2e-22
 Identities = 62/120 (51%), Positives = 69/120 (57%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EK PV   PVE  PV K PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PV
Sbjct: 424 EKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPV 483

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKPPVYKPP 360
           E  PV + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PPVEK PV   P
Sbjct: 484 EAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAP 543

 Score =  108 bits (270), Expect = 2e-22
 Identities = 62/120 (51%), Positives = 69/120 (57%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EK PV   PVE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PV
Sbjct: 439 EKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPV 498

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PVE+ PV   PVE  PPV K PVE  PV   PVE+ PV   P
Sbjct: 499 EAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAP 558

 Score =  108 bits (270), Expect = 2e-22
 Identities = 61/124 (49%), Positives = 71/124 (57%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV
Sbjct: 695  EEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPV 754

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
             + PVE  PV   PV++ PV   PVE  PV K PVE  PV   PVE+ PV   PVE PPV
Sbjct: 755  EEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKPVEAAPVEAPPV 814

Query: 349  YKPP 360
             + P
Sbjct: 815  ERKP 818

 Score =  108 bits (269), Expect = 2e-22
 Identities = 62/124 (50%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV   PVEK PV   PVE  PV K PVE  PV   PVE+ PV   PVE+ PV
Sbjct: 409 EEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPV 468

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PVE  PV
Sbjct: 469 EAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPV 528

Query: 349 YKPP 360
              P
Sbjct: 529 EAAP 532

 Score =  108 bits (269), Expect = 2e-22
 Identities = 62/124 (50%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV
Sbjct: 680  EEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPV 739

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
             + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVEK PV   PVE  PV
Sbjct: 740  EEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPV 799

Query: 349  YKPP 360
             + P
Sbjct: 800  EEKP 803

 Score =  107 bits (268), Expect = 3e-22
 Identities = 60/119 (50%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  PV + PVE  PV   PV
Sbjct: 314 EEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPV 373

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV   PVEK PV   P
Sbjct: 374 EAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAP 432

 Score =  107 bits (268), Expect = 3e-22
 Identities = 60/119 (50%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE+ PV   PVE+ PV   PVE  PV   PVE  PV + PVE  PV   PV
Sbjct: 339 EDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPV 398

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           ++ PV   PVE+ PV   PVE  PV K PVE  PV   PVEK PV   PVE  PV + P
Sbjct: 399 KEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKP 457

 Score =  107 bits (268), Expect = 3e-22
 Identities = 60/119 (50%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV   PVE  PV + PVE  PV   PV++ PV   PVE+ PV   PV
Sbjct: 359 EEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPV 418

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV K PVE  PV   PVEK PV   PVE  PV + PVE  PV + PVE  PV   P
Sbjct: 419 EAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 477

 Score =  107 bits (268), Expect = 3e-22
 Identities = 60/119 (50%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV K PV
Sbjct: 369 EDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPV 428

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVEK PV   PVE  PV + PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 429 EAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 487

 Score =  107 bits (268), Expect = 3e-22
 Identities = 60/119 (50%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PV
Sbjct: 675  EAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPV 734

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVEK PV   P
Sbjct: 735  EAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAP 793

 Score =  107 bits (267), Expect = 4e-22
 Identities = 59/119 (49%), Positives = 70/119 (58%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE+ PV + PVE  PV + PV
Sbjct: 836  EEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEDAPVEEKPVEEKPVEAAPVEEKPV 895

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV   PVE+ PV   P
Sbjct: 896  EAAPVEEKPVEAAPVEAAPVEEKPVDAAPVEEKPVDADPVEGKPVEAAPVEEKPVEAAP 954

 Score =  107 bits (266), Expect = 5e-22
 Identities = 61/120 (50%), Positives = 69/120 (57%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV K PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV + PV
Sbjct: 434 EAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPV 493

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PV++ PV   PVE  PV + PVE  PV   PPVEK PV   PVE  PV + P
Sbjct: 494 EAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKP 553

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/119 (49%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV
Sbjct: 595 EEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPV 654

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + P
Sbjct: 655 EAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKP 713

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/124 (47%), Positives = 73/124 (58%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV + PVE  PV + PVE  PV + PVE  PV + PVE+ PV   PVE+ PV
Sbjct: 836  EEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEDAPVEEKPVEEKPVEAAPVEEKPV 895

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PVE+ PV   PVE  PV + PV+  PV + PV+  PV   PVE  PV + PVE  PV
Sbjct: 896  EAAPVEEKPVEAAPVEAAPVEEKPVDAAPVEEKPVDADPVEGKPVEAAPVEEKPVEAAPV 955

Query: 349  YKPP 360
             + P
Sbjct: 956  ERKP 959

 Score =  106 bits (264), Expect = 9e-22
 Identities = 59/119 (49%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           ++ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE  PV   PVE  PV + PV
Sbjct: 329 KEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPV 388

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PV++ PV   PVE+ PV   PVE  PV K PVE  PV   PVEK PV   P
Sbjct: 389 EDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAP 447

 Score =  106 bits (264), Expect = 9e-22
 Identities = 61/124 (49%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV
Sbjct: 620 EEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPV 679

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV
Sbjct: 680 EEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPV 739

Query: 349 YKPP 360
            + P
Sbjct: 740 EEKP 743

 Score =  106 bits (264), Expect = 9e-22
 Identities = 59/119 (49%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PV
Sbjct: 645  EAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPV 704

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 705  EAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAP 763

 Score =  106 bits (264), Expect = 9e-22
 Identities = 59/119 (49%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV
Sbjct: 655  EAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPV 714

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + P
Sbjct: 715  EAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKP 773

 Score =  106 bits (264), Expect = 9e-22
 Identities = 59/119 (49%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 665  EEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPV 724

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 725  EEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAP 783

 Score =  105 bits (263), Expect = 1e-21
 Identities = 59/119 (49%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 575 EAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPV 634

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 635 EEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 693

 Score =  105 bits (263), Expect = 1e-21
 Identities = 59/119 (49%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PV
Sbjct: 585 EAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPV 644

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 645 EAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAP 703

 Score =  105 bits (263), Expect = 1e-21
 Identities = 59/119 (49%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 605 EEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPV 664

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 665 EEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAP 723

 Score =  105 bits (263), Expect = 1e-21
 Identities = 59/119 (49%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PV
Sbjct: 615 EAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPV 674

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 675 EAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAP 733

 Score =  105 bits (263), Expect = 1e-21
 Identities = 59/119 (49%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 635 EEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPV 694

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 695 EEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 753

 Score =  105 bits (261), Expect = 2e-21
 Identities = 60/116 (51%), Positives = 67/116 (57%), Gaps = 1/116 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PV
Sbjct: 449 EAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPV 508

Query: 184 EKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           E  PV   PVE+ PV   PVE  PPV K PVE  PV   PVE+ PV   PVE  PV
Sbjct: 509 EAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPV 564

 Score =  105 bits (261), Expect = 2e-21
 Identities = 60/124 (48%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  PV
Sbjct: 665  EEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPV 724

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
             + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  PV
Sbjct: 725  EEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPV 784

Query: 349  YKPP 360
             K P
Sbjct: 785  EKKP 788

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/119 (48%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PV++ PV   PVE  PV   PVE+ PV   PVE+ PV   PV
Sbjct: 309 EAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPV 368

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV K P
Sbjct: 369 EDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKP 427

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/119 (48%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PV
Sbjct: 690  EAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPV 749

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PVE  PV   PV++ PV   PVE  PV K PVE  PV   PVE+ PV   P
Sbjct: 750  EAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKPVEAAP 808

 Score =  104 bits (259), Expect = 3e-21
 Identities = 60/124 (48%), Positives = 69/124 (55%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV   PV++ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE  PV
Sbjct: 314 EEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPV 373

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV K PVE  PV
Sbjct: 374 EAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPV 433

Query: 349 YKPP 360
              P
Sbjct: 434 EAAP 437

 Score =  104 bits (259), Expect = 3e-21
 Identities = 59/119 (49%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EK PV   PVE  PV + PVE  PV   PVE+  V   PVE  PV + PVE  PV   PV
Sbjct: 535 EKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPV 594

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + P
Sbjct: 595 EEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKP 653

 Score =  103 bits (257), Expect = 6e-21
 Identities = 60/122 (49%), Positives = 69/122 (56%), Gaps = 2/122 (1%)
 Frame = +1

Query: 1   QEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 174
           +EKP  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE+ PV  
Sbjct: 221 EEKPAAPVEAAPVEEEPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEA 280

Query: 175 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
            PVE+ PV   PVE  PV + PVE   V   PVE+ PV   PVE  PV + PVE  PV  
Sbjct: 281 APVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVED 340

Query: 355 PP 360
            P
Sbjct: 341 KP 342

 Score =  103 bits (257), Expect = 6e-21
 Identities = 57/119 (47%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   PV
Sbjct: 590 EAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPV 649

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           ++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 650 KEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAP 708

 Score =  103 bits (257), Expect = 6e-21
 Identities = 59/124 (47%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV
Sbjct: 635  EEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPV 694

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
             + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV
Sbjct: 695  EEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPV 754

Query: 349  YKPP 360
             + P
Sbjct: 755  EEKP 758

 Score =  103 bits (256), Expect = 8e-21
 Identities = 58/119 (48%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV   PV
Sbjct: 234 EEEPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPV 293

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE   V   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + P
Sbjct: 294 EAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEP 352

 Score =  103 bits (256), Expect = 8e-21
 Identities = 58/119 (48%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PV
Sbjct: 244 EAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPV 303

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E   V   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  PV + P
Sbjct: 304 EAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEP 362

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/119 (47%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            ++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 650  KEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPV 709

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            ++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 710  KEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAP 768

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/119 (47%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PV
Sbjct: 660  EAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPV 719

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   P
Sbjct: 720  EAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAP 778

 Score =  102 bits (255), Expect = 1e-20
 Identities = 62/125 (49%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV
Sbjct: 454 EEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPV 513

Query: 169 YKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
              PVE+ PV   PVE  PPV K PVE  PV   PVE+ PV   PVE  PV +  VE  P
Sbjct: 514 EAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAP 573

Query: 346 VYKPP 360
           V   P
Sbjct: 574 VEAAP 578

 Score =  102 bits (255), Expect = 1e-20
 Identities = 58/119 (48%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+  V   PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PV
Sbjct: 565 EEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPV 624

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + P
Sbjct: 625 EAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 683

 Score =  102 bits (255), Expect = 1e-20
 Identities = 56/119 (47%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           ++ PV   PVE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV
Sbjct: 580 KEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPV 639

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + P
Sbjct: 640 DDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 698

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/119 (48%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE   V   PV
Sbjct: 254 EAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPV 313

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  PV + PVE  PV   P
Sbjct: 314 EEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKP 372

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/119 (48%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE   V   PVE+ PV   PV
Sbjct: 264 EEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPV 323

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PVE  PV + PVE  PV + PVE  PV   PVE  PV   P
Sbjct: 324 EAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAP 382

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/119 (48%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE+ PV   PVE  PV + PVE   V   PVE+ PV   PVE  PV + PV
Sbjct: 274 EEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPV 333

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE  PV + PVE  PV + PVE  PV   PVE  PV   PVE+ PV   P
Sbjct: 334 EAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAP 392

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/119 (48%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV + PVE   V   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 284 EEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPV 343

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV + PVE  PV   PVE  PV   PVE+ PV   PVE  PV + P
Sbjct: 344 EAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKP 402

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/119 (48%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE   V   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PV
Sbjct: 294 EAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPV 353

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PVE  PV   PVE+ PV   PVE  PV + PVE  PV + P
Sbjct: 354 EAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKP 412

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/120 (50%), Positives = 67/120 (55%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYK-PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           E  PV + PVE  PV   PPVEK PV   PVE  PV + PVE  PV   PVE+  V   P
Sbjct: 514 EAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAP 573

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           VE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 574 VEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 633

 Score =  102 bits (254), Expect = 1e-20
 Identities = 57/112 (50%), Positives = 64/112 (57%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           PPVEK PV   PVE  PV + PVE  PV   PVE+  V   PVE  PV + PVE  PV  
Sbjct: 532 PPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEA 591

Query: 205 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 592 APVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAP 643

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/124 (48%), Positives = 69/124 (55%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV   PVE+  V   PVE  PV + PVE  PV   PVE+ PV   PVE+ PV
Sbjct: 550 EEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPV 609

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV
Sbjct: 610 EAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPV 669

Query: 349 YKPP 360
              P
Sbjct: 670 EAAP 673

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/124 (46%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   PV++ PV
Sbjct: 595 EEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPV 654

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV
Sbjct: 655 EAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPV 714

Query: 349 YKPP 360
              P
Sbjct: 715 EAAP 718

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/124 (46%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV   PVE+ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV
Sbjct: 605 EEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPV 664

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  PV
Sbjct: 665 EEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPV 724

Query: 349 YKPP 360
            + P
Sbjct: 725 EEKP 728

 Score =  102 bits (253), Expect = 2e-20
 Identities = 58/119 (48%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PVE+  V   PVE  PV + PVE  PV   PVE+ PV   PV
Sbjct: 545 EAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPV 604

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 605 EEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAP 663

 Score =  102 bits (253), Expect = 2e-20
 Identities = 56/119 (47%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PV++ PV   PVE  PV + PVE  PV + PVE  PV   PVE+ PV   PV
Sbjct: 570 EDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPV 629

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PV+  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 630 EAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 688

 Score =  102 bits (253), Expect = 2e-20
 Identities = 56/119 (47%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PV+  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PV
Sbjct: 630 EAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPV 689

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 690 EAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 748

 Score =  102 bits (253), Expect = 2e-20
 Identities = 56/119 (47%), Positives = 68/119 (57%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV
Sbjct: 1846 EEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPV 1905

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV   PV++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + P
Sbjct: 1906 EAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKP 1964

 Score =  101 bits (252), Expect = 2e-20
 Identities = 59/120 (49%), Positives = 68/120 (56%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV
Sbjct: 464 EEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPV 523

Query: 184 EKPPVYK-PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PPVEK PV   PVE  PV + PVE  PV   PVE+  V   PVE  PV + P
Sbjct: 524 EAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKP 583

 Score =  101 bits (252), Expect = 2e-20
 Identities = 59/120 (49%), Positives = 68/120 (56%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPP 180
           E+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PPV K P
Sbjct: 479 EEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKP 538

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           VE  PV   PVE+ PV   PVE  PV +  VE  PV   PV++ PV   PVE  PV + P
Sbjct: 539 VEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKP 598

 Score =  101 bits (252), Expect = 2e-20
 Identities = 59/120 (49%), Positives = 68/120 (56%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPP 180
           E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PPV K PVE  PV   P
Sbjct: 489 EEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAP 548

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           VE+ PV   PVE  PV +  VE  PV   PV++ PV   PVE  PV + PVE  PV + P
Sbjct: 549 VEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKP 608

 Score =  101 bits (252), Expect = 2e-20
 Identities = 59/120 (49%), Positives = 68/120 (56%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           ++ PV   PVE  PV + PVE  PV   PPVEK PV   PVE  PV + PVE  PV   P
Sbjct: 504 KEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAP 563

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           VE+  V   PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + P
Sbjct: 564 VEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 623

 Score =  101 bits (252), Expect = 2e-20
 Identities = 59/120 (49%), Positives = 68/120 (56%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           E+ PV   PVE  PPV K PVE  PV   PVE+ PV   PVE  PV +  VE  PV   P
Sbjct: 519 EEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAP 578

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           V++ PV   PVE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + P
Sbjct: 579 VKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 638

 Score =  101 bits (252), Expect = 2e-20
 Identities = 55/112 (49%), Positives = 65/112 (58%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            ++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 710  KEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPV 769

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
            ++ PV   PVE  PV K PVE  PV   PVE+ PV   PVE PPV + P E+
Sbjct: 770  KEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKPVEAAPVEAPPVERKPDER 821

 Score =  101 bits (251), Expect = 3e-20
 Identities = 59/124 (47%), Positives = 69/124 (55%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV + PVE  PV + PVE  PV   PVE+ PV    VE  PV + PVE  PV
Sbjct: 264 EEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPV 323

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PV++ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE  PV   PVE  PV
Sbjct: 324 EAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPV 383

Query: 349 YKPP 360
            + P
Sbjct: 384 EEKP 387

 Score =  100 bits (250), Expect = 4e-20
 Identities = 57/119 (47%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV + PVE  PV + PVE  PV   PVE+ PV    VE  PV + PV
Sbjct: 259 EAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPV 318

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PV++ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE  PV   P
Sbjct: 319 EDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAP 377

 Score =  100 bits (250), Expect = 4e-20
 Identities = 59/120 (49%), Positives = 67/120 (55%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PP 180
           E  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PP
Sbjct: 474 EAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPP 533

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           VEK PV   PVE  PV + PVE  PV   PVE+  V   PVE  PV + PVE  PV   P
Sbjct: 534 VEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAP 593

 Score =  100 bits (250), Expect = 4e-20
 Identities = 59/120 (49%), Positives = 67/120 (55%), Gaps = 1/120 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           E  PV + PVE  PV   PVE+ PV   PVE  PPV K PVE  PV   PVE+ PV   P
Sbjct: 499 EAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAP 558

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           VE  PV +  VE  PV   PV++ PV   PVE  PV + PVE  PV + PVE  PV   P
Sbjct: 559 VEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 618

 Score =  100 bits (249), Expect = 5e-20
 Identities = 59/124 (47%), Positives = 68/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV + PVE  PV   PVE+ PV    VE  PV + PVE  PV   PV++ PV
Sbjct: 274 EEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPV 333

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE  PV   PVE+ PV   PVE+ PV   PVE  PV   PVE  PV + PVE  PV
Sbjct: 334 EAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPV 393

Query: 349 YKPP 360
              P
Sbjct: 394 EAAP 397

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/119 (46%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV + PV+  PV   PV++ PV   PVE  PV + PV+  PV   PV
Sbjct: 1841 EAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPV 1900

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            ++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 1901 KEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAP 1959

 Score =  100 bits (248), Expect = 7e-20
 Identities = 56/119 (47%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           ++ PV   PVE  PV + PVE  PV + PVE  PV + PVE  PV   PVE+ PV    V
Sbjct: 249 KEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALV 308

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PV++ PV   PVE  PV   PVE+ PV   PVE+ PV   P
Sbjct: 309 EAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAP 367

 Score =  100 bits (248), Expect = 7e-20
 Identities = 56/119 (47%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV + PV+   V   PVE+ PV   PVE+ PV   PVE  PV + PV
Sbjct: 1816 EAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPV 1875

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  PV + P
Sbjct: 1876 EAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 1934

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 55/117 (47%), Positives = 69/117 (58%), Gaps = 4/117 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV + PVE  PV + PVE  PV + PVE+ PV   PVE+ PV   PVE+ PV
Sbjct: 846  EEKPVEAAPVEEKPVEAAPVEEKPVEDAPVEEKPVEEKPVEAAPVEEKPVEAAPVEEKPV 905

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
               PVE  PV + PV+  PV + PV+  PV   PVE  PV + PVE  PV + P E+
Sbjct: 906  EAAPVEAAPVEEKPVDAAPVEEKPVDADPVEGKPVEAAPVEEKPVEAAPVERKPEER 962

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 56/120 (46%), Positives = 69/120 (57%), Gaps = 4/120 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV + PV+  PV   PV++ PV   PVE  PV + PV+  PV   PV++ PV
Sbjct: 1846 EEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPV 1905

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV
Sbjct: 1906 EAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPV 1965

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 56/119 (47%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PV++ PV   PVE  PV + PVE  PV + PVE  PV + PV
Sbjct: 229 EAAPVEEEPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPV 288

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE+ PV    VE  PV + PVE  PV   PV++ PV   PVE  PV   P
Sbjct: 289 EAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAP 347

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 56/119 (47%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PV++ PV   PVE  PV + PVE  PV + PVE  PV + PVE  PV   PV
Sbjct: 239 EAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPV 298

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV    VE  PV + PVE  PV   PV++ PV   PVE  PV   PVE+ PV   P
Sbjct: 299 EEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAP 357

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 56/119 (47%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV    VE  PV + PVE  PV   PV++ PV   PVE  PV   PVE+ PV   PV
Sbjct: 299 EEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPV 358

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE  PV   PVE  PV + PVE  PV   PV++ PV   PVE+ PV   P
Sbjct: 359 EEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAP 417

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 56/119 (47%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE+ PV   PVE+ PV   PVE+  V   PVE   V + PV+  PV + PV
Sbjct: 1321 EEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPV 1380

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   P
Sbjct: 1381 EAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAP 1439

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 58/124 (46%), Positives = 69/124 (55%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV + PVE  PV   PVE+ PV    VE  PV + PVE  PV + PV+   V
Sbjct: 1781 EEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQV 1840

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV
Sbjct: 1841 EAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPV 1900

Query: 349  YKPP 360
             + P
Sbjct: 1901 KEKP 1904

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 57/124 (45%), Positives = 69/124 (55%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV + PV+   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV
Sbjct: 1821 EEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPV 1880

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV
Sbjct: 1881 EAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPV 1940

Query: 349  YKPP 360
               P
Sbjct: 1941 EAAP 1944

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 55/119 (46%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 1856 EEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPV 1915

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            ++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE   V + P
Sbjct: 1916 KEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKP 1974

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 55/119 (46%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV +  VE  PV   PV++ PV   PVE  PV + PVE  PV + PVE  PV   PV
Sbjct: 560 EAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPV 619

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE  PV   P
Sbjct: 620 EEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAP 678

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 58/120 (48%), Positives = 68/120 (56%), Gaps = 4/120 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV + PVE  PV + PVE  PV +  VE  PV    VE+ PV   PVE+ PV
Sbjct: 1321 EEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPV 1380

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  PV + PVE  PV
Sbjct: 1381 EAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPV 1440

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 58/124 (46%), Positives = 68/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV   PVE+ PV    VE  PV + PVE  PV + PV+   V   PVE+ PV
Sbjct: 1791 EEKPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPV 1850

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV
Sbjct: 1851 EAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPV 1910

Query: 349  YKPP 360
               P
Sbjct: 1911 EAAP 1914

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 54/119 (45%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV    VE  PV + PVE  PV + PV+  PV   PV++ PV   PVE  PV + PV
Sbjct: 1831 EEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPV 1890

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + P
Sbjct: 1891 DAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKP 1949

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 58/124 (46%), Positives = 68/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV
Sbjct: 1886 EEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPV 1945

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
             + PVE  PV   PVE+ PV    VE+ PV    VE  PV + PVE  PV + PVE  PV
Sbjct: 1946 KEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAPV 2005

Query: 349  YKPP 360
               P
Sbjct: 2006 EAAP 2009

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 53/114 (46%), Positives = 65/114 (57%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PV
Sbjct: 1366 EEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPV 1425

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
            E  PV + PVE  PV +  V+  PV + P E  PV + PV+  PV  PP E+ P
Sbjct: 1426 EAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKP 1479

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 56/120 (46%), Positives = 68/120 (56%), Gaps = 4/120 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV   PV++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV
Sbjct: 1856 EEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPV 1915

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
             + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV    VE+ PV
Sbjct: 1916 KEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKPV 1975

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 55/119 (46%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV    VE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 1356 EAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPV 1415

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PVE  PV + PVE  PV +  V+  PV + P E  PV + PV+  PV  PP
Sbjct: 1416 EAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPP 1474

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 54/115 (46%), Positives = 65/115 (56%)
 Frame = +1

Query: 16   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 195
            V + PV+  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ P
Sbjct: 1365 VEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKP 1424

Query: 196  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            V   PVE+ PV   PVE+  V   PVE+ P    PVE+ PV   PVE PP  + P
Sbjct: 1425 VEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKP 1479

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 55/119 (46%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV    VE  PV + PVE  PV + PV+   V   PVE+ PV   PVE+ PV   PV
Sbjct: 1806 EEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPV 1865

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   P
Sbjct: 1866 EAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAP 1924

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 55/119 (46%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PV+  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PV
Sbjct: 1881 EAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPV 1940

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PVE  PV   PVE+ PV    VE+ PV    VE  PV + PVE  PV + P
Sbjct: 1941 EAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAPVEEKP 1999

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 57/129 (44%), Positives = 66/129 (51%), Gaps = 10/129 (7%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--- 174
           E+ PV  PPVE+ PV   PVE  PV + PVE  P+ K P E  PV   PVE PPV +   
Sbjct: 16  EEKPVEVPPVEEKPVEAAPVEVAPVEQKPVETAPLEKKPAEAAPVEAAPVEAPPVEEKQD 75

Query: 175 -------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 333
                   PVE+ PV    VE  PV + PVE  P    PVE+ P    PVE+ PV   P 
Sbjct: 76  EATLAEAAPVEEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEKPFEATPVEQKPVEDSPA 135

Query: 334 EKPPVYKPP 360
           E  PV K P
Sbjct: 136 EVAPVEKKP 144

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 55/119 (46%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            ++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 1901 KEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPV 1960

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E+ PV    VE+ PV    VE  PV + PVE  PV + PVE  PV   PV++ PV   P
Sbjct: 1961 EEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 2019

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/119 (46%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE+ PV   PVE+  V   PVE   V + PV+  PV + PVE  PV + PV
Sbjct: 1331 EEEPVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPV 1390

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV   PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE+  V   P
Sbjct: 1391 EAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAP 1449

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/119 (46%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV +  VE  PV    VE+ PV   PVE+ PV   PVE+ PV   PV
Sbjct: 1336 EAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPV 1395

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PVE  PV   PVE  PV + PVE  PV + PVE  PV +  V+  PV + P
Sbjct: 1396 EAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKP 1454

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/117 (47%), Positives = 66/117 (56%), Gaps = 4/117 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV
Sbjct: 1366 EEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPV 1425

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
               PVE+ PV   PVE+  V   PVE+ P    PVE+ PV   PVE PP  + P E+
Sbjct: 1426 EAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKPEER 1482

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 54/119 (45%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            ++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE  PV   PV
Sbjct: 1871 KEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPV 1930

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E+ PV   PVE  PV + PVE  PV   PVE+ PV    VE+ PV    VE  PV + P
Sbjct: 1931 EEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKP 1989

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/130 (43%), Positives = 66/130 (50%), Gaps = 10/130 (7%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           Q+  PV   P E+ PV  PPVE+ PV   PVE  PV + PVE  P+ K P E  PV   P
Sbjct: 5   QKAAPVEAAPAEEKPVEVPPVEEKPVEAAPVEVAPVEQKPVETAPLEKKPAEAAPVEAAP 64

Query: 181 VEKPPVYK----------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 330
           VE PPV +           PVE+ PV    VE  PV + PVE  P    PVE+ P    P
Sbjct: 65  VEAPPVEEKQDEATLAEAAPVEEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEKPFEATP 124

Query: 331 VEKPPVYKPP 360
           VE+ PV   P
Sbjct: 125 VEQKPVEDSP 134

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 59/140 (42%), Positives = 70/140 (50%), Gaps = 20/140 (14%)
 Frame = +1

Query: 1    QEKPPVYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP- 165
            ++ P    P    PVE  PV   PVEK PV   PVE  PV + PVE  PV  PPVE+ P 
Sbjct: 760  EDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKPVEAAPVEAPPVERKPD 819

Query: 166  ---------------VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 300
                             + PVE  PV + PVE  PV + PVE  PV + PVE  PV + P
Sbjct: 820  ERKEADSEIKKIISVTEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEDAPVEEKP 879

Query: 301  VEKPPVYKPPVEKPPVYKPP 360
            VE+ PV   PVE+ PV   P
Sbjct: 880  VEEKPVEAAPVEEKPVEAAP 899

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 53/119 (44%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PV++ PV   PV
Sbjct: 1896 EAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPV 1955

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PVE   V + PV+   V   PVE+ PV   PVE+ PV   PVE  PV + P
Sbjct: 1956 EAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKP 2014

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 53/119 (44%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PV
Sbjct: 1801 EAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPV 1860

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +  PV   PV++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + P
Sbjct: 1861 DAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKP 1919

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/114 (47%), Positives = 63/114 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV    V
Sbjct: 1911 EAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASV 1970

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
            E+ PV    VE  PV + PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 1971 EEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 2024

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 55/124 (44%), Positives = 68/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP     V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PV+  PV
Sbjct: 1806 EEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPV 1865

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PV++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE  PV
Sbjct: 1866 EAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPV 1925

Query: 349  YKPP 360
               P
Sbjct: 1926 EAAP 1929

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 53/119 (44%), Positives = 65/119 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV   PV++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PV
Sbjct: 1906 EAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPV 1965

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E   V + PV+   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 1966 EVASVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 2024

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/119 (44%), Positives = 65/119 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PV
Sbjct: 1866 EAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPV 1925

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PV+  PV   PV++ PV   PVE  PV + PVE   V + PV+   V   P
Sbjct: 1926 EAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAP 1984

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/119 (44%), Positives = 65/119 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV
Sbjct: 1876 EAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPV 1935

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +  PV   PV++ PV   PVE  PV + PVE   V + PV+   V   PVE+ PV   P
Sbjct: 1936 DAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAP 1994

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 61/140 (43%), Positives = 70/140 (50%), Gaps = 21/140 (15%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYK-P----PVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            E+ PV   PVE  PV + PVE  PV   P    PVE  PV   PVEK PV   PVE  PV
Sbjct: 740  EEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPV 799

Query: 169  YKPPVEKPPVYKPPVEKPP----------------VYKPPVEKPPVYKPPVEKPPVYKPP 300
             + PVE  PV  PPVE+ P                  + PVE  PV + PVE  PV + P
Sbjct: 800  EEKPVEAAPVEAPPVERKPDERKEADSEIKKIISVTEEKPVEAAPVEEKPVEAAPVEEKP 859

Query: 301  VEKPPVYKPPVEKPPVYKPP 360
            VE  PV + PVE  PV + P
Sbjct: 860  VEAAPVEEKPVEDAPVEEKP 879

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 61/140 (43%), Positives = 69/140 (49%), Gaps = 21/140 (15%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYK-P----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            E  PV + PVE  PV   P    PVE  PV   PVE+ PV   PVE  PV + PVE  PV
Sbjct: 720  EAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPV 779

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP----------------VYKPP 300
               PVEK PV   PVE  PV + PVE  PV  PPVE+ P                  + P
Sbjct: 780  EAAPVEKKPVEAAPVEAAPVEEKPVEAAPVEAPPVERKPDERKEADSEIKKIISVTEEKP 839

Query: 301  VEKPPVYKPPVEKPPVYKPP 360
            VE  PV + PVE  PV + P
Sbjct: 840  VEAAPVEEKPVEAAPVEEKP 859

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 54/119 (45%), Positives = 65/119 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV +  VE  PV    VE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PV
Sbjct: 1346 EAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPV 1405

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV   PVE  PV + PVE  PV + PVE  PV +  V+  PV + P E  PV + P
Sbjct: 1406 EAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKP 1464

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 54/119 (45%), Positives = 65/119 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+  V   PVE   V + PV+  PV + PVE  PV + PVE  PV   PVE+ PV   PV
Sbjct: 1351 EEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPV 1410

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV   PVE+ PV   PVE+ PV   PVE+  V   PVE+ P    PVE+ PV   P
Sbjct: 1411 EAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAP 1469

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 53/124 (42%), Positives = 62/124 (50%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV   PVE+ PV   P+EK P    PVE  PV  PPVE+        E  PV
Sbjct: 26  EEKPVEAAPVEVAPVEQKPVETAPLEKKPAEAAPVEAAPVEAPPVEEKQDEATLAEAAPV 85

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            + PVE   V   PV++ PV   P E  PV + P E  PV + PVE  P    PVEK PV
Sbjct: 86  EEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEKPFEATPVEQKPVEDSPAEVAPVEKKPV 145

Query: 349 YKPP 360
              P
Sbjct: 146 EAAP 149

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 54/121 (44%), Positives = 67/121 (55%), Gaps = 7/121 (5%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVY-KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 165
            +EKP    PV + PVE  PV  KP VE+ PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 856  EEKPVEAAPVEEKPVEDAPVEEKP-VEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 914

Query: 166  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEK 339
            V + PV+  PV + PV+  PV   PVE  PV + PVE  PV + P E+         +EK
Sbjct: 915  VEEKPVDAAPVEEKPVDADPVEGKPVEAAPVEEKPVEAAPVERKPEERKEADTVNKKIEK 974

Query: 340  P 342
            P
Sbjct: 975  P 975

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 48/115 (41%), Positives = 56/115 (48%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   P+EK P    PVE  PV  PPVE+        E  PV + PVE   V   PV
Sbjct: 41  EQKPVETAPLEKKPAEAAPVEAAPVEAPPVEEKQDEATLAEAAPVEEKPVEAASVEAAPV 100

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           ++ PV   P E  PV + P E  PV + PVE  P    PVEK PV   P E   V
Sbjct: 101 KEKPVEDTPAEVAPVEEKPFEATPVEQKPVEDSPAEVAPVEKKPVEAAPAEAATV 155

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 46/112 (41%), Positives = 54/112 (48%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  P+ K P E  PV   PVE PPV +   E       PVE+ PV    VE  PV + PV
Sbjct: 46  ETAPLEKKPAEAAPVEAAPVEAPPVEEKQDEATLAEAAPVEEKPVEAASVEAAPVKEKPV 105

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           E  P    PVE+ P    PVE+ PV   P E  PV K PVE  P     V++
Sbjct: 106 EDTPAEVAPVEEKPFEATPVEQKPVEDSPAEVAPVEKKPVEAAPAEAATVKE 157

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 45/112 (40%), Positives = 53/112 (47%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EK P    PVE  PV  PPVE+        E  PV + PVE   V   PV++ PV   P 
Sbjct: 51  EKKPAEAAPVEAAPVEAPPVEEKQDEATLAEAAPVEEKPVEAASVEAAPVKEKPVEDTPA 110

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           E  PV + P E  PV + PVE  P    PVEK PV   P E   V +   E+
Sbjct: 111 EVAPVEEKPFEATPVEQKPVEDSPAEVAPVEKKPVEAAPAEAATVKEKSEER 162

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 51/119 (42%), Positives = 61/119 (51%), Gaps = 7/119 (5%)
 Frame = +1

Query: 1    QEKP----PVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 165
            +EKP    PV   PVE KP V   PVE  PV   PVE+ PV   PVE+ PV   PVE+  
Sbjct: 1386 EEKPVEAAPVEAAPVEEKP-VEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQ 1444

Query: 166  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVE 336
            V   PVE+ P    PVE+ PV   PVE PP  + P E+         +EKP +    VE
Sbjct: 1445 VDAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKPEERKEADSEIKKIEKPLLTDVEVE 1503

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 53/169 (31%), Positives = 66/169 (39%), Gaps = 50/169 (29%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP- 180
            E+ PV   PVE+ PV   PVE+  V   PVE+ P    PVE+ PV   PVE PP  + P 
Sbjct: 1211 EEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKPE 1270

Query: 181  -------------------------------------------------VEKPPVYKPPV 213
                                                              E+ PV   PV
Sbjct: 1271 ERKEADSEIKKIETPLLTDVEVXXXXLDLLMESSEFIEGNISRIPQISVTEEKPVEAAPV 1330

Query: 214  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E+ PV   PVE+ PV   PVE+  V   PVE   V + PV+  PV + P
Sbjct: 1331 EEEPVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENP 1379

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 54/170 (31%), Positives = 65/170 (38%), Gaps = 55/170 (32%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--- 174
            E+ PV   PVE+ PV    VE  PV + PVE  PV + PVE   V   PVE+ P  +   
Sbjct: 1666 EEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEGAQVEAAPVEEKPEERREA 1725

Query: 175  ----PPVEKP------------------------------------------------PV 198
                  +EKP                                                PV
Sbjct: 1726 DSEIKKIEKPLLTDVEVELVFSKAETFSGLELDLLMESSEFIEGNISRIPQISVTEEKPV 1785

Query: 199  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PVE+ PV   PVE  PV + PVE   V   PVE+ PV   PVE+ PV
Sbjct: 1786 EAAPVEEKPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPV 1835

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 51/161 (31%), Positives = 62/161 (38%), Gaps = 50/161 (31%)
 Frame = +1

Query: 28   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 207
            PVE  PV + PVE   V + PVE  PV + PVE  PV   PVE+ PV    VE  PV + 
Sbjct: 1544 PVEAAPVERKPVEAALVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVDAAQVEAAPVAEK 1603

Query: 208  P------------VEKPPVYKPPV------------------------------------ 243
            P            +EKP +    V                                    
Sbjct: 1604 PEERREADSEIKKIEKPLLTDVEVELVFSKAETFSGLELDLLMESSEFIEGNFSRIPQIS 1663

Query: 244  --EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
              E+ PV   PVE+ PV    VE  PV + PVE  PV + P
Sbjct: 1664 VTEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKP 1704

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 51/154 (33%), Positives = 67/154 (43%), Gaps = 34/154 (22%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVE-- 156
            +EKP    PV + PVE  PV + PVE  PV + P E+         +EKP +    VE  
Sbjct: 1116 EEKPVEAAPVEEKPVEAAPVEEKPVEAAPVERKPEERKEADTVIKKIEKPLLTDLEVELV 1175

Query: 157  --KPPVYK---------------------PPV---EKPPVYKPPVEKPPVYKPPVEKPPV 258
              K  ++                      P +   E+ PV   PVE+ PV   PVE+  V
Sbjct: 1176 FSKAEIFYGLELDLLMESSEFIEGNISRIPQISLTEEKPVEAAPVEEKPVEAAPVEEKQV 1235

Query: 259  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
               PVE+ P    PVE+ PV   PVE PP  + P
Sbjct: 1236 DAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKP 1269

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 43/130 (33%), Positives = 59/130 (45%), Gaps = 16/130 (12%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-------PPVEKPPVYKPPVE-- 156
            E+ PV   PVE+ PV   PVE+ PV   PVE+ P  +         +EKP +    VE  
Sbjct: 1021 EEKPVEAAPVEEKPVEAAPVEEKPVEAAPVERKPEERKEADTVIKKIEKPLLTDVEVELV 1080

Query: 157  --KPPVY-----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
              K  ++        +E     +  + + P      EK PV   PVE+ PV   PVE+ P
Sbjct: 1081 FSKAEIFYGLELDLLMESSEFIEGNISRIPQISLTEEK-PVEAAPVEEKPVEAAPVEEKP 1139

Query: 316  VYKPPVEKPP 345
            V   PVE+ P
Sbjct: 1140 VEAAPVERKP 1149

[104][TOP]
>UniRef100_Q27409 Adhesive plaque matrix protein n=1 Tax=Mytilus galloprovincialis
           RepID=FP1_MYTGA
          Length = 751

 Score =  110 bits (276), Expect = 4e-23
 Identities = 53/116 (45%), Positives = 55/116 (47%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYKP +  PP YKP    PP YKP    P  YK     P  YKP    PP YKP +  
Sbjct: 106 PPVYKPKMTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPTYKPKLTY 165

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YKP    PP YKP    P  YK     PP YK     P  YKP    P  YKP
Sbjct: 166 PPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTYPSTYKP 221

 Score =  108 bits (271), Expect = 1e-22
 Identities = 51/115 (44%), Positives = 54/115 (46%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YKP    P  YK     PP YK     P  YKP    
Sbjct: 156 PPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTY 215

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  YKP V  PP YK     PP+YK     P  YKP    P  YKP +  PP YK
Sbjct: 216 PSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTYPSTYKPKISYPPTYK 270

 Score =  105 bits (262), Expect = 2e-21
 Identities = 51/116 (43%), Positives = 53/116 (45%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YKP    PP YKP +  PP YKP    PP YKP    P  YK     PP YK     
Sbjct: 146 PSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTY 205

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P  YKP    P  YKP V  PP YK     PP+YK     P  YKP    P  YKP
Sbjct: 206 PSSYKPKKTYPSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTYPSTYKP 261

 Score =  104 bits (260), Expect = 3e-21
 Identities = 50/113 (44%), Positives = 52/113 (46%)
 Frame = +1

Query: 19  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 198
           Y      PPVYKP +  PP YKP    PP YKP    P  YK     P  YKP    PP 
Sbjct: 99  YNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPT 158

Query: 199 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           YKP +  PP YKP    PP YKP    P  YK     PP YK     P  YKP
Sbjct: 159 YKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKP 211

 Score =  103 bits (258), Expect = 5e-21
 Identities = 51/119 (42%), Positives = 53/119 (44%), Gaps = 4/119 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPPVYKP 177
           PP YK     PP YK     PP YK     PP YK     P   P  YK     PP YK 
Sbjct: 616 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKAKPSYPPTYKA 675

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
               PP YKP    PP YK     P  YKP    PP YKP +  PP+YKP    PP YK
Sbjct: 676 KPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPIYKPKPSYPPTYK 734

 Score =  101 bits (252), Expect = 2e-20
 Identities = 48/115 (41%), Positives = 51/115 (44%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YKP    PP YKP +  PP YK     PP+YK     PP YK     
Sbjct: 336 PPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSY 395

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
            P YK     PP YK     P  YK     PP YK     PP YK  +  PP YK
Sbjct: 396 LPTYKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYK 450

 Score =  101 bits (252), Expect = 2e-20
 Identities = 48/115 (41%), Positives = 51/115 (44%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP    PP YKP +  PP YK     PP+YK     PP YK      P YK     
Sbjct: 346 PPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSY 405

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     P  YK     PP YK     PP YK  +  PP YK     PP YK
Sbjct: 406 PPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYK 460

 Score =  100 bits (249), Expect = 5e-20
 Identities = 48/115 (41%), Positives = 50/115 (43%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK     PP YKP    PP YKP +  PP YK     PP+YK     
Sbjct: 326 PPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSY 385

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK      P YK     PP YK     P  YK     PP YK     PP YK
Sbjct: 386 PPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYK 440

 Score =  100 bits (248), Expect = 7e-20
 Identities = 48/115 (41%), Positives = 50/115 (43%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK     P  YK     PP YK     PP YK     PP YKP    
Sbjct: 296 PPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTY 355

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP +  PP YK     PP+YK     PP YK      P YK     PP YK
Sbjct: 356 PPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYK 410

 Score =  100 bits (248), Expect = 7e-20
 Identities = 54/140 (38%), Positives = 56/140 (40%), Gaps = 24/140 (17%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 174
            PP YK     PP YK     PP YK     PP YK     PP YK     PP YK     
Sbjct: 586  PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 645

Query: 175  PPVEK-------------------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 297
            PP  K                   PP YK     PP YKP    PP YK     P  YKP
Sbjct: 646  PPTYKAKPSYPATYPSTYKAKPSYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKP 705

Query: 298  PVEKPPVYKPPVEKPPVYKP 357
                PP YKP +  PP+YKP
Sbjct: 706  KKTYPPTYKPKLTYPPIYKP 725

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 47/115 (40%), Positives = 50/115 (43%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YK     PP+YK     PP YK      P YK     PP YK     
Sbjct: 356 PPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRY 415

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  YK     PP YK     PP YK  +  PP YK     PP YK     PP YK
Sbjct: 416 PTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYK 470

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 51/119 (42%), Positives = 53/119 (44%), Gaps = 4/119 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           PP YK     PP YK     PP YK     P   P  YK     PP YK     PP YKP
Sbjct: 626 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKAKPSYPPTYKAKPSYPPTYKP 685

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
               PP YK     P  YKP    PP YKP +  PP+YKP    PP YK     PP YK
Sbjct: 686 KPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPIYKPKPSYPPTYKS--SYPPRYK 742

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 47/115 (40%), Positives = 49/115 (42%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YK     PP YK     PP YKP    PP YKP +  PP YK     
Sbjct: 316 PSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSY 375

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP+YK     PP YK      P YK     PP YK     P  YK     PP YK
Sbjct: 376 PPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYK 430

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 47/115 (40%), Positives = 49/115 (42%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YK     PP YK     P  YK     PP YK     PP YK     
Sbjct: 286 PSTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSY 345

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP    PP YKP +  PP YK     PP+YK     PP YK      P YK
Sbjct: 346 PPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYK 400

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 47/115 (40%), Positives = 49/115 (42%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     P  YK     PP YK     PP YK     PP YKP    PP YKP +  
Sbjct: 306 PPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISY 365

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP+YK     PP YK      P YK     PP YK     P  YK
Sbjct: 366 PPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTTYK 420

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 49/119 (41%), Positives = 49/119 (41%), Gaps = 4/119 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK     PP YK     PP YK     PP YK     PP YK     
Sbjct: 576 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 635

Query: 190 PPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     P   P  YK     PP YK     PP YKP    PP YK
Sbjct: 636 PPTYKAKPSYPPTYKAKPSYPATYPSTYKAKPSYPPTYKAKPSYPPTYKPKPSYPPTYK 694

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 46/115 (40%), Positives = 49/115 (42%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YKP +  PP YK     P  Y+     P  YK     PP YK     PP YK     
Sbjct: 256 PSTYKPKISYPPTYKAKPSYPTSYRAKPSYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTY 315

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  YK     PP YK     PP YK     PP YKP    PP YKP +  PP YK
Sbjct: 316 PSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYK 370

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 49/120 (40%), Positives = 49/120 (40%), Gaps = 4/120 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK     PP YK     PP YK     PP YK     PP YK     
Sbjct: 566 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 625

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YK     PP YK     PP YK     P   P  YK     PP YK     PP YKP
Sbjct: 626 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKAKPSYPPTYKAKPSYPPTYKP 685

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 47/115 (40%), Positives = 47/115 (40%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK     PP YK     PP YK     PP YK     P  YK     
Sbjct: 506 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSY 565

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     PP YK     PP YK     PP YK     PP YK
Sbjct: 566 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 620

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 47/115 (40%), Positives = 47/115 (40%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK     PP YK     PP YK     P  YK     PP YK     
Sbjct: 516 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSY 575

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     PP YK     PP YK     PP YK     PP YK
Sbjct: 576 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 630

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 47/115 (40%), Positives = 47/115 (40%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK     PP YK     P  YK     PP YK     PP YK     
Sbjct: 526 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSY 585

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     PP YK     PP YK     PP YK     PP YK
Sbjct: 586 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 640

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 47/115 (40%), Positives = 47/115 (40%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK     P  YK     PP YK     PP YK     PP YK     
Sbjct: 536 PPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 595

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     PP YK     PP YK     PP YK     PP YK
Sbjct: 596 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 650

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 49/118 (41%), Positives = 52/118 (44%), Gaps = 4/118 (3%)
 Frame = +1

Query: 13  PVYKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           P Y P  +     P  YK     P  YKP    PP YKP +  PP YKP    PP YKP 
Sbjct: 123 PSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPK 182

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
              P  YK     PP YK     P  YKP    P  YKP V  PP YK     PP+YK
Sbjct: 183 PSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTYPSTYKPKVSYPPTYKSKKSYPPIYK 240

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 46/115 (40%), Positives = 49/115 (42%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     P  Y+     P  YK     PP YK     PP YK     P  YK     
Sbjct: 266 PPTYKAKPSYPTSYRAKPSYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSY 325

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     PP YKP    PP YKP +  PP YK     PP+YK
Sbjct: 326 PPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYK 380

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 46/115 (40%), Positives = 49/115 (42%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  Y+     P  YK     PP YK     PP YK     P  YK     PP YK     
Sbjct: 276 PTSYRAKPSYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKAKPSY 335

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YKP    PP YKP +  PP YK     PP+YK     PP YK
Sbjct: 336 PPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYK 390

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/126 (40%), Positives = 52/126 (41%), Gaps = 9/126 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP----PVEKPPVYKP 177
           PP YK     PP YK     PP YK     PP YK     PP YK     P   P  YK 
Sbjct: 606 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKA 665

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKP 342
               PP YK     PP YKP    PP YK     P  YKP    PP YKP     P+ KP
Sbjct: 666 KPSYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPIYKP 725

Query: 343 PVYKPP 360
               PP
Sbjct: 726 KPSYPP 731

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 46/115 (40%), Positives = 48/115 (41%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP+YK     PP YK      P YK     PP YK     P  YK     
Sbjct: 366 PPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTTYKAKPSY 425

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK  +  PP YK     PP YK     PP YK     PP YK
Sbjct: 426 PPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 480

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 53/146 (36%), Positives = 55/146 (37%), Gaps = 30/146 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 174
           P  YKP V  PP YK     PP+YK     P  YKP    P  YKP +  PP YK     
Sbjct: 216 PSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTYPSTYKPKISYPPTYKAKPSY 275

Query: 175 --------------------PPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 279
                               PP  K     PP YK     P  YK     PP YK     
Sbjct: 276 PTSYRAKPSYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKAKPSY 335

Query: 280 PPVYKPPVEKPPVYKPPVEKPPVYKP 357
           PP YK     PP YKP    PP YKP
Sbjct: 336 PPTYKAKPSYPPSYKPKTTYPPSYKP 361

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 46/115 (40%), Positives = 49/115 (42%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     P  YKP    P  YKP V  PP YK     PP+YK     P  YKP    
Sbjct: 196 PPSYKTKKTYPSSYKPKKTYPSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTY 255

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  YKP +  PP YK     P  Y+     P  YK     PP YK     PP YK
Sbjct: 256 PSTYKPKISYPPTYKAKPSYPTSYRAKPSYPSTYKAKPSYPPTYKAKPSYPPTYK 310

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 45/115 (39%), Positives = 48/115 (41%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YKP    P  YKP V  PP YK     PP+YK     P  YKP    P  YKP +  
Sbjct: 206 PSSYKPKKTYPSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTYPSTYKPKISY 265

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     P  Y+     P  YK     PP YK     PP YK     P  YK
Sbjct: 266 PPTYKAKPSYPTSYRAKPSYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYK 320

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 50/135 (37%), Positives = 53/135 (39%), Gaps = 20/135 (14%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK---------------PPVYKPPVEK 129
           PP YKP    PP YKP    P  YK     PP  K               P  YKP V  
Sbjct: 166 PPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTYPSTYKPKVSY 225

Query: 130 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 309
           PP YK     PP+YK     P  YKP    P  YKP +  PP YK     P  Y+     
Sbjct: 226 PPTYKSKKSYPPIYKTKASYPSSYKPKKTYPSTYKPKISYPPTYKAKPSYPTSYRAKPSY 285

Query: 310 PPVYKPPVEKPPVYK 354
           P  YK     PP YK
Sbjct: 286 PSTYKAKPSYPPTYK 300

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 45/115 (39%), Positives = 47/115 (40%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+YK     PP YK      P YK     PP YK     P  YK     PP YK     
Sbjct: 376 PPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYKAKPSY 435

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK  +  PP YK     PP YK     PP YK     PP YK     P  YK
Sbjct: 436 PPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYK 490

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 45/114 (39%), Positives = 45/114 (39%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     P  YK     PP YK     PP YK     PP YK     PP YK     
Sbjct: 546 PPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 605

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           PP YK     PP YK     PP YK     PP YK     PP YK     P  Y
Sbjct: 606 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATY 659

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 45/115 (39%), Positives = 46/115 (40%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK  +  PP YK     PP YK     PP YK     PP YK     
Sbjct: 426 PPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKTKPSY 485

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  YK        YK     PP YK     PP YK     PP YK     PP YK
Sbjct: 486 PRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 540

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 45/115 (39%), Positives = 46/115 (40%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK  +  PP YK     PP YK     PP YK     PP YK     P  YK     
Sbjct: 436 PPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYKAKPSY 495

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
              YK     PP YK     PP YK     PP YK     PP YK     PP YK
Sbjct: 496 SSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 550

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 45/112 (40%), Positives = 45/112 (40%)
 Frame = +1

Query: 19  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 198
           YK     PP YK     PP YK     PP YK     PP YK     PP YK     P  
Sbjct: 499 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQT 558

Query: 199 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           YK     PP YK     PP YK     PP YK     PP YK     PP YK
Sbjct: 559 YKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 610

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 47/119 (39%), Positives = 47/119 (39%), Gaps = 4/119 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YK     PP YK     PP YK     PP YK     PP YK     
Sbjct: 556 PQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 615

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     PP YK     PP YK     P   P  YK     PP YK
Sbjct: 616 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKAKPSYPPTYK 674

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 49/119 (41%), Positives = 51/119 (42%), Gaps = 7/119 (5%)
 Frame = +1

Query: 19  YKPPVEKPPVYKP--PVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKP 177
           Y P  +K   YKP           PPV KP     P YKP    PP YKP    P  YK 
Sbjct: 82  YLPLAKKLSSYKPIKTTYNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYKPKPSYPATYKS 141

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
               P  YKP    PP YKP +  PP YKP    PP YKP    P  YK     PP YK
Sbjct: 142 KSSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYK 200

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 44/115 (38%), Positives = 45/115 (39%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     P  YK     PP YK     PP YK  +  PP YK     PP YK     
Sbjct: 406 PPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKAKPSY 465

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     P  YK        YK     PP YK     PP YK
Sbjct: 466 PPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYK 520

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 44/115 (38%), Positives = 45/115 (39%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YK     PP YK  +  PP YK     PP YK     PP YK     
Sbjct: 416 PTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 475

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     P  YK        YK     PP YK     PP YK     PP YK
Sbjct: 476 PPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 530

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 45/108 (41%), Positives = 48/108 (44%), Gaps = 4/108 (3%)
 Frame = +1

Query: 10  PPVYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           PP YK     P   P  YK     PP YK     PP YKP    PP YK     P  YKP
Sbjct: 646 PPTYKAKPSYPATYPSTYKAKPSYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKP 705

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 321
               PP YKP +  PP+YKP    PP YK     PP YK  +  P  Y
Sbjct: 706 KKTYPPTYKPKLTYPPIYKPKPSYPPTYKS--SYPPRYKKKISYPSQY 751

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 44/115 (38%), Positives = 44/115 (38%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK     PP YK     PP YK     P  YK        YK     
Sbjct: 446 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSY 505

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     PP YK     PP YK     PP YK     P  YK
Sbjct: 506 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYK 560

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 44/115 (38%), Positives = 44/115 (38%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK     PP YK     P  YK        YK     PP YK     
Sbjct: 456 PPTYKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSY 515

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     PP YK     PP YK     P  YK     PP YK
Sbjct: 516 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYK 570

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 44/115 (38%), Positives = 44/115 (38%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK     P  YK        YK     PP YK     PP YK     
Sbjct: 466 PPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSY 525

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     PP YK     P  YK     PP YK     PP YK
Sbjct: 526 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYK 580

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 44/115 (38%), Positives = 44/115 (38%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     P  YK        YK     PP YK     PP YK     PP YK     
Sbjct: 476 PPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 535

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     P  YK     PP YK     PP YK     PP YK
Sbjct: 536 PPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYK 590

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 44/115 (38%), Positives = 44/115 (38%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK        YK     PP YK     PP YK     PP YK     PP YK     
Sbjct: 486 PRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 545

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     P  YK     PP YK     PP YK     PP YK     PP YK
Sbjct: 546 PPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 600

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 43/114 (37%), Positives = 44/114 (38%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P YK     PP YK     P  YK     PP YK     PP YK  +  PP YK     P
Sbjct: 397 PTYKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYP 456

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P YK     PP YK     PP YK     P  YK        YK     PP YK
Sbjct: 457 PTYKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYK 510

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 51/128 (39%), Positives = 53/128 (41%), Gaps = 13/128 (10%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYK------PPVEKPPVYKP--PVEKPPVYKPPVEKP-- 162
           PVYKP       Y P    PP Y       P  +K   YKP           PPV KP  
Sbjct: 57  PVYKPVKTS---YHPTNSYPPTYGSKTNYLPLAKKLSSYKPIKTTYNAKTNYPPVYKPKM 113

Query: 163 ---PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 333
              P YKP    PP YKP    P  YK     P  YKP    PP YKP +  PP YKP  
Sbjct: 114 TYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPTYKPKLTYPPTYKPKP 173

Query: 334 EKPPVYKP 357
             PP YKP
Sbjct: 174 SYPPTYKP 181

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 44/123 (35%), Positives = 46/123 (37%), Gaps = 7/123 (5%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP--PV 183
           P  Y    +  PVYKP       Y P    PP Y         Y P  +K   YKP    
Sbjct: 46  PNAYPYGTKHGPVYKPVKTS---YHPTNSYPPTYGSKTN----YLPLAKKLSSYKPIKTT 98

Query: 184 EKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
                  PPV KP     P YKP    PP YKP    P  YK     P  YKP    PP 
Sbjct: 99  YNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPT 158

Query: 349 YKP 357
           YKP
Sbjct: 159 YKP 161

[105][TOP]
>UniRef100_C0E650 Putative uncharacterized protein n=1 Tax=Corynebacterium matruchotii
            ATCC 33806 RepID=C0E650_9CORY
          Length = 1035

 Score =  110 bits (275), Expect = 5e-23
 Identities = 57/126 (45%), Positives = 63/126 (50%), Gaps = 10/126 (7%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYK-------PPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            PP    P  +PPV +PP    P          P    P    P   +PPV KPP   PP 
Sbjct: 895  PPKAALPKAQPPVARPPTATAPAVPAAPGGSVPKTVAPGAAIPGTARPPVAKPPAPTPPT 954

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
             KPP   PPV KPP   PP   PP  +P   PV KPP  KPPV +PPV KPPV KPP+ K
Sbjct: 955  AKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVAKPPVAKPPMAK 1014

Query: 340  PPVYKP 357
            PP   P
Sbjct: 1015 PPTIPP 1020

 Score =  106 bits (265), Expect = 7e-22
 Identities = 54/117 (46%), Positives = 60/117 (51%), Gaps = 10/117 (8%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYK-------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 165
            +PPV +PP    P          P    P    P   +PPV KPP   PP  KPP   PP
Sbjct: 904  QPPVARPPTATAPAVPAAPGGSVPKTVAPGAAIPGTARPPVAKPPAPTPPTAKPPAAAPP 963

Query: 166  VYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 327
            V KPP   PP   PP  +P   PV KPP  KPPV +PPV KPPV KPP+ KPP   P
Sbjct: 964  VAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVAKPPVAKPPMAKPPTIPP 1020

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 55/137 (40%), Positives = 60/137 (43%), Gaps = 20/137 (14%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPV 183
            P    PP    P   PP    P  +PPV +PP    P     P    P    P    P  
Sbjct: 880  PGSVAPPAAATPKATPPKAALPKAQPPVARPPTATAPAVPAAPGGSVPKTVAPGAAIPGT 939

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKP------------------PVEKPPVYKPPVEK 309
             +PPV KPP   PP  KPP   PPV KP                  PV KPP  KPPV +
Sbjct: 940  ARPPVAKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQ 999

Query: 310  PPVYKPPVEKPPVYKPP 360
            PPV KPPV KPP+ KPP
Sbjct: 1000 PPVAKPPVAKPPMAKPP 1016

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 55/163 (33%), Positives = 60/163 (36%), Gaps = 46/163 (28%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            P    PP   PP  +     PP    P    P    PP    P   PP    P  +PPV 
Sbjct: 849  PGAVIPPAATPPGARLATPTPPGTAVPGAAAPGSVAPPAAATPKATPPKAALPKAQPPVA 908

Query: 187  KPP---------------------------VYKPPVEKPPVYKPPVEKPPVYKPPVEKP- 282
            +PP                             +PPV KPP   PP  KPP   PPV KP 
Sbjct: 909  RPPTATAPAVPAAPGGSVPKTVAPGAAIPGTARPPVAKPPAPTPPTAKPPAAAPPVAKPP 968

Query: 283  -----------------PVYKPPVEKPPVYKPPVEKPPVYKPP 360
                             PV KPP  KPPV +PPV KPPV KPP
Sbjct: 969  TATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVAKPPVAKPP 1011

[106][TOP]
>UniRef100_Q9SET1 Cell wall-plasma membrane linker protein homolog n=1
           Tax=Arabidopsis thaliana RepID=Q9SET1_ARATH
          Length = 306

 Score =  110 bits (275), Expect = 5e-23
 Identities = 62/155 (40%), Positives = 66/155 (42%), Gaps = 37/155 (23%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKP---------PVEKPPVYKPPVEKPP-VYKPPVE---------- 126
           KPP  KPP  KPP  KP         P  KPP+ KPP + PP   KPP +          
Sbjct: 56  KPPAVKPPTPKPPTVKPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPSPSTPKPST 115

Query: 127 --------KPPVYKP---------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 255
                   KPP +KP         P   PPV  PP    PV  PP   PPV  P    PP
Sbjct: 116 TKPPPSTPKPPHHKPSPTPCPPPTPTPTPPVVTPPTPTHPVITPPTPTPPVVTPATPTPP 175

Query: 256 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           V  PP   PPV  PP   PPV  PP   PPV  PP
Sbjct: 176 VITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPP 210

 Score =  106 bits (265), Expect = 7e-22
 Identities = 58/135 (42%), Positives = 62/135 (45%), Gaps = 18/135 (13%)
 Frame = +1

Query: 7   KPPVYKPPVEKPP-VYKPPVE------KPPVYKPP--VEKPPVYKP---------PVEKP 132
           KPP+ KPP + PP   KPP +      KP   KPP    KPP +KP         P   P
Sbjct: 85  KPPIVKPPTKPPPSTPKPPTKPSPSTPKPSTTKPPPSTPKPPHHKPSPTPCPPPTPTPTP 144

Query: 133 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 312
           PV  PP    PV  PP   PPV  P    PPV  PP   PPV  PP   PPV  PP   P
Sbjct: 145 PVVTPPTPTHPVITPPTPTPPVVTPATPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTP 204

Query: 313 PVYKPPVEKPPVYKP 357
           PV  PP   PP   P
Sbjct: 205 PVVTPPTPTPPTPIP 219

 Score =  102 bits (255), Expect = 1e-20
 Identities = 61/155 (39%), Positives = 66/155 (42%), Gaps = 37/155 (23%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---------PVEKPPVYKPPVEK 159
           KPP +     KPP  KPP  KPP  KPP  KPP  KP         P  KPP+ KPP + 
Sbjct: 38  KPPKHPVKPPKPPAVKPP--KPPAVKPPTPKPPTVKPHPKPPTKPHPHPKPPIVKPPTKP 95

Query: 160 PP-VYKPPVE------------------KPPVYKP---------PVEKPPVYKPPVEKPP 255
           PP   KPP +                  KPP +KP         P   PPV  PP    P
Sbjct: 96  PPSTPKPPTKPSPSTPKPSTTKPPPSTPKPPHHKPSPTPCPPPTPTPTPPVVTPPTPTHP 155

Query: 256 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           V  PP   PPV  P    PPV  PP   PPV  PP
Sbjct: 156 VITPPTPTPPVVTPATPTPPVITPPTPTPPVITPP 190

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 59/154 (38%), Positives = 64/154 (41%), Gaps = 37/154 (24%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---------PVEKP 162
           PP   P   KPP +     KPP  KPP  KPP  KPP  KPP  KP         P  KP
Sbjct: 29  PPKPSPAPHKPPKHPVKPPKPPAVKPP--KPPAVKPPTPKPPTVKPHPKPPTKPHPHPKP 86

Query: 163 PVYKPPVEKPP-VYKPPVE------------------KPPVYKP---------PVEKPPV 258
           P+ KPP + PP   KPP +                  KPP +KP         P   PPV
Sbjct: 87  PIVKPPTKPPPSTPKPPTKPSPSTPKPSTTKPPPSTPKPPHHKPSPTPCPPPTPTPTPPV 146

Query: 259 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PP    PV  PP   PPV  P    PPV  PP
Sbjct: 147 VTPPTPTHPVITPPTPTPPVVTPATPTPPVITPP 180

[107][TOP]
>UniRef100_P13983 Extensin n=1 Tax=Nicotiana tabacum RepID=EXTN_TOBAC
          Length = 620

 Score =  110 bits (275), Expect = 5e-23
 Identities = 56/117 (47%), Positives = 58/117 (49%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP Y+     PP Y PP+  PP Y PP   PP Y PP   PP Y  P   PP Y PP   
Sbjct: 386 PPTYEQSPPPPPAYSPPLPAPPTYSPP---PPTYSPP---PPTYAQPPPLPPTYSPP--- 436

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP Y PP   PP Y PP   PP Y PP   PP Y  P   PP Y PP   PP Y PP
Sbjct: 437 PPAYSPP--PPPTYSPP---PPTYSPP---PPAYAQPPPPPPTYSPP---PPAYSPP 482

 Score =  110 bits (275), Expect = 5e-23
 Identities = 57/117 (48%), Positives = 59/117 (50%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP Y PP+  PP Y PP   PP Y PP   PP Y  P   PP Y PP   PP Y PP   
Sbjct: 396 PPAYSPPLPAPPTYSPP---PPTYSPP---PPTYAQPPPLPPTYSPP---PPAYSPP--P 444

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP Y PP   PP Y PP   PP Y  P   PP Y PP   PP Y PP    P+Y PP
Sbjct: 445 PPTYSPP---PPTYSPP---PPAYAQPPPPPPTYSPP---PPAYSPP-PPSPIYSPP 491

 Score =  108 bits (269), Expect = 2e-22
 Identities = 55/117 (47%), Positives = 58/117 (49%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP + PP   PP Y+     PP Y PP+  PP Y PP   PP Y PP   PP Y  P   
Sbjct: 379 PPSFSPP---PPTYEQSPPPPPAYSPPLPAPPTYSPP---PPTYSPP---PPTYAQPPPL 429

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP Y PP   PP Y PP   PP Y PP   PP Y PP   PP Y  P   PP Y PP
Sbjct: 430 PPTYSPP---PPAYSPP--PPPTYSPP---PPTYSPP---PPAYAQPPPPPPTYSPP 475

 Score =  105 bits (262), Expect = 2e-21
 Identities = 58/128 (45%), Positives = 60/128 (46%), Gaps = 11/128 (8%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----------PPVYKPPVEKPPVYKPPVE 156
           PPVY PP   PP Y PP   PP Y PP              PP Y+     PP Y PP+ 
Sbjct: 350 PPVYSPP--PPPSYSPP---PPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLP 404

Query: 157 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
            PP Y PP   PP Y PP   PP Y  P   PP Y PP   PP Y PP   PP Y PP  
Sbjct: 405 APPTYSPP---PPTYSPP---PPTYAQPPPLPPTYSPP---PPAYSPP--PPPTYSPP-- 451

Query: 337 KPPVYKPP 360
            PP Y PP
Sbjct: 452 -PPTYSPP 458

 Score =  101 bits (251), Expect = 3e-20
 Identities = 55/121 (45%), Positives = 60/121 (49%), Gaps = 4/121 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP----VEKPPVYKP 177
           PP Y P +   P+Y PP   PPVY PP   PP Y PP   PP Y PP       PP + P
Sbjct: 334 PPTYLP-LPSSPIYSPP---PPVYSPP--PPPSYSPP---PPTYLPPPPPSSPPPPSFSP 384

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P   PP Y+     PP Y PP+  PP Y PP   PP Y PP   PP Y  P   PP Y P
Sbjct: 385 P---PPTYEQSPPPPPAYSPPLPAPPTYSPP---PPTYSPP---PPTYAQPPPLPPTYSP 435

Query: 358 P 360
           P
Sbjct: 436 P 436

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 55/123 (44%), Positives = 59/123 (47%), Gaps = 6/123 (4%)
 Frame = +1

Query: 10  PPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PP+  PP     PP Y PP   PP Y  P   PP Y PP   PP Y PP   PP Y PP 
Sbjct: 401 PPLPAPPTYSPPPPTYSPP---PPTYAQPPPLPPTYSPP---PPAYSPP--PPPTYSPP- 451

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVY 351
             PP Y PP   PP Y  P   PP Y PP   PP Y PP    P+Y PP  +    PP +
Sbjct: 452 --PPTYSPP---PPAYAQPPPPPPTYSPP---PPAYSPP-PPSPIYSPPPPQVQPLPPTF 502

Query: 352 KPP 360
            PP
Sbjct: 503 SPP 505

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 52/126 (41%), Positives = 58/126 (46%), Gaps = 9/126 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP Y  P   PP Y PP   PP Y PP   PP Y PP   PP Y PP   PP Y  P   
Sbjct: 420 PPTYAQPPPLPPTYSPP---PPAYSPP--PPPTYSPP---PPTYSPP---PPAYAQPPPP 468

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPPVEK-----PPVYKPPVEKP 342
           PP Y PP   PP Y PP    P+Y PP  +    PP + PP  +     PP ++ P    
Sbjct: 469 PPTYSPP---PPAYSPP-PPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPT 524

Query: 343 PVYKPP 360
           P Y  P
Sbjct: 525 PTYGQP 530

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 52/126 (41%), Positives = 59/126 (46%), Gaps = 9/126 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP Y PP   PP Y PP   PP Y PP   PP Y PP   PP Y  P   PP Y PP   
Sbjct: 430 PPTYSPP---PPAYSPP--PPPTYSPP---PPTYSPP---PPAYAQPPPPPPTYSPP--- 475

Query: 190 PPVYKPPVEKPPVYKPPVEK----PPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKP 342
           PP Y PP   P +Y PP  +    PP + PP  +     PP ++ P    P Y  P   P
Sbjct: 476 PPAYSPPPPSP-IYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQP-PSP 533

Query: 343 PVYKPP 360
           P + PP
Sbjct: 534 PTFSPP 539

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 56/132 (42%), Positives = 62/132 (46%), Gaps = 12/132 (9%)
 Frame = +1

Query: 1   QEKPPVYKPPV-------EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPV 153
           Q +PP Y PP        +  P Y PP   PP Y PP   P +Y PP   PP Y   PP 
Sbjct: 259 QPQPPTYSPPPPAYAQSPQPSPTYSPP---PPTYSPPPPSP-IYSPP---PPAYSPSPPP 311

Query: 154 EKPPVYKPP---VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 324
              P + PP      PP Y PP   PP Y  P+   P+Y PP   PPVY PP   PP Y 
Sbjct: 312 TPTPTFSPPPPAYSPPPTYSPP---PPTYL-PLPSSPIYSPP---PPVYSPP--PPPSYS 362

Query: 325 PPVEKPPVYKPP 360
           PP   PP Y PP
Sbjct: 363 PP---PPTYLPP 371

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 44/145 (30%), Positives = 57/145 (39%), Gaps = 28/145 (19%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPPVEK-----PPVYKPPVEKP 162
           PP Y PP   PP Y PP   P +Y PP  +    PP + PP  +     PP ++ P    
Sbjct: 469 PPTYSPP---PPAYSPPPPSP-IYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPT 524

Query: 163 PVYKPPVEKPPVYKPPVEK------PPVYKPPVEKPPVYKPPV-------------EKPP 285
           P Y  P   PP + PP  +      PP ++P    P   +PP                PP
Sbjct: 525 PTYGQP-PSPPTFSPPPPRQIHSPPPPHWQPRTPTPTYGQPPSPPTFSAPPPRQIHSPPP 583

Query: 286 VYKPPVEKPPVYKPPVEKPPVYKPP 360
            ++ P    P Y  P   P  Y PP
Sbjct: 584 PHRQPRPPTPTYGQPPSPPTTYSPP 608

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 46/141 (32%), Positives = 57/141 (40%), Gaps = 24/141 (17%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV------- 168
           PP Y  P    P+Y P         P V+ PP Y PP   PP +  P   PP        
Sbjct: 180 PPTYAQP-PPTPIYSP--------SPQVQPPPTYSPP---PPTHVQPTPSPPSRGHQPQP 227

Query: 169 ----YKPPVEK--PPVYKP-PVE----------KPPVYKPPVEKPPVYKPPVEKPPVYKP 297
               + PP  +  PP ++P P+           +PP Y PP   PP Y    +  P Y P
Sbjct: 228 PTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTYSPP---PPAYAQSPQPSPTYSP 284

Query: 298 PVEKPPVYKPPVEKPPVYKPP 360
           P   PP Y PP    P+Y PP
Sbjct: 285 P---PPTYSPP-PPSPIYSPP 301

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 46/145 (31%), Positives = 59/145 (40%), Gaps = 26/145 (17%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP--VEKPPVYKPPVEKPPVYKP 177
           + PP ++ P        PP   PP Y  P    P+Y P   V+ PP Y PP   PP +  
Sbjct: 161 QHPPSHRRPSPPSRHGHPP---PPTYAQP-PPTPIYSPSPQVQPPPTYSPP---PPTHVQ 213

Query: 178 PVEKPPV-----------YKPPVEK--PPVYKP-PVE----------KPPVYKPPVEKPP 285
           P   PP            + PP  +  PP ++P P+           +PP Y PP   PP
Sbjct: 214 PTPSPPSRGHQPQPPTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTYSPP---PP 270

Query: 286 VYKPPVEKPPVYKPPVEKPPVYKPP 360
            Y    +  P Y PP   PP Y PP
Sbjct: 271 AYAQSPQPSPTYSPP---PPTYSPP 292

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/129 (31%), Positives = 55/129 (42%), Gaps = 12/129 (9%)
 Frame = +1

Query: 1   QEKPPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEK 159
           Q  PP + PP  +     PP ++ P    P Y  P   PP + PP   PP  ++ PP   
Sbjct: 496 QPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQP-PSPPTFSPP---PPRQIHSPP--- 548

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYK 324
           PP ++P    P   +PP   PP +  P  +     PP ++ P    P Y  P   P  Y 
Sbjct: 549 PPHWQPRTPTPTYGQPP--SPPTFSAPPPRQIHSPPPPHRQPRPPTPTYGQPPSPPTTYS 606

Query: 325 PPVEKPPVY 351
           PP   PP Y
Sbjct: 607 PP--SPPPY 613

[108][TOP]
>UniRef100_Q09083 Hydroxyproline-rich glycoprotein n=1 Tax=Phaseolus vulgaris
           RepID=Q09083_PHAVU
          Length = 580

 Score =  110 bits (274), Expect = 6e-23
 Identities = 68/133 (51%), Positives = 68/133 (51%), Gaps = 18/133 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKP 162
           PPVYK     PPVYK     PPVYK     PPVYK     PPV K    PP YK P   P
Sbjct: 314 PPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPP 373

Query: 163 PVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
           P YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PP
Sbjct: 374 PPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPP 433

Query: 316 VYKPPVEKPPVYK 354
           VYK     PPVYK
Sbjct: 434 VYKYKSPPPPVYK 446

 Score =  108 bits (271), Expect = 1e-22
 Identities = 67/133 (50%), Positives = 67/133 (50%), Gaps = 18/133 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 174
           PP YK P   PP YK     PPVYK     PPVYK     PPVYK     PPVYK     
Sbjct: 294 PPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPP 353

Query: 175 PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPP 315
           PPV K    PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP
Sbjct: 354 PPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 413

Query: 316 VYKPPVEKPPVYK 354
            YK P   PPVYK
Sbjct: 414 PYKYPSPPPPVYK 426

 Score =  107 bits (268), Expect = 3e-22
 Identities = 67/133 (50%), Positives = 67/133 (50%), Gaps = 18/133 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----P 162
           PP YK     PPVYK     PPVYK     PPVYK     PPVYK     PPV K    P
Sbjct: 304 PPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPP 363

Query: 163 PVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPP 315
           P YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P   PP
Sbjct: 364 PPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPP 423

Query: 316 VYKPPVEKPPVYK 354
           VYK     PPVYK
Sbjct: 424 VYKYNSPPPPVYK 436

 Score =  107 bits (268), Expect = 3e-22
 Identities = 71/142 (50%), Positives = 71/142 (50%), Gaps = 27/142 (19%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKP 162
           PPVYK     PPVYK     PPVYK     PPV K    PP YK P   PP YK P   P
Sbjct: 324 PPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPP 383

Query: 163 PVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PP 300
           PVYK     PPV K    PP YK P   PP YK P   PPVYK     PPVYK     PP
Sbjct: 384 PVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPP 443

Query: 301 VEK----PPVYKPPVEKPPVYK 354
           V K    PP YK P   PP YK
Sbjct: 444 VYKYKSPPPPYKYPSPPPPPYK 465

 Score =  107 bits (268), Expect = 3e-22
 Identities = 71/142 (50%), Positives = 71/142 (50%), Gaps = 27/142 (19%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----P 147
           PPVYK     PPVYK     PPV K    PP YK P   PP YK P   PPVYK     P
Sbjct: 334 PPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPP 393

Query: 148 PVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPV 288
           PV K    PP YK P   PP YK P   PPVYK     PPVYK     PPV K    PP 
Sbjct: 394 PVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPP 453

Query: 289 YKPPVEKPPVYKPPVEKPPVYK 354
           YK P   PP YK     PPVYK
Sbjct: 454 YKYPSPPPPPYKYSSPPPPVYK 475

 Score =  106 bits (265), Expect = 7e-22
 Identities = 70/142 (49%), Positives = 70/142 (49%), Gaps = 27/142 (19%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKP 162
           PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P   P
Sbjct: 363 PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPP 422

Query: 163 PVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PP 300
           PVYK     PPVYK     PPV K    PP YK P   PP YK     PPVYK     PP
Sbjct: 423 PVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPP 482

Query: 301 VEK----PPVYKPPVEKPPVYK 354
           V K    PP YK P   PP YK
Sbjct: 483 VYKYKSPPPPYKYPSPPPPPYK 504

 Score =  105 bits (263), Expect = 1e-21
 Identities = 70/142 (49%), Positives = 70/142 (49%), Gaps = 27/142 (19%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 162
           PP YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     P
Sbjct: 373 PPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPP 432

Query: 163 PVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPV 288
           PVYK     PPV K    PP YK P   PP YK     PPVYK     PPV K    PP 
Sbjct: 433 PVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPP 492

Query: 289 YKPPVEKPPVYKPPVEKPPVYK 354
           YK P   PP YK     PPVYK
Sbjct: 493 YKYPSPPPPPYKYSSPPPPVYK 514

 Score =  105 bits (263), Expect = 1e-21
 Identities = 70/142 (49%), Positives = 70/142 (49%), Gaps = 27/142 (19%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKP 162
           PP YK P   PP YK P   PPVYK     PPVYK     PPV K    PP YK P   P
Sbjct: 402 PPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPP 461

Query: 163 PVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PP 300
           P YK     PPVYK     PPV K    PP YK P   PP YK     PPVYK     PP
Sbjct: 462 PPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPP 521

Query: 301 VEK----PPVYKPPVEKPPVYK 354
           V K    PP YK P   PPVYK
Sbjct: 522 VYKYKSPPPPYKYPSPPPPVYK 543

 Score =  105 bits (262), Expect = 2e-21
 Identities = 70/144 (48%), Positives = 71/144 (49%), Gaps = 27/144 (18%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----P 147
           PPVYK     PPVYK     PPV K    PP YK P   PP YK     PPVYK     P
Sbjct: 422 PPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPP 481

Query: 148 PVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPV 288
           PV K    PP YK P   PP YK     PPVYK     PPV K    PP YK P   PPV
Sbjct: 482 PVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPV 541

Query: 289 YKPPVEKPPVYKPPVEKPPVYKPP 360
           YK     PPVYK     PPV+ PP
Sbjct: 542 YKYKSPPPPVYKYNSPPPPVHSPP 565

 Score =  105 bits (261), Expect = 2e-21
 Identities = 70/142 (49%), Positives = 70/142 (49%), Gaps = 27/142 (19%)
 Frame = +1

Query: 10  PPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----P 147
           PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PPVYK     P
Sbjct: 383 PPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPP 442

Query: 148 PVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPV 288
           PV K    PP YK P   PP YK     PPVYK     PPV K    PP YK P   PP 
Sbjct: 443 PVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPP 502

Query: 289 YKPPVEKPPVYKPPVEKPPVYK 354
           YK     PPVYK     PPVYK
Sbjct: 503 YKYSSPPPPVYKYKSPPPPVYK 524

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 64/134 (47%), Positives = 65/134 (48%), Gaps = 19/134 (14%)
 Frame = +1

Query: 10  PPVY---KPPVEKPPVYK---PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 159
           PP Y    PP + P  Y    PPV K    PP YK P   PP YK     PPVYK     
Sbjct: 264 PPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPP 323

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKP 312
           PPVYK     PPVYK     PPVYK     PPV K    PP YK P   PP YK P   P
Sbjct: 324 PPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPP 383

Query: 313 PVYKPPVEKPPVYK 354
           PVYK     PPVYK
Sbjct: 384 PVYKYKSPPPPVYK 397

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 65/136 (47%), Positives = 66/136 (48%), Gaps = 21/136 (15%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PP + PP   PP Y   PP  K P YK     PPVYK     PP YK P   PP YK   
Sbjct: 257 PPKHSPP---PPYYYHSPPPPKNP-YKYSSPPPPVYKYK-SPPPPYKYPSPPPPPYKYSS 311

Query: 184 EKPPVYKPPVEKPPVYK-----PPVEK-----PPVYK-----PPVEK----PPVYKPPVE 306
             PPVYK     PPVYK     PPV K     PPVYK     PPV K    PP YK P  
Sbjct: 312 PPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSP 371

Query: 307 KPPVYKPPVEKPPVYK 354
            PP YK P   PPVYK
Sbjct: 372 PPPPYKYPSPPPPVYK 387

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 58/127 (45%), Positives = 61/127 (48%), Gaps = 12/127 (9%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY---KPPVEKPPVYK---PPVEK-- 159
           PP + PP   PP Y   PP   PP + PP   PP Y    PP + P  Y    PPV K  
Sbjct: 241 PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPPPPKNPYKYSSPPPPVYKYK 291

Query: 160 --PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 333
             PP YK P   PP YK     PPVYK     PPVYK     PPVYK     PPVYK   
Sbjct: 292 SPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKS 351

Query: 334 EKPPVYK 354
             PPVYK
Sbjct: 352 PPPPVYK 358

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 56/122 (45%), Positives = 58/122 (47%), Gaps = 18/122 (14%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----P 147
           PP YK     PPVYK     PPV K    PP YK P   PP YK     PPVYK     P
Sbjct: 461 PPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPP 520

Query: 148 PVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
           PV K    PP YK P   PPVYK     PPVYK     PPV+ PP   PP Y      PP
Sbjct: 521 PVYKYKSPPPPYKYPSPPPPVYKYKSPPPPVYKYNSPPPPVHSPP---PPHYIYASPPPP 577

Query: 316 VY 321
            +
Sbjct: 578 YH 579

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 57/130 (43%), Positives = 60/130 (46%), Gaps = 15/130 (11%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY---KPPVEKPP 165
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y    PP + P 
Sbjct: 225 PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPPPPKNPY 278

Query: 166 VYK---PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 324
            Y    PPV K    PP YK P   PP YK     PPVYK     PPVYK     PPVYK
Sbjct: 279 KYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYK 338

Query: 325 PPVEKPPVYK 354
                PPVYK
Sbjct: 339 YNSPPPPVYK 348

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 55/132 (41%), Positives = 59/132 (44%), Gaps = 15/132 (11%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 193 PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 243

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYK---- 324
           + PP   PP Y   PP   PP + PP   PP Y   PP  K P YK     PPVYK    
Sbjct: 244 HSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPPPPKNP-YKYSSPPPPVYKYKSP 293

Query: 325 PPVEKPPVYKPP 360
           PP  K P   PP
Sbjct: 294 PPPYKYPSPPPP 305

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 53/132 (40%), Positives = 58/132 (43%), Gaps = 17/132 (12%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 177 PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 227

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY----KPPVEKPP----VYKPPVEKPPV 318
           + PP   PP Y   PP   PP + PP   PP Y     PP   PP     + PP  K P 
Sbjct: 228 HSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKNP- 277

Query: 319 YKPPVEKPPVYK 354
           YK     PPVYK
Sbjct: 278 YKYSSPPPPVYK 289

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 53/130 (40%), Positives = 59/130 (45%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY-- 171
           PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y  
Sbjct: 49  PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYH 93

Query: 172 KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEK---PPVYKPP 330
            PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP  K   PP Y   
Sbjct: 94  SPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPPPPKHSPPPPYYYH 141

Query: 331 VEKPPVYKPP 360
              PP + PP
Sbjct: 142 SPPPPKHSPP 151

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 53/130 (40%), Positives = 59/130 (45%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 65  PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 115

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 330
           + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 116 HSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 160

Query: 331 VEKPPVYKPP 360
              PP + PP
Sbjct: 161 ---PPKHSPP 167

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 53/130 (40%), Positives = 59/130 (45%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 81  PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 131

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 330
           + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 132 HSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 176

Query: 331 VEKPPVYKPP 360
              PP + PP
Sbjct: 177 ---PPKHSPP 183

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 53/130 (40%), Positives = 59/130 (45%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 113 PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 163

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 330
           + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 164 HSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 208

Query: 331 VEKPPVYKPP 360
              PP + PP
Sbjct: 209 ---PPKHSPP 215

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 53/130 (40%), Positives = 59/130 (45%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 129 PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 179

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 330
           + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 180 HSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 224

Query: 331 VEKPPVYKPP 360
              PP + PP
Sbjct: 225 ---PPKHSPP 231

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 53/130 (40%), Positives = 59/130 (45%), Gaps = 13/130 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPV 168
           PP + PP   PP Y   PP  K   PP Y      PP + PP   PP Y   PP   PP 
Sbjct: 161 PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPP---PPK 211

Query: 169 YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 330
           + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 212 HSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 256

Query: 331 VEKPPVYKPP 360
              PP + PP
Sbjct: 257 ---PPKHSPP 263

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 50/123 (40%), Positives = 56/123 (45%), Gaps = 11/123 (8%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKP 192
           PP  KP  Y+ P   PP + PP   PP Y   PP   PP + PP   PP Y   PP   P
Sbjct: 36  PPPPKPYYYQSP--PPPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---P 81

Query: 193 PVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVY 351
           P + PP   PP Y   PP   PP + PP   PP Y   PP  K   PP Y      PP +
Sbjct: 82  PKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKH 132

Query: 352 KPP 360
            PP
Sbjct: 133 SPP 135

[109][TOP]
>UniRef100_A5AVB2 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5AVB2_VITVI
          Length = 296

 Score =  109 bits (273), Expect = 8e-23
 Identities = 57/120 (47%), Positives = 68/120 (56%), Gaps = 2/120 (1%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  
Sbjct: 54  QPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGA 113

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPP 360
           +PP  KPP  +PP  KPP  +PP   PP  +PPV KPP     PP   PP+   P Y  P
Sbjct: 114 QPPNGKPPGAQPPNGKPPGAQPPKGTPPGAQPPVAKPPSHYGYPPYGSPPIYASPPYAAP 173

 Score =  109 bits (272), Expect = 1e-22
 Identities = 59/131 (45%), Positives = 70/131 (53%), Gaps = 13/131 (9%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  
Sbjct: 59  KPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPNG 118

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPP---------- 330
           KPP  +PP  KPP  +PP   PP  +PPV KPP +   PP   PP+Y  P          
Sbjct: 119 KPPGAQPPNGKPPGAQPPKGTPPGAQPPVAKPPSHYGYPPYGSPPIYASPPYAAPPTNGS 178

Query: 331 -VEKPPVYKPP 360
               PPV  PP
Sbjct: 179 ITPTPPVLSPP 189

 Score =  108 bits (270), Expect = 2e-22
 Identities = 57/117 (48%), Positives = 68/117 (58%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P    PP+  PP   PP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +
Sbjct: 36  PYTASPPLS-PPNGIPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQ 94

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP   PP  +PPV KPP
Sbjct: 95  PPKGKPPGAQPPNGKPPGAQPPNGKPPGAQPPNGKPPGAQPPKGTPPGAQPPVAKPP 151

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 53/117 (45%), Positives = 63/117 (53%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P     P   P    PP+  PP   PP  +PP  KPP  +PP  KPP  +PP  KPP  +
Sbjct: 26  PTTTPTPAPAPYTASPPLS-PPNGIPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQ 84

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP   PP
Sbjct: 85  PPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPNGKPPGAQPPNGKPPGAQPPKGTPP 141

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/122 (40%), Positives = 59/122 (48%), Gaps = 3/122 (2%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPV---YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 174
           + PP   P    PP    Y+PP        P     P   P    PP+  PP   PP  +
Sbjct: 3   QXPPPPPPQHPMPPCKCGYQPPT-------PTTTPTPAPAPYTASPPL-SPPNGIPPGAQ 54

Query: 175 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +
Sbjct: 55  PPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQ 114

Query: 355 PP 360
           PP
Sbjct: 115 PP 116

[110][TOP]
>UniRef100_Q25460 Adhesive plaque matrix protein (Fragment) n=1 Tax=Mytilus edulis
           RepID=FP1_MYTED
          Length = 875

 Score =  109 bits (273), Expect = 8e-23
 Identities = 53/115 (46%), Positives = 56/115 (48%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYKP +  PP YKP    PP YK      P YKP +  PP YK     P  YKP    
Sbjct: 72  PPVYKPKMTYPPTYKPKPSYPPTYK----SKPTYKPKITYPPTYKAKPSYPSSYKPKKTY 127

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP +  PP YKP    PP YKP    PP YK     P  YK     PP YK
Sbjct: 128 PPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPPSYKTKKTYPSSYKAKPSYPPTYK 182

 Score =  107 bits (267), Expect = 4e-22
 Identities = 50/116 (43%), Positives = 53/116 (45%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
            PP YK     PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    
Sbjct: 756  PPTYKAKPSYPPTYKPKPSYPPTYKSKSIYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSY 815

Query: 190  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            PP YKP +  P  YK     PP YK     PP Y   +  P  YK     PP YKP
Sbjct: 816  PPSYKPKITYPSTYKLKPSYPPTYKSKTSYPPTYNKKISYPSSYKAKTSYPPAYKP 871

 Score =  104 bits (259), Expect = 3e-21
 Identities = 52/121 (42%), Positives = 54/121 (44%), Gaps = 6/121 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 171
           PP YKP    PP YK      P +  PP YK     P  YKP    PP YKP +  PP Y
Sbjct: 82  PPTYKPKPSYPPTYKSKPTYKPKITYPPTYKAKPSYPSSYKPKKTYPPTYKPKLTYPPTY 141

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           KP    PP YKP    PP YK     P  YK     PP YK     PP YK     PP Y
Sbjct: 142 KPKPSYPPTYKPKPSYPPSYKTKKTYPSSYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTY 201

Query: 352 K 354
           K
Sbjct: 202 K 202

 Score =  103 bits (256), Expect = 8e-21
 Identities = 50/112 (44%), Positives = 53/112 (47%)
 Frame = +1

Query: 19  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 198
           Y      PPVYKP +  PP YKP    PP YK      P YKP +  PP YK     P  
Sbjct: 65  YNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYK----SKPTYKPKITYPPTYKAKPSYPSS 120

Query: 199 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           YKP    PP YKP +  PP YKP    PP YKP    PP YK     P  YK
Sbjct: 121 YKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPPSYKTKKTYPSSYK 172

 Score =  102 bits (255), Expect = 1e-20
 Identities = 49/115 (42%), Positives = 51/115 (44%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YK     P  YKP    PP YKP +   P YKP    PP YKP    
Sbjct: 472 PASYKAKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKPKTTY 531

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP +  PP YK     P  YK     PP YK     PP YK     PP YK
Sbjct: 532 PPTYKPKISYPPTYKAKPSYPATYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 586

 Score =  100 bits (250), Expect = 4e-20
 Identities = 48/114 (42%), Positives = 51/114 (44%)
 Frame = +1

Query: 13   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
            P YK     PP YK     PP YKP    PP YK     P  YKP    PP YKP +  P
Sbjct: 747  PTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSIYPSSYKPKKTYPPTYKPKLTYP 806

Query: 193  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
            P YKP    PP YKP +  P  YK     PP YK     PP Y   +  P  YK
Sbjct: 807  PTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTSYPPTYNKKISYPSSYK 860

 Score =  100 bits (249), Expect = 5e-20
 Identities = 50/118 (42%), Positives = 53/118 (44%), Gaps = 2/118 (1%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            PP YK     PP YK     PP YK  P  +  P Y    +  P YK     PP YK   
Sbjct: 704  PPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTYPPTYKAKP 763

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
              PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YKP
Sbjct: 764  SYPPTYKPKPSYPPTYKSKSIYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKP 821

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 48/115 (41%), Positives = 50/115 (43%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     P  YK     PP YK     P  YKP    PP YKP +   P YKP    
Sbjct: 462 PSTYKAKPSYPASYKAKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKPSY 521

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YKP    PP YKP +  PP YK     P  YK     PP YK     PP YK
Sbjct: 522 PPSYKPKTTYPPTYKPKISYPPTYKAKPSYPATYKAKPSYPPTYKAKPSYPPTYK 576

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 52/131 (39%), Positives = 54/131 (41%), Gaps = 16/131 (12%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +   P YKP    PP YKP    PP YKP +  PP YK     P  YK     
Sbjct: 502 PPTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPSYPATYKAKPSY 561

Query: 190 PPVYKPPVEKPPVYK-----PPVEK-----------PPVYKPPVEKPPVYKPPVEKPPVY 321
           PP YK     PP YK     PP  K           P  YK     PP YK     PP Y
Sbjct: 562 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTY 621

Query: 322 KPPVEKPPVYK 354
           K     PP YK
Sbjct: 622 KAKPSYPPTYK 632

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 56/139 (40%), Positives = 62/139 (44%), Gaps = 22/139 (15%)
 Frame = +1

Query: 7   KPPVYKPPVEK---------PPVYK------PPVEKPPVYKP-------PVEKPPVYKPP 120
           KPP Y+P  +K         PP Y       P  +K   YKP           PPVYKP 
Sbjct: 19  KPPTYQPLKKKVDYRPTKSYPPTYGSKTNYLPLAKKLSSYKPIKTTYNAKTNYPPVYKPK 78

Query: 121 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 300
           +  PP YKP    PP YK      P YKP +  PP YK     P  YKP    PP YKP 
Sbjct: 79  MTYPPTYKPKPSYPPTYK----SKPTYKPKITYPPTYKAKPSYPSSYKPKKTYPPTYKPK 134

Query: 301 VEKPPVYKPPVEKPPVYKP 357
           +  PP YKP    PP YKP
Sbjct: 135 LTYPPTYKPKPSYPPTYKP 153

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 49/117 (41%), Positives = 53/117 (45%), Gaps = 2/117 (1%)
 Frame = +1

Query: 10   PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            PP YK  P  +  P Y    +  P YK     PP YK     PP YKP    PP YK   
Sbjct: 724  PPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKS 783

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
              P  YKP    PP YKP +  PP YKP    PP YKP +  P  YK     PP YK
Sbjct: 784  IYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYK 840

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 47/113 (41%), Positives = 50/113 (44%)
 Frame = +1

Query: 13   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
            P Y    +  P YK     PP YK     PP YKP    PP YK     P  YKP    P
Sbjct: 737  PTYPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSIYPSSYKPKKTYP 796

Query: 193  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
            P YKP +  PP YKP    PP YKP +  P  YK     PP YK     PP Y
Sbjct: 797  PTYKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTSYPPTY 849

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 47/114 (41%), Positives = 49/114 (42%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P YK     P  YK     P  YK     PP YK     P  YKP    PP YKP +   
Sbjct: 453 PTYKAKPTYPSTYKAKPSYPASYKAKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYK 512

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P YKP    PP YKP    PP YKP +  PP YK     P  YK     PP YK
Sbjct: 513 PTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPSYPATYKAKPSYPPTYK 566

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 46/114 (40%), Positives = 50/114 (43%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P Y P  +  P Y P  +  P YK     P  YK     P  YK     PP YK     P
Sbjct: 433 PSYPPSYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPASYKAKPSYPPTYKSKSSYP 492

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
             YKP    PP YKP +   P YKP    PP YKP    PP YKP +  PP YK
Sbjct: 493 SSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYK 546

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 46/114 (40%), Positives = 49/114 (42%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P Y P  +  P YK     P  YK     P  YK     PP YK     P  YKP    P
Sbjct: 443 PSYPPTYKAKPTYKAKPTYPSTYKAKPSYPASYKAKPSYPPTYKSKSSYPSSYKPKKTYP 502

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P YKP +   P YKP    PP YKP    PP YKP +  PP YK     P  YK
Sbjct: 503 PTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPSYPATYK 556

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 51/132 (38%), Positives = 52/132 (39%), Gaps = 16/132 (12%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 174
           PP YKP    PP YKP +  PP YK     P  YK     PP YK     PP YK     
Sbjct: 522 PPSYKPKTTYPPTYKPKISYPPTYKAKPSYPATYKAKPSYPPTYKAKPSYPPTYKAKPSY 581

Query: 175 PPVEK-----------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 321
           PP  K           P  YK     PP YK     PP YK     PP YK     P  Y
Sbjct: 582 PPTYKAKPSYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTY 641

Query: 322 KPPVEKPPVYKP 357
           K     PP YKP
Sbjct: 642 KAKPSYPPTYKP 653

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/141 (36%), Positives = 53/141 (37%), Gaps = 26/141 (18%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----- 174
           PP YKP +  PP YK     P  YK     PP YK     PP YK     PP YK     
Sbjct: 532 PPTYKPKISYPPTYKAKPSYPATYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 591

Query: 175 ----------------PPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 291
                           PP  K     PP YK     PP YK     P  YK     PP Y
Sbjct: 592 KAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTY 651

Query: 292 KPPVEKPPVYKPPVEKPPVYK 354
           KP +  PP YK     PP YK
Sbjct: 652 KPKISYPPTYKAKPSYPPTYK 672

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 49/121 (40%), Positives = 50/121 (41%), Gaps = 6/121 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YK     PP YK     PP YK     P  YK     PP YKP +  PP YK     
Sbjct: 608 PPTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYKAKPSY 667

Query: 190 PPVYK-----PPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           PP YK     PP  K  P YK     P  YK     PP YK     PP YK     PP Y
Sbjct: 668 PPTYKAKPSYPPTYKAKPTYKAKPTNPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTY 727

Query: 352 K 354
           K
Sbjct: 728 K 728

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 49/121 (40%), Positives = 50/121 (41%), Gaps = 6/121 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKP-PVEK-----PPVYKPPVEKPPVYKPPVEKPPVY 171
           PP YK     PP YK     PP YK  P  K     P  YK     PP YK     PP Y
Sbjct: 562 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTY 621

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           K     PP YK     P  YK     PP YKP +  PP YK     PP YK     PP Y
Sbjct: 622 KAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYKAKPSYPPTYKAKPSYPPTY 681

Query: 352 K 354
           K
Sbjct: 682 K 682

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/123 (42%), Positives = 56/123 (45%), Gaps = 11/123 (8%)
 Frame = +1

Query: 19  YKPPVEKPPVYKP-------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           Y P  +K   YKP           PPVYKP +  PP YKP    PP YK      P YKP
Sbjct: 48  YLPLAKKLSSYKPIKTTYNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYK----SKPTYKP 103

Query: 178 PVEKPPVYKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
            +  PP YK         P  YKP    PP YKP +  PP YKP    PP YKP    PP
Sbjct: 104 KITYPPTYK----AKPSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPP 159

Query: 346 VYK 354
            YK
Sbjct: 160 SYK 162

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/127 (40%), Positives = 54/127 (42%), Gaps = 11/127 (8%)
 Frame = +1

Query: 7   KPPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 171
           KP +  PP  K     P  YKP    PP YKP +  PP YKP    PP YKP    PP Y
Sbjct: 102 KPKITYPPTYKAKPSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPPSY 161

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEK-----PPVYKPPV 333
           K     P  YK     PP YK     PP YK     PP YK  P  K     P  YK   
Sbjct: 162 KTKKTYPSSYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKP 221

Query: 334 EKPPVYK 354
             PP YK
Sbjct: 222 SYPPTYK 228

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 51/124 (41%), Positives = 53/124 (42%), Gaps = 8/124 (6%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YKP    PP YKP +  PP YKP    PP YKP    PP YK     P  YK     
Sbjct: 118 PSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPPSYKTKKTYPSSYKAKPSY 177

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKP-PVEK-----PPVYKPPVEKPPVY--KPPVEKPP 345
           PP YK     PP YK     PP YK  P  K     P  YK     PP Y  KP  +  P
Sbjct: 178 PPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKP 237

Query: 346 VYKP 357
            Y P
Sbjct: 238 SYPP 241

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/115 (38%), Positives = 48/115 (41%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P Y    +  P Y P  +  P Y P  +  P YK     P  YK     P  YK     P
Sbjct: 423 PTYPSTYKAKPSYPPSYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPASYKAKPSYP 482

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P YK     P  YKP    PP YKP +   P YKP    PP YKP    PP YKP
Sbjct: 483 PTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKP 537

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 45/115 (39%), Positives = 46/115 (40%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P  YK     PP YK     PP YK     PP YK     P  YK     PP YKP +  
Sbjct: 598 PSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKPKISY 657

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP YK     PP YK     PP YK      P YK     P  YK     PP YK
Sbjct: 658 PPTYKAKPSYPPTYKAKPSYPPTYKAK----PTYKAKPTNPSTYKAKPSYPPTYK 708

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/134 (37%), Positives = 54/134 (40%), Gaps = 18/134 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP YKP +  PP YKP    PP YKP    PP YK     P  YK     PP YK     
Sbjct: 128 PPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPPSYKTKKTYPSSYKAKPSYPPTYKAKPSY 187

Query: 190 PPVYKPPVEKPPVYKP-PVEK---------------PPVYK--PPVEKPPVYKPPVEKPP 315
           PP YK     PP YK  P  K               PP YK  P  +  P Y P  +  P
Sbjct: 188 PPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKP 247

Query: 316 VYKPPVEKPPVYKP 357
            Y P  +  P Y P
Sbjct: 248 SYPPTYKAKPSYPP 261

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 52/131 (39%), Positives = 54/131 (41%), Gaps = 16/131 (12%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEK----- 159
           P  YKP    PP YKP +   P YKP    PP YKP     P  KP +  PP  K     
Sbjct: 492 PSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPSY 551

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEK-----PPVYKPPVEKPPVY 321
           P  YK     PP YK     PP YK     PP YK  P  K     P  YK     PP Y
Sbjct: 552 PATYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYKAKPTYPSTYKAKPSYPPTY 611

Query: 322 KPPVEKPPVYK 354
           K     PP YK
Sbjct: 612 KAKPSYPPTYK 622

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/122 (39%), Positives = 50/122 (40%), Gaps = 8/122 (6%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYK-PPV 183
           P Y P  +  P YK     PP YK     PP YK     PP YK  P  +  P YK  P 
Sbjct: 221 PSYPPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYKAKPT 280

Query: 184 EK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            K     PP YK     PP YK     PP YK     PP YK     PP YK     PP 
Sbjct: 281 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPT 340

Query: 349 YK 354
           YK
Sbjct: 341 YK 342

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 49/129 (37%), Positives = 50/129 (38%), Gaps = 14/129 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK--------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 165
           PP YK     PP YK        P  +  P YK     PP YK     PP YK     PP
Sbjct: 250 PPTYKAKPSYPPTYKAKPTYKAKPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 309

Query: 166 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEK-----PPVYKPPVEKPPVYKP 327
            YK     PP YK     PP YK     PP YK  P  K     P  YK     PP YK 
Sbjct: 310 TYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKA 369

Query: 328 PVEKPPVYK 354
               PP YK
Sbjct: 370 KPSYPPTYK 378

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/118 (37%), Positives = 49/118 (41%), Gaps = 2/118 (1%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PP YK  P  +  P Y    +  P Y P  +  P Y P  +  P YK     P  YK   
Sbjct: 410 PPTYKAKPTYKAKPTYPSTYKAKPSYPPSYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKP 469

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
             P  YK     PP YK     P  YKP    PP YKP +   P YKP    PP YKP
Sbjct: 470 SYPASYKAKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKP 527

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 45/125 (36%), Positives = 49/125 (39%), Gaps = 10/125 (8%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PP YK  P  +  P Y    +  P Y P  +  P YK     PP YK     PP YK   
Sbjct: 198 PPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKP 257

Query: 184 EKPPVY--------KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 339
             PP Y        KP  +  P YK     PP YK     PP YK     PP YK     
Sbjct: 258 SYPPTYKAKPTYKAKPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 317

Query: 340 PPVYK 354
           PP YK
Sbjct: 318 PPTYK 322

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/124 (37%), Positives = 50/124 (40%), Gaps = 8/124 (6%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVE 186
           PP YK     PP YK     PP YK     PP YK     PP YK     PP YK  P  
Sbjct: 288 PPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTY 347

Query: 187 K-----PPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           K     P  YK     PP YK     PP YK  P  +  P Y P  +  P Y P  +  P
Sbjct: 348 KAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKP 407

Query: 346 VYKP 357
            Y P
Sbjct: 408 SYPP 411

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 45/117 (38%), Positives = 46/117 (39%), Gaps = 2/117 (1%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P YK     PP YK     PP YK     PP YK     PP YK     PP YK     P
Sbjct: 279 PTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYP 338

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKP 357
           P YK      P YK     P  YK     PP YK     PP Y  KP  +  P Y P
Sbjct: 339 PTYKAK----PTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPSYPP 391

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/122 (37%), Positives = 49/122 (40%), Gaps = 8/122 (6%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVE 186
           P Y    +  P Y P  +  P YK     PP YK     PP YK     PP YK  P  +
Sbjct: 211 PTYPSTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYK 270

Query: 187 KPPVYK-PPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
             P YK  P  K     PP YK     PP YK     PP YK     PP YK     PP 
Sbjct: 271 AKPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPT 330

Query: 349 YK 354
           YK
Sbjct: 331 YK 332

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 48/136 (35%), Positives = 50/136 (36%), Gaps = 19/136 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK--------PPVEKPPVYKPPVEKPPVYKPPVEKPP 165
           PP YK     PP YK     PP YK        P  +  P YK     PP YK     PP
Sbjct: 240 PPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYKAKPTYKAKPSYPPTYKAKPSYPP 299

Query: 166 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYK----- 324
            YK     PP YK     PP YK     PP YK     PP YK  P  +  P Y      
Sbjct: 300 TYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKA 359

Query: 325 ----PPVEKPPVYKPP 360
               PP  K     PP
Sbjct: 360 KPSYPPTYKAKPSYPP 375

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 45/122 (36%), Positives = 49/122 (40%), Gaps = 8/122 (6%)
 Frame = +1

Query: 13  PVYK-PPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 174
           P YK  P  K     PP YK     PP YK     PP YK     PP YK     PP YK
Sbjct: 273 PTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 332

Query: 175 PPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
                PP Y  KP  +  P Y    +  P Y P  +  P Y P  +  P YK     PP 
Sbjct: 333 AKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPSYPPT 392

Query: 349 YK 354
           YK
Sbjct: 393 YK 394

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 43/122 (35%), Positives = 50/122 (40%), Gaps = 6/122 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PP YK     PP YK  P  +  P Y    +  P Y P  +  P YK     PP YK   
Sbjct: 188 PPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKP 247

Query: 184 EKPPVYKPPVEKPPVYK--PPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
             PP YK     PP YK  P  +  P YK  P  +  P Y P  +  P Y P  +  P Y
Sbjct: 248 SYPPTYKAKPSYPPTYKAKPTYKAKPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSY 307

Query: 352 KP 357
            P
Sbjct: 308 PP 309

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 42/117 (35%), Positives = 46/117 (39%), Gaps = 2/117 (1%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PP YK  P  +  P Y    +  P Y P  +  P Y P  +  P YK     PP YK   
Sbjct: 338 PPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKP 397

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
             PP YK     PP YK      P YK     P  YK     PP YK     PP YK
Sbjct: 398 SYPPTYKAKPSYPPTYK----AKPTYKAKPTYPSTYKAKPSYPPSYKAKPSYPPTYK 450

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 45/128 (35%), Positives = 49/128 (38%), Gaps = 12/128 (9%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PP YK     PP YK     PP YK  P  +  P Y    +  P Y P  +  P Y P  
Sbjct: 390 PPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPSYKAKPSYPPTY 449

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKP-- 342
           +  P YK     P  YK     P  YK     PP YK     P  YKP     P  KP  
Sbjct: 450 KAKPTYKAKPTYPSTYKAKPSYPASYKAKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKL 509

Query: 343 ---PVYKP 357
              P YKP
Sbjct: 510 TYKPTYKP 517

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 42/117 (35%), Positives = 45/117 (38%), Gaps = 4/117 (3%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEK-PPVYKPPVE 186
           P YK     P  YK     PP YK     PP YK  P  K     PP  K  P Y P  +
Sbjct: 345 PTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKPSYPPTYK 404

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVY 351
             P Y P  +  P YK     P  YK     PP YK     PP Y  KP  +  P Y
Sbjct: 405 AKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPSYKAKPSYPPTYKAKPTYKAKPTY 461

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 34/87 (39%), Positives = 37/87 (42%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            KP    PP  KP      +  PP YKP    PP YKP +  P  YK     PP YK    
Sbjct: 790  KPKKTYPPTYKP-----KLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTS 844

Query: 187  KPPVYKPPVEKPPVYKPPVEKPPVYKP 267
             PP Y   +  P  YK     PP YKP
Sbjct: 845  YPPTYNKKISYPSSYKAKTSYPPAYKP 871

[111][TOP]
>UniRef100_B9GHP4 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GHP4_POPTR
          Length = 223

 Score =  109 bits (272), Expect = 1e-22
 Identities = 61/119 (51%), Positives = 63/119 (52%), Gaps = 2/119 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVE 186
           PP  K P   PPV  P     P+YKPP   PPV  PP   PPV  P PV+ P    PPV 
Sbjct: 23  PPEVKSPTPAPPVVTPST---PLYKPPTPAPPVKTPP-PAPPVNPPTPVKPPTTPAPPVY 78

Query: 187 KPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           KPP   PPV  P   KPP    PPVYKPP   PPV  PP   PPV  P    PPVYKPP
Sbjct: 79  KPPSPAPPVNPPTPVKPPTTPAPPVYKPPSPAPPV-NPPTPVPPVKPPTAPAPPVYKPP 136

 Score =  109 bits (272), Expect = 1e-22
 Identities = 64/125 (51%), Positives = 66/125 (52%), Gaps = 7/125 (5%)
 Frame = +1

Query: 7   KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPVYKP 177
           K P   PPV  P  P+YKPP   PPV  PP   PPV  P PV+ P    PPV KPP   P
Sbjct: 27  KSPTPAPPVVTPSTPLYKPPTPAPPVKTPP-PAPPVNPPTPVKPPTTPAPPVYKPPSPAP 85

Query: 178 PVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP---P 345
           PV  P   KPP    PPVYKPP   PPV  PP   PPV  P    PPVYKPP   P   P
Sbjct: 86  PVNPPTPVKPPTTPAPPVYKPPSPAPPV-NPPTPVPPVKPPTAPAPPVYKPPSPAPTPVP 144

Query: 346 VYKPP 360
             KPP
Sbjct: 145 PVKPP 149

 Score =  105 bits (261), Expect = 2e-21
 Identities = 63/118 (53%), Positives = 65/118 (55%), Gaps = 3/118 (2%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           P+YKPP   PPV  PP   PPV  P PV+ P    PPV KPP   PPV  P   KPP   
Sbjct: 41  PLYKPPTPAPPVKTPP-PAPPVNPPTPVKPPTTPAPPVYKPPSPAPPVNPPTPVKPPTTP 99

Query: 190 -PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKP 357
            PPVYKPP   PPV  PP   PPV  P    PPVYKPP   P PV  PPV KPP   P
Sbjct: 100 APPVYKPPSPAPPV-NPPTPVPPVKPPTAPAPPVYKPPSPAPTPV--PPV-KPPTTGP 153

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 46/91 (50%), Positives = 46/91 (50%), Gaps = 3/91 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYKPP   PPV  P   KPP        PPVYKPP   PPV  PP   PPV  P    
Sbjct: 75  PPVYKPPSPAPPVNPPTPVKPPT----TPAPPVYKPPSPAPPV-NPPTPVPPVKPPTAPA 129

Query: 190 PPVYKPPVEKP---PVYKPPVEKPPVYKPPV 273
           PPVYKPP   P   P  KPP   P    PPV
Sbjct: 130 PPVYKPPSPAPTPVPPVKPPTTGP--MPPPV 158

[112][TOP]
>UniRef100_Q9FUF1 Putative proline-rich protein (Fragment) n=1 Tax=Solanum
           lycopersicum RepID=Q9FUF1_SOLLC
          Length = 158

 Score =  108 bits (271), Expect = 1e-22
 Identities = 54/96 (56%), Positives = 62/96 (64%), Gaps = 1/96 (1%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           PP+  PP+ KPPV  PPV  PP+ KPPV  PPV  PP+ KPPV+ PPV  PPV  PP+ K
Sbjct: 1   PPIGIPPIVKPPVILPPVGIPPIVKPPVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVK 60

Query: 205 PPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEK 309
           PPV+ PP+  PPV  PPV KP P  K P   PP  K
Sbjct: 61  PPVDLPPIGIPPVTVPPVIKPSPKGKKPC--PPTTK 94

 Score =  107 bits (267), Expect = 4e-22
 Identities = 51/88 (57%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +1

Query: 85  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 264
           PP+  PP+ KPPV  PPV  PP+ KPPV  PPV  PP+ KPPV+ PPV  PPV  PP+ K
Sbjct: 1   PPIGIPPIVKPPVILPPVGIPPIVKPPVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVK 60

Query: 265 PPVEKPPVYKPPVEKPPVYKP-PVEKPP 345
           PPV+ PP+  PPV  PPV KP P  K P
Sbjct: 61  PPVDLPPIGIPPVTVPPVIKPSPKGKKP 88

 Score =  106 bits (265), Expect = 7e-22
 Identities = 48/81 (59%), Positives = 56/81 (69%)
 Frame = +1

Query: 115 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 294
           PP+  PP+ KPPV  PPV  PP+ KPPV  PPV  PP+ KPPV+ PPV  PPV  PP+ K
Sbjct: 1   PPIGIPPIVKPPVILPPVGIPPIVKPPVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVK 60

Query: 295 PPVEKPPVYKPPVEKPPVYKP 357
           PPV+ PP+  PPV  PPV KP
Sbjct: 61  PPVDLPPIGIPPVTVPPVIKP 81

 Score =  104 bits (259), Expect = 3e-21
 Identities = 54/96 (56%), Positives = 61/96 (63%), Gaps = 1/96 (1%)
 Frame = +1

Query: 70  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 249
           PP+  PP+ KPPV  PPV  PP+ KPPV+ PPV  PP+ KPPV  PPV  PPV  PP+ K
Sbjct: 1   PPIGIPPIVKPPVILPPVGIPPIVKPPVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVK 60

Query: 250 PPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYK 354
           PPV  PP+  PPV  PPV KP P  K P   PP  K
Sbjct: 61  PPVDLPPIGIPPVTVPPVIKPSPKGKKPC--PPTTK 94

 Score =  104 bits (259), Expect = 3e-21
 Identities = 52/91 (57%), Positives = 59/91 (64%), Gaps = 1/91 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+ KPPV  PPV  PP+ KPPV  PPV  PP+ KPPV+ PPV  PPV  PP+ KPPV+ 
Sbjct: 6   PPIVKPPVILPPVGIPPIVKPPVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVKPPVDL 65

Query: 190 PPVYKPPVEKPPVYKP-PVEKPPVYKPPVEK 279
           PP+  PPV  PPV KP P  K P   PP  K
Sbjct: 66  PPIGIPPVTVPPVIKPSPKGKKPC--PPTTK 94

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 42/72 (58%), Positives = 50/72 (69%)
 Frame = +1

Query: 145 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 324
           PP+  PP+ KPPV  PPV  PP+ KPPV  PPV  PP+ KPPV+ PPV  PPV  PP+ K
Sbjct: 1   PPIGIPPIVKPPVILPPVGIPPIVKPPVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVK 60

Query: 325 PPVEKPPVYKPP 360
           PPV+ PP+  PP
Sbjct: 61  PPVDLPPIGIPP 72

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 41/72 (56%), Positives = 46/72 (63%), Gaps = 1/72 (1%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PV 183
           KPPV  PPV  PP+ KPPV+ PPV  PPV  PP+ KPPV+ PP+  PPV  PPV KP P 
Sbjct: 25  KPPVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVKPPVDLPPIGIPPVTVPPVIKPSPK 84

Query: 184 EKPPVYKPPVEK 219
            K P   PP  K
Sbjct: 85  GKKPC--PPTTK 94

[113][TOP]
>UniRef100_C5YGB7 Putative uncharacterized protein Sb06g016310 n=1 Tax=Sorghum
           bicolor RepID=C5YGB7_SORBI
          Length = 283

 Score =  108 bits (271), Expect = 1e-22
 Identities = 71/139 (51%), Positives = 72/139 (51%), Gaps = 22/139 (15%)
 Frame = +1

Query: 7   KPPVYKPP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           K PVY PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPVY P   KPPV
Sbjct: 101 KSPVYPPPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPVYTPS-PKPPV 155

Query: 169 YKPPVEK--PPVY----KPPVEKPPVY----KPPVEK--PPVY----KPPVEKPPVYKPP 300
            KPP  K  PPVY    KPPV KPP +    KPP  K  PPVY    KPP   PP Y  P
Sbjct: 156 TKPPTPKPTPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTPSPKPPKPSPPTY-TP 214

Query: 301 VEKPPVYKPPVEKPPVYKP 357
             KPP  KPP   P   KP
Sbjct: 215 TPKPPATKPPTSTPTHPKP 233

 Score =  106 bits (265), Expect = 7e-22
 Identities = 69/131 (52%), Positives = 69/131 (52%), Gaps = 15/131 (11%)
 Frame = +1

Query: 10  PPVYKP-PVEKPPVYKPP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           PP Y P P  K PVY PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPV
Sbjct: 91  PPTYTPSPKPKSPVYPPPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPV 146

Query: 169 YKPPVEKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEK--PPVY----K 324
           Y P   KPPV KPP  KP  PVY P   KPPV KPP   P   KPP  K  PPVY    K
Sbjct: 147 YTPS-PKPPVTKPPTPKPTPPVYTPN-PKPPVTKPPTHTPSP-KPPTSKPTPPVYTPSPK 203

Query: 325 PPVEKPPVYKP 357
           PP   PP Y P
Sbjct: 204 PPKPSPPTYTP 214

 Score =  104 bits (260), Expect = 3e-21
 Identities = 68/145 (46%), Positives = 69/145 (47%), Gaps = 27/145 (18%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVY----KPPVEKPPVYKP------PVEKPPVYKPPVEKPPVYKPPVE 156
           KPP  KPP   PPVY    KPPV KPP  KP      P  KPPV KPP   P   KPP  
Sbjct: 135 KPPATKPPT--PPVYTPSPKPPVTKPPTPKPTPPVYTPNPKPPVTKPPTHTPSP-KPPTS 191

Query: 157 K--PPVY----KPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYK--- 294
           K  PPVY    KPP   PP Y    KPP  KPP   P   KP  + P P   PP YK   
Sbjct: 192 KPTPPVYTPSPKPPKPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPIPKPTPPTYKPAP 251

Query: 295 ---PPVEKPPVYKPPVEKPPVYKPP 360
              PP   PP Y PPV   P   PP
Sbjct: 252 KPTPPAPTPPTYTPPVSHTPSSPPP 276

 Score =  101 bits (252), Expect = 2e-20
 Identities = 70/150 (46%), Positives = 71/150 (47%), Gaps = 33/150 (22%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVY-------KPPVEK---PPVYKP----------PVEKPPVYKP-PV 123
           KPP   P  EKPP         KPP E    PP Y P          P   PP Y P P 
Sbjct: 40  KPPAKGPKPEKPPTKGHGHKPEKPPKEHKPTPPTYTPSPKPTPPPATPKPTPPTYTPSPK 99

Query: 124 EKPPVYKPP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 285
            K PVY PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPVY P   KPP
Sbjct: 100 PKSPVYPPPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPVYTPS-PKPP 154

Query: 286 VYKPPVEK--PPVY----KPPVEKPPVYKP 357
           V KPP  K  PPVY    KPPV KPP + P
Sbjct: 155 VTKPPTPKPTPPVYTPNPKPPVTKPPTHTP 184

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 60/137 (43%), Positives = 61/137 (44%), Gaps = 22/137 (16%)
 Frame = +1

Query: 7   KPPVYKPPVEKP-----------PVYKPPVEKPPVYKPPVEK--PPVY----KPPVEKPP 135
           KPPV KPP  KP           PV KPP   P   KPP  K  PPVY    KPP   PP
Sbjct: 152 KPPVTKPPTPKPTPPVYTPNPKPPVTKPPTHTPSP-KPPTSKPTPPVYTPSPKPPKPSPP 210

Query: 136 VY----KPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 300
            Y    KPP  KPP   P   KP  + P P   PP YKP     P   PP   PP Y PP
Sbjct: 211 TYTPTPKPPATKPPTSTPTHPKPTPHTPIPKPTPPTYKP----APKPTPPAPTPPTYTPP 266

Query: 301 VEKPPVYKPPVEKPPVY 351
           V   P   PP   PP Y
Sbjct: 267 VSHTPSSPPPPPPPPYY 283

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 60/131 (45%), Positives = 61/131 (46%), Gaps = 17/131 (12%)
 Frame = +1

Query: 19  YKPPVEKPPVYKPPVEKPPVY-------KPPVEK---PPVYKPPVEKPPVYKPPVEKPPV 168
           Y  P  KPP   P  EKPP         KPP E    PP Y P  +  P    P   PP 
Sbjct: 34  YPTPTPKPPAKGPKPEKPPTKGHGHKPEKPPKEHKPTPPTYTPSPKPTPPPATPKPTPPT 93

Query: 169 YKP-PVEKPPVYKPP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 327
           Y P P  K PVY PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPVY P
Sbjct: 94  YTPSPKPKSPVYPPPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPVYTP 149

Query: 328 PVEKPPVYKPP 360
              KPPV KPP
Sbjct: 150 S-PKPPVTKPP 159

[114][TOP]
>UniRef100_Q57UP2 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei
           RepID=Q57UP2_9TRYP
          Length = 507

 Score =  108 bits (271), Expect = 1e-22
 Identities = 70/181 (38%), Positives = 88/181 (48%), Gaps = 67/181 (37%)
 Frame = +1

Query: 19  YKPPVEKP--PVYKPPVEKPP--VYKPPVEKPP--VYKPPVEKP--PVYKPPVEKPP--- 165
           YKPPV+KP   VY+PP EKP    Y+PP +KP    YKPP +KP    Y+PP +KP    
Sbjct: 227 YKPPVDKPVSGVYRPPTEKPTSGAYRPPTDKPATGAYKPPTDKPFSGAYRPPADKPSSGA 286

Query: 166 -----------------------------VYKPPVEKPP--VYKPPVEKPP--VYKPPVE 246
                                         Y+PP++KP    YKPPV+KP    YKPP +
Sbjct: 287 YRPTAAKLGEVMAATTARDETSSEKPAAGAYRPPIDKPSSGAYKPPVDKPSSGAYKPPTD 346

Query: 247 KPPV--YKPPVEKPP-----------------VYKPPVEKPP--VYKPPVEKPP--VYKP 357
           K  +  Y+PP EKP                   Y+PP +KPP  VYKPPV+KP    Y+P
Sbjct: 347 KSSLGAYEPPSEKPASVPAVPAESSAVKPSTGAYRPPTDKPPTGVYKPPVDKPSTGAYRP 406

Query: 358 P 360
           P
Sbjct: 407 P 407

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 50/122 (40%), Positives = 67/122 (54%), Gaps = 23/122 (18%)
 Frame = +1

Query: 4   EKPP--VYKPPVEKPP--VYKPPVEKPP---VYKPPVEKPPVYKP----PVEKPP--VYK 144
           +KPP  VYKPPV+KP    Y+PP +KP     Y PP E+     P     VEKP    YK
Sbjct: 385 DKPPTGVYKPPVDKPSTGAYRPPTDKPSSGGAYVPPSERLATAAPGEQLSVEKPSAGTYK 444

Query: 145 PPVEK--PPVYKPPVEKPP--VYKPPVEKPP--VYKPPVEKPP--VYKPPVEKP--PVYK 294
           PP ++     YKPP ++P    YKPP +KP    Y+PP ++P    Y+PP E+     ++
Sbjct: 445 PPTDRVSSGSYKPPTDRPSAGAYKPPTDKPSSGAYRPPTDRPSSGAYRPPAERSFGSTFR 504

Query: 295 PP 300
           PP
Sbjct: 505 PP 506

[115][TOP]
>UniRef100_P24152 Extensin n=1 Tax=Sorghum bicolor RepID=EXTN_SORBI
          Length = 283

 Score =  108 bits (271), Expect = 1e-22
 Identities = 71/139 (51%), Positives = 72/139 (51%), Gaps = 22/139 (15%)
 Frame = +1

Query: 7   KPPVYKPP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           K PVY PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPVY P   KPPV
Sbjct: 101 KSPVYPPPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPVYTPS-PKPPV 155

Query: 169 YKPPVEK--PPVY----KPPVEKPPVY----KPPVEK--PPVY----KPPVEKPPVYKPP 300
            KPP  K  PPVY    KPPV KPP +    KPP  K  PPVY    KPP   PP Y  P
Sbjct: 156 TKPPTPKPTPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTPSPKPPKPSPPTY-TP 214

Query: 301 VEKPPVYKPPVEKPPVYKP 357
             KPP  KPP   P   KP
Sbjct: 215 TPKPPATKPPTSTPTHPKP 233

 Score =  106 bits (265), Expect = 7e-22
 Identities = 69/131 (52%), Positives = 69/131 (52%), Gaps = 15/131 (11%)
 Frame = +1

Query: 10  PPVYKP-PVEKPPVYKPP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           PP Y P P  K PVY PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPV
Sbjct: 91  PPTYTPSPKPKSPVYPPPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPV 146

Query: 169 YKPPVEKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEK--PPVY----K 324
           Y P   KPPV KPP  KP  PVY P   KPPV KPP   P   KPP  K  PPVY    K
Sbjct: 147 YTPS-PKPPVTKPPTPKPTPPVYTPN-PKPPVTKPPTHTPSP-KPPTSKPTPPVYTPSPK 203

Query: 325 PPVEKPPVYKP 357
           PP   PP Y P
Sbjct: 204 PPKPSPPTYTP 214

 Score =  104 bits (260), Expect = 3e-21
 Identities = 68/145 (46%), Positives = 69/145 (47%), Gaps = 27/145 (18%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVY----KPPVEKPPVYKP------PVEKPPVYKPPVEKPPVYKPPVE 156
           KPP  KPP   PPVY    KPPV KPP  KP      P  KPPV KPP   P   KPP  
Sbjct: 135 KPPATKPPT--PPVYTPSPKPPVTKPPTPKPTPPVYTPNPKPPVTKPPTHTPSP-KPPTS 191

Query: 157 K--PPVY----KPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYK--- 294
           K  PPVY    KPP   PP Y    KPP  KPP   P   KP  + P P   PP YK   
Sbjct: 192 KPTPPVYTPSPKPPKPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPYPQAHPPTYKPAP 251

Query: 295 ---PPVEKPPVYKPPVEKPPVYKPP 360
              PP   PP Y PPV   P   PP
Sbjct: 252 KPSPPAPTPPTYTPPVSHTPSSPPP 276

 Score =  101 bits (252), Expect = 2e-20
 Identities = 70/150 (46%), Positives = 71/150 (47%), Gaps = 33/150 (22%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVY-------KPPVEK---PPVYKP----------PVEKPPVYKP-PV 123
           KPP   P  EKPP         KPP E    PP Y P          P   PP Y P P 
Sbjct: 40  KPPAKGPKPEKPPTKGHGHKPEKPPKEHKPTPPTYTPSPKPTPPPATPKPTPPTYTPSPK 99

Query: 124 EKPPVYKPP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 285
            K PVY PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPVY P   KPP
Sbjct: 100 PKSPVYPPPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPVYTPS-PKPP 154

Query: 286 VYKPPVEK--PPVY----KPPVEKPPVYKP 357
           V KPP  K  PPVY    KPPV KPP + P
Sbjct: 155 VTKPPTPKPTPPVYTPNPKPPVTKPPTHTP 184

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 60/137 (43%), Positives = 61/137 (44%), Gaps = 22/137 (16%)
 Frame = +1

Query: 7   KPPVYKPPVEKP-----------PVYKPPVEKPPVYKPPVEK--PPVY----KPPVEKPP 135
           KPPV KPP  KP           PV KPP   P   KPP  K  PPVY    KPP   PP
Sbjct: 152 KPPVTKPPTPKPTPPVYTPNPKPPVTKPPTHTPSP-KPPTSKPTPPVYTPSPKPPKPSPP 210

Query: 136 VY----KPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 300
            Y    KPP  KPP   P   KP  + P P   PP YKP     P   PP   PP Y PP
Sbjct: 211 TYTPTPKPPATKPPTSTPTHPKPTPHTPYPQAHPPTYKP----APKPSPPAPTPPTYTPP 266

Query: 301 VEKPPVYKPPVEKPPVY 351
           V   P   PP   PP Y
Sbjct: 267 VSHTPSSPPPPPPPPYY 283

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 60/131 (45%), Positives = 61/131 (46%), Gaps = 17/131 (12%)
 Frame = +1

Query: 19  YKPPVEKPPVYKPPVEKPPVY-------KPPVEK---PPVYKPPVEKPPVYKPPVEKPPV 168
           Y  P  KPP   P  EKPP         KPP E    PP Y P  +  P    P   PP 
Sbjct: 34  YPTPTPKPPAKGPKPEKPPTKGHGHKPEKPPKEHKPTPPTYTPSPKPTPPPATPKPTPPT 93

Query: 169 YKP-PVEKPPVYKPP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 327
           Y P P  K PVY PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPVY P
Sbjct: 94  YTPSPKPKSPVYPPPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPVYTP 149

Query: 328 PVEKPPVYKPP 360
              KPPV KPP
Sbjct: 150 S-PKPPVTKPP 159

[116][TOP]
>UniRef100_Q8H9E0 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Solanum
           tuberosum RepID=Q8H9E0_SOLTU
          Length = 217

 Score =  108 bits (270), Expect = 2e-22
 Identities = 61/119 (51%), Positives = 62/119 (52%), Gaps = 2/119 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     
Sbjct: 85  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 144

Query: 190 PPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPVYK     PPV  YK P   PPVYK     PPVYK     PPVYK     PPV+K P
Sbjct: 145 PPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSP 203

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/117 (52%), Positives = 61/117 (52%), Gaps = 2/117 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PPVYK     PPVYK   P   PPVYK     PPVYK     PPVYK     PPVYK   
Sbjct: 43  PPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS 102

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
             PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK
Sbjct: 103 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYK 159

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/117 (52%), Positives = 61/117 (52%), Gaps = 2/117 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     
Sbjct: 65  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 124

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYK 354
           PPVYK     PPVYK     PPVYK     PPV  YK P   PPVYK     PPVYK
Sbjct: 125 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYK 181

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/117 (52%), Positives = 61/117 (52%), Gaps = 2/117 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     
Sbjct: 75  PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 134

Query: 190 PPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PPVYK     PPVYK     PPV  YK P   PPVYK     PPVYK     PPVYK
Sbjct: 135 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYK 191

 Score =  107 bits (266), Expect = 5e-22
 Identities = 62/119 (52%), Positives = 62/119 (52%), Gaps = 4/119 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKP 177
           PPVYK     PPVYK   P   PPVYK     PPV  YK P   PPVYK     PPVYK 
Sbjct: 21  PPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKY 80

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
               PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK
Sbjct: 81  KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYK 139

 Score =  107 bits (266), Expect = 5e-22
 Identities = 62/119 (52%), Positives = 62/119 (52%), Gaps = 4/119 (3%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 177
           PPVYK   P   PPVYK     PPVYK   P   PPVYK     PPVYK     PPVYK 
Sbjct: 31  PPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKY 90

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
               PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK
Sbjct: 91  KSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYK 149

 Score =  107 bits (266), Expect = 5e-22
 Identities = 62/119 (52%), Positives = 62/119 (52%), Gaps = 4/119 (3%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PPVYK   P   PPVYK     PPVYK     PPVYK     PPVYK     PPVYK   
Sbjct: 53  PPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKS 112

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYK 354
             PPVYK     PPVYK     PPVYK     PPVYK     PPV  YK P   PPVYK
Sbjct: 113 PPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYK 171

 Score =  105 bits (263), Expect = 1e-21
 Identities = 63/121 (52%), Positives = 63/121 (52%), Gaps = 6/121 (4%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPV--YKPPVEKPPVY 171
           PPVYK   P   PPVYK     PPVYK   P   PPVYK     PPV  YK P   PPVY
Sbjct: 9   PPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVY 68

Query: 172 KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
           K     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVY
Sbjct: 69  KYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVY 128

Query: 352 K 354
           K
Sbjct: 129 K 129

 Score =  100 bits (249), Expect = 5e-20
 Identities = 61/119 (51%), Positives = 61/119 (51%), Gaps = 6/119 (5%)
 Frame = +1

Query: 16  VYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPV--YKP 177
           VYK     PPVYK   P   PPVYK     PPV  YK P   PPVYK     PPV  YK 
Sbjct: 1   VYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKS 60

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P   PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK
Sbjct: 61  PPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYK 119

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 56/117 (47%), Positives = 57/117 (48%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     
Sbjct: 105 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYK----- 159

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
              YK P   PPVYK     PPVYK     PPVYK     PPV+K P   P  Y  P
Sbjct: 160 ---YKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPA--PYYYTSP 211

[117][TOP]
>UniRef100_Q39600 Extensin n=1 Tax=Catharanthus roseus RepID=Q39600_CATRO
          Length = 217

 Score =  108 bits (270), Expect = 2e-22
 Identities = 69/142 (48%), Positives = 78/142 (54%), Gaps = 25/142 (17%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK-------PPVEKPP--VYKPPVEKPPVYKPPVEKP 162
           PP++K P   P VYK P   PPVYK       PPV K P  +YK P   PP+YK P   P
Sbjct: 61  PPIHKSPPPPPYVYKSPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSP--PP 118

Query: 163 PVYK--PPVEKPPVYKPPVEKPPVYKP----PVEKPPVYKPP-----VEK---PPVYK-- 294
           PVYK  PP + P VYK P   PPVYK       +KP VYK P     V K   PPVYK  
Sbjct: 119 PVYKSPPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPPPPVYKSP 178

Query: 295 PPVEKPPVYKPPVEKPPVYKPP 360
           PP +KP VYK P   PP++K P
Sbjct: 179 PPPKKPYVYKSPPPPPPIHKSP 200

 Score =  102 bits (255), Expect = 1e-20
 Identities = 60/121 (49%), Positives = 67/121 (55%), Gaps = 6/121 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKP 177
           PP Y      PPV+ PP   PPVYK   P   PP++K P   P VYK P   PPV  YK 
Sbjct: 31  PPPYHYSSPPPPVHSPP--PPPVYKYKSPPPPPPIHKSPPPPPYVYKSPPPPPPVYKYKS 88

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVY 351
           P   PPV+K P   P +YK P   PP+YK P   PPVYK  PP + P VYK P   PPVY
Sbjct: 89  PPPPPPVHKYP---PYIYKSPPPPPPIYKSP--PPPVYKSPPPPKNPYVYKSPPPPPPVY 143

Query: 352 K 354
           K
Sbjct: 144 K 144

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 66/131 (50%), Positives = 73/131 (55%), Gaps = 17/131 (12%)
 Frame = +1

Query: 10  PPVYK-------PPVEKPP--VYKPPVEKPPVYKPPVEKPPVYK-PPVEKPP-VYKPPVE 156
           PPVYK       PPV K P  +YK P   PP+YK P   PPVYK PP  K P VYK P  
Sbjct: 81  PPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSP--PPPVYKSPPPPKNPYVYKSPPP 138

Query: 157 KPPVYK----PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPV 318
            PPVYK       +KP VYK P   P V+K P   PPVYK  PP +KP VYK P   PP+
Sbjct: 139 PPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSP--PPPVYKSPPPPKKPYVYKSPPPPPPI 196

Query: 319 YKPPVEKPPVY 351
           +K P   PP Y
Sbjct: 197 HKSP---PPPY 204

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 58/120 (48%), Positives = 66/120 (55%), Gaps = 8/120 (6%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKP----PVEKPPVY 171
           P +YK P   PP+YK P   PPVYK  PP + P VYK P   PPVYK       +KP VY
Sbjct: 100 PYIYKSPPPPPPIYKSP--PPPVYKSPPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVY 157

Query: 172 KPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           K P   P V+K P   PPVYK  PP +KP VYK P   PP++K P   PP Y      PP
Sbjct: 158 KSPPPPPFVHKSP--PPPVYKSPPPPKKPYVYKSPPPPPPIHKSP---PPPYHYYYSSPP 212

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 53/110 (48%), Positives = 59/110 (53%), Gaps = 13/110 (11%)
 Frame = +1

Query: 70  PPVYKPPVEKPPVYKPPVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYK--- 234
           PP Y      PPV+ PP   PPVYK   P   PP++K P   P VYK P   PPVYK   
Sbjct: 31  PPPYHYSSPPPPVHSPP--PPPVYKYKSPPPPPPIHKSPPPPPYVYKSPPPPPPVYKYKS 88

Query: 235 ----PPVEK--PPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPP 360
               PPV K  P +YK P   PP+YK P   PPVYK  PP + P VYK P
Sbjct: 89  PPPPPPVHKYPPYIYKSPPPPPPIYKSP--PPPVYKSPPPPKNPYVYKSP 136

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 47/107 (43%), Positives = 53/107 (49%)
 Frame = +1

Query: 40  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 219
           PP Y      PPV+ PP   PPVYK        YK P   PP++K P   P VYK P   
Sbjct: 31  PPPYHYSSPPPPVHSPP--PPPVYK--------YKSPPPPPPIHKSPPPPPYVYKSPPPP 80

Query: 220 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPVYK        YK P   PPV+K P   P +YK P   PP+YK P
Sbjct: 81  PPVYK--------YKSPPPPPPVHKYP---PYIYKSPPPPPPIYKSP 116

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 42/90 (46%), Positives = 48/90 (53%), Gaps = 6/90 (6%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPP 165
           + P VYK P   PPVYK       +KP VYK P   P V+K P   PPVYK  PP +KP 
Sbjct: 128 KNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSP--PPPVYKSPPPPKKPY 185

Query: 166 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 255
           VYK P   PP++K P   PP Y      PP
Sbjct: 186 VYKSPPPPPPIHKSP---PPPYHYYYSSPP 212

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 33/67 (49%), Positives = 38/67 (56%), Gaps = 2/67 (2%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 174
           Q+KP VYK P   P V+K P   PPVYK  PP +KP VYK P   PP++K P   PP Y 
Sbjct: 151 QKKPYVYKSPPPPPFVHKSP--PPPVYKSPPPPKKPYVYKSPPPPPPIHKSP---PPPYH 205

Query: 175 PPVEKPP 195
                PP
Sbjct: 206 YYYSSPP 212

[118][TOP]
>UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RZI2_RICCO
          Length = 829

 Score =  108 bits (269), Expect = 2e-22
 Identities = 63/128 (49%), Positives = 71/128 (55%), Gaps = 11/128 (8%)
 Frame = +1

Query: 10  PPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKP 177
           PPVY PP   PP  V+ PP   PPVY PP   PP  V+ PP   PPV+ PP   PPV+ P
Sbjct: 665 PPVYSPPPPSPPPPVHSPP---PPVYSPPPPSPPPPVHSPP---PPVHSPP---PPVHSP 715

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEK--PPVYKPP-----VEKPPVYKPPVEKPPVYKPPVE 336
           P   PPVY PP   PP   PP+    PPVY PP        PPV+ PP   PPV+ PP  
Sbjct: 716 P---PPVYSPPPPSPPSPPPPMHSPPPPVYSPPPPPVRSPPPPVHSPP---PPVHSPP-- 767

Query: 337 KPPVYKPP 360
            PP+Y PP
Sbjct: 768 -PPIYSPP 774

 Score =  105 bits (263), Expect = 1e-21
 Identities = 63/123 (51%), Positives = 69/123 (56%), Gaps = 6/123 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKP 177
           PPV  PP   PPVY PP   PP  V+ PP   PPVY PP   PP  V+ PP   PPV+ P
Sbjct: 658 PPVNSPP---PPVYSPPPPSPPPPVHSPP---PPVYSPPPPSPPPPVHSPP---PPVHSP 708

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVEKPPVY 351
           P   PPV+ PP   PPVY PP   PP   PP+    PPVY PP   PPV  PP   PPV+
Sbjct: 709 P---PPVHSPP---PPVYSPPPPSPPSPPPPMHSPPPPVYSPP--PPPVRSPP---PPVH 757

Query: 352 KPP 360
            PP
Sbjct: 758 SPP 760

 Score =  105 bits (262), Expect = 2e-21
 Identities = 61/121 (50%), Positives = 69/121 (57%), Gaps = 4/121 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PPVY PP   PP  V+ PP   PPV+ PP   PPV+ PP   PPVY PP   PP   PP+
Sbjct: 684 PPVYSPPPPSPPPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPPPPSPPSPPPPM 734

Query: 184 EKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
             PP  VY PP   PPV  PP   PPV+ PP   PPV+ PP   PP+Y PP   PP + P
Sbjct: 735 HSPPPPVYSPP--PPPVRSPP---PPVHSPP---PPVHSPP---PPIYSPP---PPRFSP 780

Query: 358 P 360
           P
Sbjct: 781 P 781

 Score =  103 bits (256), Expect = 8e-21
 Identities = 62/123 (50%), Positives = 67/123 (54%), Gaps = 6/123 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEK--PPVYKP 177
           PP   PP   PPV  PP   PPVY PP   PP  V+ PP   PPVY PP     PPV+ P
Sbjct: 651 PPTQSPP---PPVNSPP---PPVYSPPPPSPPPPVHSPP---PPVYSPPPPSPPPPVHSP 701

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPPVY 351
           P   PPV+ PP   PPV+ PP   PPVY PP   PP   PP+    PPVY PP   PPV 
Sbjct: 702 P---PPVHSPP---PPVHSPP---PPVYSPPPPSPPSPPPPMHSPPPPVYSPP--PPPVR 750

Query: 352 KPP 360
            PP
Sbjct: 751 SPP 753

 Score =  102 bits (253), Expect = 2e-20
 Identities = 59/119 (49%), Positives = 68/119 (57%), Gaps = 2/119 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPV 183
           PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PP   PP+    PPVY PP 
Sbjct: 696 PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPPPPSPPSPPPPMHSPPPPVYSPP- 745

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV  PP   PPV+ PP   PPV+ PP   PP+Y PP   PP + PP   PP + PP
Sbjct: 746 -PPPVRSPP---PPVHSPP---PPVHSPP---PPIYSPP---PPRFSPP---PPRFSPP 788

 Score =  100 bits (250), Expect = 4e-20
 Identities = 61/123 (49%), Positives = 66/123 (53%), Gaps = 6/123 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPV 183
           PP   PP   PP   PP   PPV  PP   PPVY PP   PP  V+ PP   PPVY PP 
Sbjct: 644 PPGQSPP---PPTQSPP---PPVNSPP---PPVYSPPPPSPPPPVHSPP---PPVYSPPP 691

Query: 184 EK--PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK--PPVY 351
               PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PP   PP+    PPVY
Sbjct: 692 PSPPPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPPPPSPPSPPPPMHSPPPPVY 742

Query: 352 KPP 360
            PP
Sbjct: 743 SPP 745

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 58/119 (48%), Positives = 66/119 (55%), Gaps = 2/119 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPV 183
           PPV+ PP   PPV+ PP   PPVY PP   PP   PP+  PP  VY PP   PPV  PP 
Sbjct: 703 PPVHSPP---PPVHSPP---PPVYSPPPPSPPSPPPPMHSPPPPVYSPP--PPPVRSPP- 753

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV+ PP   PPV+ PP   PP+Y PP   PP + PP   PP + PP   PP   PP
Sbjct: 754 --PPVHSPP---PPVHSPP---PPIYSPP---PPRFSPP---PPRFSPP---PPTSSPP 795

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 57/119 (47%), Positives = 64/119 (53%), Gaps = 2/119 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPV 183
           PPV+ PP   PPVY PP   PP   PP+  PP  VY PP   PPV  PP   PPV+ PP 
Sbjct: 710 PPVHSPP---PPVYSPPPPSPPSPPPPMHSPPPPVYSPP--PPPVRSPP---PPVHSPP- 760

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV+ PP   PP+Y PP   PP + PP   PP + PP   PP   PP   P V  PP
Sbjct: 761 --PPVHSPP---PPIYSPP---PPRFSPP---PPRFSPP---PPTSSPP-PTPTVAAPP 804

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 57/120 (47%), Positives = 60/120 (50%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           Q  PP        PP   PP   PP   PP   PPV  PP   PPVY PP   PP   PP
Sbjct: 631 QSPPPTTPEQSPSPPGQSPP---PPTQSPP---PPVNSPP---PPVYSPPPPSPP---PP 678

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           V  PP   PPV  PP   PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP
Sbjct: 679 VHSPP---PPVYSPP---PPSPPPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP 723

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 52/122 (42%), Positives = 58/122 (47%), Gaps = 10/122 (8%)
 Frame = +1

Query: 10   PPVYKPPVEKPPVYKPPVEKPP--VYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPV 168
            PPVY PP   PP   PP+  PP  VY PP        PPV+ PP   PPV+ PP   PP+
Sbjct: 717  PPVYSPPPPSPPSPPPPMHSPPPPVYSPPPPPVRSPPPPVHSPP---PPVHSPP---PPI 770

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK---PPVYKPPVEK 339
            Y PP   PP + PP   PP + PP   PP   PP   P V  PP E    PP        
Sbjct: 771  YSPP---PPRFSPP---PPRFSPP---PPTSSPP-PTPTVAAPPPEDFILPPNIGFQYSS 820

Query: 340  PP 345
            PP
Sbjct: 821  PP 822

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 49/122 (40%), Positives = 57/122 (46%), Gaps = 3/122 (2%)
 Frame = +1

Query: 4   EKPPVYKPPVE-KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 174
           E  P   P  E + P   P  E P      P +E+ P   PP + PP   P  E+ P   
Sbjct: 590 EPSPTPSPESEPQSPTSTPSPESPLSSPTSPTLEQSP--SPPGQSPPPTTP--EQSP--S 643

Query: 175 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           PP + PP   PP + PP   PPV  PP   PPV  PP   PP   PPV+ PP   PPVY 
Sbjct: 644 PPGQSPP---PPTQSPP---PPVNSPP---PPVYSPP---PPSPPPPVHSPP---PPVYS 688

Query: 355 PP 360
           PP
Sbjct: 689 PP 690

[119][TOP]
>UniRef100_A8WLZ2 Putative uncharacterized protein (Fragment) n=1 Tax=Caenorhabditis
           briggsae AF16 RepID=A8WLZ2_CAEBR
          Length = 1042

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/124 (49%), Positives = 72/124 (58%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV
Sbjct: 225 EEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPV 284

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            + PVE  PV   PVE+ PV+  PVE  PV + PVE  PV   PVE+ PV   PVE  PV
Sbjct: 285 KEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPV 344

Query: 349 YKPP 360
            + P
Sbjct: 345 EEKP 348

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/124 (49%), Positives = 72/124 (58%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV + PVE  PV
Sbjct: 235 EEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPV 294

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE+ PV+  PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV
Sbjct: 295 EAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPV 354

Query: 349 YKPP 360
            + P
Sbjct: 355 EEKP 358

 Score =  107 bits (268), Expect = 3e-22
 Identities = 59/119 (49%), Positives = 69/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PV
Sbjct: 220 EAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPV 279

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PVE+ PV+  PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 280 EAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 338

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/119 (48%), Positives = 69/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE+ PV    VE  PV + PVE  PV + PVE  PV   PVE+ PV   PV
Sbjct: 200 EEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPV 259

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV + PVE  PV + PVE  PV   PVE+ PV+  PVE  PV + P
Sbjct: 260 EAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKP 318

 Score =  105 bits (262), Expect = 2e-21
 Identities = 60/124 (48%), Positives = 71/124 (57%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV + PVE  PV + PVE  PV   PVE+ PV+  PVE  PV + PVE  PV
Sbjct: 265 EEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPV 324

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE+ PV   PVE  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ PV
Sbjct: 325 EAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPV 384

Query: 349 YKPP 360
              P
Sbjct: 385 EAAP 388

 Score =  105 bits (262), Expect = 2e-21
 Identities = 60/124 (48%), Positives = 71/124 (57%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV + PVE  PV   PVE+ PV+  PVE  PV + PVE  PV   PVE+ PV
Sbjct: 275 EEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPV 334

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   PVE  PV
Sbjct: 335 DAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPV 394

Query: 349 YKPP 360
            + P
Sbjct: 395 KEKP 398

 Score =  105 bits (261), Expect = 2e-21
 Identities = 58/119 (48%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV    VE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV
Sbjct: 210 EEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPV 269

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV + PVE  PV   PVE+ PV+  PVE  PV + PVE  PV   P
Sbjct: 270 EAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAP 328

 Score =  105 bits (261), Expect = 2e-21
 Identities = 58/119 (48%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV + PVE  PV + PVE  PV   PVE+ PV+  PVE  PV + PV
Sbjct: 260 EAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPV 319

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE+ PV   PVE  PV + PVE  PV + PVE   V   PVE+ PV   P
Sbjct: 320 EAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAP 378

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/119 (48%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV + PVE  PV + PVE  PV + PVE  PV   PVE+ PV+  PV
Sbjct: 250 EEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPV 309

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE   V   P
Sbjct: 310 EAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAP 368

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/119 (48%), Positives = 68/119 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV+  PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PV
Sbjct: 300 EEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPV 359

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 360 EAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 418

 Score =  104 bits (259), Expect = 3e-21
 Identities = 58/119 (48%), Positives = 67/119 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE+ PV+  PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV
Sbjct: 290 EAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPV 349

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 350 EAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 408

 Score =  104 bits (259), Expect = 3e-21
 Identities = 60/124 (48%), Positives = 69/124 (55%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV   PVE+ PV   PVE  PV   PVE+ PV   P E  PV + PVE  PV
Sbjct: 643  EEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPV 702

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV
Sbjct: 703  EAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPV 762

Query: 349  YKPP 360
             + P
Sbjct: 763  KEKP 766

 Score =  104 bits (259), Expect = 3e-21
 Identities = 58/119 (48%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   P E  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   PV
Sbjct: 678  EEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPV 737

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + P
Sbjct: 738  EEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKP 796

 Score =  104 bits (259), Expect = 3e-21
 Identities = 58/119 (48%), Positives = 67/119 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   PV
Sbjct: 688  EAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPV 747

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   P
Sbjct: 748  EEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAP 806

 Score =  103 bits (258), Expect = 5e-21
 Identities = 58/119 (48%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   P 
Sbjct: 628 EEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPF 687

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   P
Sbjct: 688 EAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAP 746

 Score =  103 bits (258), Expect = 5e-21
 Identities = 58/119 (48%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   P E  PV + PV
Sbjct: 638 EAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPV 697

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV   P
Sbjct: 698 EAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAP 756

 Score =  103 bits (258), Expect = 5e-21
 Identities = 58/119 (48%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE  PV   PVE+ PV   P E  PV + PVE  PV   PVE+ PV   PV
Sbjct: 658  EEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPV 717

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 718  EAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 776

 Score =  103 bits (257), Expect = 6e-21
 Identities = 59/124 (47%), Positives = 69/124 (55%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  P 
Sbjct: 628 EEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPF 687

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PV+  PV + PVE  PV
Sbjct: 688 EAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPV 747

Query: 349 YKPP 360
            + P
Sbjct: 748 EEKP 751

 Score =  103 bits (257), Expect = 6e-21
 Identities = 58/119 (48%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV   PVE+ PV   P E  PV + PVE  PV   PVE+ PV   PVE  PV   PV
Sbjct: 668  EAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPV 727

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 728  EEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 786

 Score =  103 bits (256), Expect = 8e-21
 Identities = 57/119 (47%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PV
Sbjct: 623 EAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPV 682

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  P    PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PV+  PV + P
Sbjct: 683 EAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKP 741

 Score =  102 bits (254), Expect = 1e-20
 Identities = 59/124 (47%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP     V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PVE  PV
Sbjct: 185 EEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPV 244

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE+ PV   PVE  PV + PVE  PV + PVE  PV + PVE  PV   PVE+ PV
Sbjct: 245 EAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPV 304

Query: 349 YKPP 360
           +  P
Sbjct: 305 HAAP 308

 Score =  102 bits (253), Expect = 2e-20
 Identities = 58/124 (46%), Positives = 69/124 (55%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV   PVE  PV + PVE  P    PVE+ PV   PVE  PV + PVE  PV
Sbjct: 658  EEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPV 717

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PVE  PV + PV+  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV
Sbjct: 718  EAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPV 777

Query: 349  YKPP 360
             + P
Sbjct: 778  EEKP 781

 Score =  101 bits (252), Expect = 2e-20
 Identities = 56/119 (47%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV   PVE  PV + PVE  P    PVE+ PV   PVE  PV + PV
Sbjct: 653  EAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPV 712

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV   PVE  PV + PV+  PV + PVE  PV + PVE  PV   PV++ PV   P
Sbjct: 713  EAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 771

 Score =  101 bits (251), Expect = 3e-20
 Identities = 57/115 (49%), Positives = 65/115 (56%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE   V   PV
Sbjct: 310 EAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPV 369

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           E+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV
Sbjct: 370 EEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPV 424

 Score =  101 bits (251), Expect = 3e-20
 Identities = 57/119 (47%), Positives = 65/119 (54%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV    VE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 613 EEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPV 672

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  P    PVE+ PV   PVE  PV + PVE  PV   PVE  PV + P
Sbjct: 673 EAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKP 731

 Score =  101 bits (251), Expect = 3e-20
 Identities = 57/119 (47%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PV
Sbjct: 708  EETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPV 767

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV   PVE+ PV   PVE  PV + PV+  PV   PVE   V   PVE+ PV   P
Sbjct: 768  EAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAP 826

 Score =  100 bits (250), Expect = 4e-20
 Identities = 59/124 (47%), Positives = 68/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV   PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV
Sbjct: 693  EEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPV 752

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   PVE   V
Sbjct: 753  EAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQV 812

Query: 349  YKPP 360
               P
Sbjct: 813  EAAP 816

 Score =  100 bits (249), Expect = 5e-20
 Identities = 59/124 (47%), Positives = 67/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP     V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV
Sbjct: 613 EEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPV 672

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE+ PV   P E  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV
Sbjct: 673 EAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPV 732

Query: 349 YKPP 360
              P
Sbjct: 733 DAAP 736

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/119 (46%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  P    PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PV
Sbjct: 673  EAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPV 732

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   P
Sbjct: 733  DAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 791

 Score =  100 bits (249), Expect = 5e-20
 Identities = 57/124 (45%), Positives = 69/124 (55%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    P    PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PV+  PV
Sbjct: 678  EEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPV 737

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
             + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PVE+ PV
Sbjct: 738  EEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPV 797

Query: 349  YKPP 360
               P
Sbjct: 798  DAAP 801

 Score =  100 bits (248), Expect = 7e-20
 Identities = 57/119 (47%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   PV
Sbjct: 330 EEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPV 389

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PVE+ PV   PVE  PV    VE  PV + PVE  PV + P
Sbjct: 390 EAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKP 448

 Score =  100 bits (248), Expect = 7e-20
 Identities = 56/115 (48%), Positives = 65/115 (56%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PV
Sbjct: 718  EAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPV 777

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            E+ PV   PVE  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ PV
Sbjct: 778  EEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPV 832

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 54/115 (46%), Positives = 66/115 (57%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PVE+ PV   PVE+ PV   PV++ PV   PVE  PV + PV
Sbjct: 245 EAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPV 304

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PV   PV++ PV   PVE  PV + PV+  PV   PVE+ PV   PVE+ PV
Sbjct: 305 HAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPV 359

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 57/119 (47%), Positives = 65/119 (54%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE+ PV   PVE  PV + PVE  PV + PVE   V   PVE+ PV   PV
Sbjct: 320 EAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPV 379

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV    VE  PV + P
Sbjct: 380 EEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKP 438

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 56/116 (48%), Positives = 63/116 (54%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV + PVE   V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  
Sbjct: 611 PVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAA 670

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PV   PVE+ PV   P E  PV + PVE  PV   PVE+ PV   PVE  PV   P
Sbjct: 671 PVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAP 726

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 56/119 (47%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE  PV + PV+   V   PVE+ PV   PVE+ PV    VE  PV + PV
Sbjct: 170 EAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPV 229

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV + P
Sbjct: 230 EAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKP 288

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 56/119 (47%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PV+   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PV
Sbjct: 180 EVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPV 239

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV + PVE  PV   P
Sbjct: 240 EAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAP 298

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 56/116 (48%), Positives = 63/116 (54%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV   PVE+ PV    VE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  
Sbjct: 606 PVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAA 665

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PV   PVE  PV + PVE  P    PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 666 PVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAP 721

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/119 (46%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV   PVE  PV + PV+  PV + PVE  PV + PVE  PV   PV
Sbjct: 703  EAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPV 762

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            ++ PV   PVE  PV + PV+  PV   PVE+ PV   PVE  PV    VE  PV + P
Sbjct: 763  KEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKP 821

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/119 (46%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV   PVE  PV + PV+  PV + PVE  PV + PVE  PV   PV++ PV   PV
Sbjct: 713  EAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPV 772

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PV+  PV   PVE+ PV   PVE  PV    VE  PV + PVE  PV + P
Sbjct: 773  EAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKP 831

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 56/119 (47%), Positives = 66/119 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PV
Sbjct: 728  EEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPV 787

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ PV    VE  PV + P
Sbjct: 788  EAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKP 846

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 56/119 (47%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE+ PV    VE  PV + PVE  PV + PVE   V   PVE+ PV   PV
Sbjct: 175 EAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPV 234

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PV++ PV   P
Sbjct: 235 EEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAP 293

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 56/124 (45%), Positives = 69/124 (55%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV   PV++ PV   PVE  PV + PV+  PV   PVE+ PV   PVE+ PV
Sbjct: 300 EEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPV 359

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               VE  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV
Sbjct: 360 EAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPV 419

Query: 349 YKPP 360
              P
Sbjct: 420 EAAP 423

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 56/119 (47%), Positives = 65/119 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV
Sbjct: 738  EEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPV 797

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +  PV   PVE   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV   P
Sbjct: 798  DAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAP 856

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 54/119 (45%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PV   PV   PV++ PV   PVE  PV + PV+  PV   PVE+ PV   PV
Sbjct: 295 EAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPV 354

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV    VE  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + P
Sbjct: 355 EEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 413

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 55/119 (46%), Positives = 66/119 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV    V
Sbjct: 370 EEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQV 429

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV + PV+   V   PV++ PV   PVE  PV + PVE  PV + P
Sbjct: 430 EAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKP 488

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 56/120 (46%), Positives = 67/120 (55%), Gaps = 4/120 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PVE  PV
Sbjct: 330 EEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPV 389

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PV++ PV   PVE  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ PV
Sbjct: 390 EAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPV 449

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 55/119 (46%), Positives = 65/119 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   PV
Sbjct: 748  EEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPV 807

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV   PV++ PV   P
Sbjct: 808  EAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAP 866

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 58/124 (46%), Positives = 67/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV + PVE   V   PVE  PV   PVE+ PV    VE  PV + PVE  PV
Sbjct: 150 EEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPV 209

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV
Sbjct: 210 EEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPV 269

Query: 349 YKPP 360
              P
Sbjct: 270 EAAP 273

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 58/124 (46%), Positives = 67/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP     V   PVE  PV   PVE+ PV    VE  PV + PVE  PV + PVE   V
Sbjct: 160 EEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQV 219

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE+ PV
Sbjct: 220 EAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPV 279

Query: 349 YKPP 360
              P
Sbjct: 280 EAAP 283

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 54/119 (45%), Positives = 65/119 (54%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PV+  PV   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PV
Sbjct: 325 EAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPV 384

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PV++ PV   PVE  PV + PV+  PV   PVE   V   PVE+ PV   P
Sbjct: 385 EAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAP 443

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 55/119 (46%), Positives = 65/119 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   PVE   V   PV
Sbjct: 758  EAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPV 817

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E+ PV   PVE+ PV    VE  PV + PVE  PV   PV++ PV   PVE+ PV   P
Sbjct: 818  EEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAP 876

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 55/119 (46%), Positives = 65/119 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV   PVE+ PV   PVE  PV + PV+  PV   PVE   V   PVE+ PV   PV
Sbjct: 768  EAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPV 827

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E+ PV    VE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV + P
Sbjct: 828  EEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKP 886

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 56/119 (47%), Positives = 64/119 (53%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV + PVE   V   PVE  PV   PVE+ PV    VE  PV + PV
Sbjct: 145 EAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPV 204

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 205 EAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAP 263

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/119 (45%), Positives = 65/119 (54%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV    VE  PV + PV
Sbjct: 380 EEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPV 439

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PV+   V   PV++ PV   PVE  PV + PVE  PV + PV+  PV   P
Sbjct: 440 EAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAP 498

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/119 (46%), Positives = 64/119 (53%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + PV
Sbjct: 340 EAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPV 399

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV+   V   P
Sbjct: 400 EAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAP 458

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 54/119 (45%), Positives = 65/119 (54%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PV
Sbjct: 365 EAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPV 424

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV   PV++ PV   P
Sbjct: 425 EAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAP 483

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 56/124 (45%), Positives = 68/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PVE   V
Sbjct: 370 EEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQV 429

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE+ PV   PVE+ PV    VE  PV + PVE  PV   PV++ PV   PVE+ PV
Sbjct: 430 EAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPV 489

Query: 349 YKPP 360
              P
Sbjct: 490 DAAP 493

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 56/124 (45%), Positives = 68/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV   PV++ PV   PVE  PV + PV+  PV   PVE   V   PVE+ PV
Sbjct: 380 EEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPV 439

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE+ PV    VE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV
Sbjct: 440 EAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPV 499

Query: 349 YKPP 360
            + P
Sbjct: 500 EEKP 503

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 54/119 (45%), Positives = 65/119 (54%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV   PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV
Sbjct: 390 EAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPV 449

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           +   V   PV++ PV   PVE  PV + PVE  PV + PV+  PV   PVE+ PV   P
Sbjct: 450 DAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAP 508

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 53/119 (44%), Positives = 65/119 (54%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           ++ PV   PVE  PV + PV+  PV   PVE+ PV   PVE+ PV    VE  PV + PV
Sbjct: 315 KEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPV 374

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PVE   V   P
Sbjct: 375 EAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAP 433

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/119 (45%), Positives = 65/119 (54%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE+ PV    VE  PV + PVE  PV + PVE  PV   PV++ PV   PV
Sbjct: 345 EEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPV 404

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ PV    VE  PV + P
Sbjct: 405 EAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKP 463

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 53/119 (44%), Positives = 65/119 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PV+  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV
Sbjct: 723  EAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPV 782

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +  PV   PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV+   V   P
Sbjct: 783  DAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAP 841

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 55/124 (44%), Positives = 68/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV
Sbjct: 728  EEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPV 787

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV+   V   PV++ PV
Sbjct: 788  EAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPV 847

Query: 349  YKPP 360
               P
Sbjct: 848  EAAP 851

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 55/124 (44%), Positives = 68/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PVE+ PV
Sbjct: 738  EEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPV 797

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
               PVE  PV    VE  PV + PVE  PV + PV+   V   PV++ PV   PVE  PV
Sbjct: 798  DAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPV 857

Query: 349  YKPP 360
             + P
Sbjct: 858  KEKP 861

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 55/124 (44%), Positives = 68/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1    QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
            +EKP    PV   PV++ PV   PVE  PV + PV+  PV   PVE+ PV   PVE  PV
Sbjct: 748  EEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPV 807

Query: 169  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
                VE  PV + PVE  PV + PV+   V   PV++ PV   PVE  PV + PVE  PV
Sbjct: 808  EAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPV 867

Query: 349  YKPP 360
             + P
Sbjct: 868  EEKP 871

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 56/124 (45%), Positives = 67/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV
Sbjct: 345 EEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPV 404

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV+   V   PV++ PV
Sbjct: 405 EAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPV 464

Query: 349 YKPP 360
              P
Sbjct: 465 EAAP 468

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 56/124 (45%), Positives = 67/124 (54%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP     V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV
Sbjct: 355 EEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPV 414

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE  PV    VE  PV + PVE  PV + PV+   V   PV++ PV   PVE  PV
Sbjct: 415 DAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPV 474

Query: 349 YKPP 360
            + P
Sbjct: 475 KEKP 478

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 53/119 (44%), Positives = 65/119 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E  PV + PV+  PV   PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV
Sbjct: 773  EAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPV 832

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +   V   PV++ PV   PVE  PV + PVE  PV + PV+  PV   PVE+ PV   P
Sbjct: 833  DAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAP 891

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 55/119 (46%), Positives = 64/119 (53%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV    VE  PV + PVE  PV + PVE   V   PVE  PV   PVE+ PV    V
Sbjct: 135 EEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQV 194

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + P
Sbjct: 195 EAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 253

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 55/119 (46%), Positives = 64/119 (53%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE+ PV   PVE  PV + PVE   V   PVE+ PV   PVE+ PV    V
Sbjct: 85  EEKPVEAAPVEEEPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQV 144

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE  PV + PVE   V   PVE  PV   PVE+ PV    VE  PV + P
Sbjct: 145 EAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKP 203

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 55/119 (46%), Positives = 64/119 (53%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE  PV + PVE   V   PVE+ PV   PVE+ PV    VE  PV + PV
Sbjct: 95  EEEPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPV 154

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PVE   V   PVE  PV   PVE+ PV    VE  PV + PVE  PV + P
Sbjct: 155 EAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKP 213

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 55/119 (46%), Positives = 64/119 (53%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E+ PV   PVE+ PV    VE  PV + PVE  PV + PVE   V   PVE  PV   PV
Sbjct: 125 EEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPV 184

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E+ PV    VE  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   P
Sbjct: 185 EEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAP 243

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 52/119 (43%), Positives = 65/119 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            ++ PV   PVE  PV + PV+  PV   PVE+ PV   PVE  PV    VE  PV + PV
Sbjct: 763  KEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPV 822

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E  PV + PV+   V   PV++ PV   PVE  PV + PVE  PV + PV+  PV   P
Sbjct: 823  EAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAP 881

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 58/136 (42%), Positives = 67/136 (49%), Gaps = 17/136 (12%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----------------P 132
           E+ PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE                   
Sbjct: 546 EEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALK 605

Query: 133 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 312
           PV   PVE+ PV    VE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  
Sbjct: 606 PVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAA 665

Query: 313 PVYKPPVEKPPVYKPP 360
           PV   PVE  PV + P
Sbjct: 666 PVEAAPVEAAPVEEKP 681

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 52/115 (45%), Positives = 64/115 (55%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ PV    V
Sbjct: 778  EEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQV 837

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            E  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV + PV+  P+
Sbjct: 838  EAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPL 892

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/119 (44%), Positives = 64/119 (53%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE  PV + PV+   V   PVE+ PV   PVE+ PV    VE  PV   PV
Sbjct: 120 EAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPV 179

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV + PV+   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + P
Sbjct: 180 EVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKP 238

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 55/124 (44%), Positives = 66/124 (53%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV + PV+   V   PVE+ PV   PVE+ PV    VE  PV   PVE  PV
Sbjct: 125 EEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPV 184

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            + PV+   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PVE  PV
Sbjct: 185 EEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPV 244

Query: 349 YKPP 360
              P
Sbjct: 245 EAAP 248

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/115 (44%), Positives = 64/115 (55%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           ++ PV   PVE  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ PV    V
Sbjct: 395 KEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQV 454

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           E  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV + PV+  P+
Sbjct: 455 EAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPL 509

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/124 (44%), Positives = 66/124 (53%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP    PV + PVE  PV   PVE+ PV    VE  PV + PVE  PV + PV+   V
Sbjct: 85  EEKPVEAAPVEEEPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQV 144

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE+ PV   PVE+ PV    VE  PV   PVE  PV + PV+   V   PVE+ PV
Sbjct: 145 EAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPV 204

Query: 349 YKPP 360
              P
Sbjct: 205 EAAP 208

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 53/114 (46%), Positives = 62/114 (54%)
 Frame = +1

Query: 4    EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
            E+ PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE   V +  VE  PV    V
Sbjct: 929  EEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALV 988

Query: 184  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
            E+ PV   PVE+ PV    VE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 989  EEKPVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 1042

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 52/115 (45%), Positives = 62/115 (53%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE+ PV    VE  PV + PVE  PV + PV+   V   PVE+ PV   PV
Sbjct: 100 EAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPV 159

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           E+ PV    VE  PV   PVE  PV + PV+   V   PVE+ PV   PVE+ PV
Sbjct: 160 EEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPV 214

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 56/124 (45%), Positives = 65/124 (52%), Gaps = 4/124 (3%)
 Frame = +1

Query: 1   QEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 168
           +EKP     V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PVE   V
Sbjct: 110 EEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQV 169

Query: 169 YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
              PVE  PV   PVE+ PV    VE  PV + PVE  PV + PVE   V   PVE+ PV
Sbjct: 170 EAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPV 229

Query: 349 YKPP 360
              P
Sbjct: 230 EAAP 233

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 54/119 (45%), Positives = 62/119 (52%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV + PVE   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PV
Sbjct: 105 EAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPV 164

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E   V   PVE  PV   PVE+ PV    VE  PV + PVE  PV + PVE   V   P
Sbjct: 165 EAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAP 223

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 51/111 (45%), Positives = 60/111 (54%)
 Frame = +1

Query: 28   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 207
            PVE  PV + PVE  PV + PVE  PV + PVE  PV    VE+  V   PVE   V + 
Sbjct: 932  PVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALVEEK 991

Query: 208  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PV+  PV + PVE   V   PVE+ PV   PVE  PV + PVE  PV   P
Sbjct: 992  PVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 1042

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 50/109 (45%), Positives = 59/109 (54%)
 Frame = +1

Query: 34   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 213
            E+ PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE   V +  VE  PV    V
Sbjct: 929  EEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALV 988

Query: 214  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            E+ PV   PVE+ PV    VE  PV + PVE  PV   PVE+ PV   P
Sbjct: 989  EEKPVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 1037

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 57/126 (45%), Positives = 64/126 (50%), Gaps = 7/126 (5%)
 Frame = +1

Query: 4   EKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-P----PVEKP 162
           E+  V   PVE    PV   PVE+ PV    VE  PV + PVE  PV   P    PVE  
Sbjct: 591 EEKSVEAVPVEAALKPVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAA 650

Query: 163 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
           PV   PVE+ PV   PVE  PV   PVE+ PV   P E  PV + PVE  PV   PVE+ 
Sbjct: 651 PVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEET 710

Query: 343 PVYKPP 360
           PV   P
Sbjct: 711 PVEAAP 716

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 54/152 (35%), Positives = 67/152 (44%), Gaps = 36/152 (23%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           +EKP    P VE+ PV    VE  PV + PVE  PV   PV++ PV   PVE+ PV   P
Sbjct: 435 EEKPVEAAP-VEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAP 493

Query: 181 VEKPPVYKPPVEKPPVY------------------------------------KPPVEKP 252
           VE  PV + PV+  P+                                     + PVE  
Sbjct: 494 VEAAPVEEKPVDAAPLVFSKAEIFCGLELDLLMESSEFIEGNISRIPQISVTEEKPVEAA 553

Query: 253 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           PV + PVE  PV + PVE  PV + PVE  PV
Sbjct: 554 PVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPV 585

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 54/152 (35%), Positives = 67/152 (44%), Gaps = 36/152 (23%)
 Frame = +1

Query: 1    QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
            +EKP    P VE+ PV    VE  PV + PVE  PV   PV++ PV   PVE+ PV   P
Sbjct: 818  EEKPVEAAP-VEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAP 876

Query: 181  VEKPPVYKPPVEKPPVY------------------------------------KPPVEKP 252
            VE  PV + PV+  P+                                     + PVE  
Sbjct: 877  VEAAPVEEKPVDAAPLVFSKAETFCGLELDLLMESSEFIEGNISRIPQISVTEEKPVEAA 936

Query: 253  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
            PV + PVE  PV + PVE  PV + PVE  PV
Sbjct: 937  PVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPV 968

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 52/152 (34%), Positives = 65/152 (42%), Gaps = 40/152 (26%)
 Frame = +1

Query: 25  PPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P  EKP    PV + PV+   V   PV++ PV   PVE  PV + PVE  PV + PV+  
Sbjct: 433 PVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAA 492

Query: 193 PVYKPPVEKPPVYKPPV------------------------------------EKPPVYK 264
           PV   PVE+ PV   P+                                    E+ PV  
Sbjct: 493 PVEAAPVEEKPVDAAPLVFSKAEIFCGLELDLLMESSEFIEGNISRIPQISVTEEKPVEA 552

Query: 265 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            PVE+ PV   PVE+ PV   PVE+ PV   P
Sbjct: 553 APVEEEPVEAAPVEQKPVEAAPVEEKPVEAAP 584

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 52/152 (34%), Positives = 65/152 (42%), Gaps = 40/152 (26%)
 Frame = +1

Query: 25   PPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
            P  EKP    PV + PV+   V   PV++ PV   PVE  PV + PVE  PV + PV+  
Sbjct: 816  PVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAA 875

Query: 193  PVYKPPVEKPPVYKPPV------------------------------------EKPPVYK 264
            PV   PVE+ PV   P+                                    E+ PV  
Sbjct: 876  PVEAAPVEEKPVDAAPLVFSKAETFCGLELDLLMESSEFIEGNISRIPQISVTEEKPVEA 935

Query: 265  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PVE+ PV   PVE+ PV   PVE+ PV   P
Sbjct: 936  APVEEEPVEAAPVEQKPVEAAPVEEKPVEAAP 967

[120][TOP]
>UniRef100_B9T135 Lipid binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9T135_RICCO
          Length = 246

 Score =  107 bits (268), Expect = 3e-22
 Identities = 57/97 (58%), Positives = 64/97 (65%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP+ KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 53  PPIVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI- 108

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 300
           PPV KPP+  PPV  PPV KPP+  PPV  PPV   P
Sbjct: 109 PPVVKPPINLPPVI-PPVIKPPINLPPVTVPPVITNP 144

 Score =  107 bits (268), Expect = 3e-22
 Identities = 57/97 (58%), Positives = 64/97 (65%)
 Frame = +1

Query: 40  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 219
           PP+ KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 53  PPIVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI- 108

Query: 220 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 330
           PPV KPP+  PPV  PPV KPP+  PPV  PPV   P
Sbjct: 109 PPVVKPPINLPPVI-PPVIKPPINLPPVTVPPVITNP 144

 Score =  107 bits (268), Expect = 3e-22
 Identities = 57/97 (58%), Positives = 64/97 (65%)
 Frame = +1

Query: 70  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 249
           PP+ KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 53  PPIVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI- 108

Query: 250 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV KPP+  PPV  PPV KPP+  PPV  PPV   P
Sbjct: 109 PPVVKPPINLPPVI-PPVIKPPINLPPVTVPPVITNP 144

 Score =  106 bits (264), Expect = 9e-22
 Identities = 57/97 (58%), Positives = 64/97 (65%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           PP+ KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 53  PPIVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI- 108

Query: 205 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
           PPV KPP+  PPV  PPV KPP+  PPV  PPV   P
Sbjct: 109 PPVVKPPINLPPV-IPPVIKPPINLPPVTVPPVITNP 144

 Score =  106 bits (264), Expect = 9e-22
 Identities = 57/97 (58%), Positives = 64/97 (65%)
 Frame = +1

Query: 55  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 234
           PP+ KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 53  PPIVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI- 108

Query: 235 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           PPV KPP+  PPV  PPV KPP+  PPV  PPV   P
Sbjct: 109 PPVVKPPINLPPV-IPPVIKPPINLPPVTVPPVITNP 144

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/93 (59%), Positives = 61/93 (65%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV 
Sbjct: 57  KPPINLPPV-IPPVVKPPINLPPVI-PPVVKPPINLPPV-IPPVVKPPINLPPVI-PPVV 112

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 285
           KPP+  PPV  PPV KPP+  PPV  PPV   P
Sbjct: 113 KPPINLPPV-IPPVIKPPINLPPVTVPPVITNP 144

[121][TOP]
>UniRef100_A5E4F6 Putative uncharacterized protein n=1 Tax=Lodderomyces elongisporus
           RepID=A5E4F6_LODEL
          Length = 977

 Score =  107 bits (268), Expect = 3e-22
 Identities = 58/119 (48%), Positives = 59/119 (49%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PV+  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PV
Sbjct: 428 ESSPVESSPVKSTPVESSPVESSPVESSPVESSPVESSPVESTPVESSPVESTPVESTPV 487

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   P
Sbjct: 488 ESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVESSPVESTPVESSP 546

 Score =  106 bits (264), Expect = 9e-22
 Identities = 57/116 (49%), Positives = 58/116 (50%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV   PVE  PV   PV+  PV   PVE  PV   PVE  PV   PVE  PV   PVE  
Sbjct: 421 PVESSPVESSPVESSPVKSTPVESSPVESSPVESSPVESSPVESSPVESTPVESSPVEST 480

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   P
Sbjct: 481 PVESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVESSP 536

 Score =  106 bits (264), Expect = 9e-22
 Identities = 60/124 (48%), Positives = 60/124 (48%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PV
Sbjct: 448 ESSPVESSPVESSPVESSPVESTPVESSPVESTPVESTPVESSPVKSTPVESSPVKSTPV 507

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----PPVYKPPVEKPPV 348
           E  PV   PVE  PV   PVE  PV   PVE  PV   PVE      PPV   PVE  PV
Sbjct: 508 ESSPVKSTPVESSPVKSTPVESSPVESSPVESTPVESSPVESSIHIDPPVESSPVESTPV 567

Query: 349 YKPP 360
              P
Sbjct: 568 ESSP 571

 Score =  106 bits (264), Expect = 9e-22
 Identities = 60/124 (48%), Positives = 60/124 (48%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PV
Sbjct: 458 ESSPVESSPVESTPVESSPVESTPVESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPV 517

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPV 348
           E  PV   PVE  PV   PVE  PV   PVE      PPV   PVE  PV   PVE  PV
Sbjct: 518 ESSPVKSTPVESSPVESSPVESTPVESSPVESSIHIDPPVESSPVESTPVESSPVESTPV 577

Query: 349 YKPP 360
              P
Sbjct: 578 ESSP 581

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/119 (48%), Positives = 58/119 (48%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PV
Sbjct: 468 ESTPVESSPVESTPVESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVKSTPV 527

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE  PV   PVE      PPVE  PV   PVE  PV   PVE  PV   P
Sbjct: 528 ESSPVESSPVESTPVESSPVESSIHIDPPVESSPVESTPVESSPVESTPVESSPVESSP 586

 Score =  104 bits (260), Expect = 3e-21
 Identities = 56/116 (48%), Positives = 58/116 (50%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV   PV+  PV   PVE  PV   PV+  PV   PVE  PV   PVE  PV   PVE  
Sbjct: 411 PVESSPVKSTPVESSPVESSPVESSPVKSTPVESSPVESSPVESSPVESSPVESSPVEST 470

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   P
Sbjct: 471 PVESSPVESTPVESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVKSTP 526

 Score =  104 bits (260), Expect = 3e-21
 Identities = 59/121 (48%), Positives = 59/121 (48%), Gaps = 5/121 (4%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  
Sbjct: 441 PVESSPVESSPVESSPVESSPVESSPVESTPVESSPVESTPVESTPVESSPVKSTPVESS 500

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----PPVYKP 357
           PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE      PPV   
Sbjct: 501 PVKSTPVESSPVKSTPVESSPVKSTPVESSPVESSPVESTPVESSPVESSIHIDPPVESS 560

Query: 358 P 360
           P
Sbjct: 561 P 561

 Score =  103 bits (256), Expect = 8e-21
 Identities = 55/116 (47%), Positives = 58/116 (50%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  
Sbjct: 406 PVKSTPVESSPVKSTPVESSPVESSPVESSPVKSTPVESSPVESSPVESSPVESSPVESS 465

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PV   PVE  PV   PVE  PV   PV+  PV   PV+  PV   PV+  PV   P
Sbjct: 466 PVESTPVESSPVESTPVESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSP 521

 Score =  103 bits (256), Expect = 8e-21
 Identities = 55/119 (46%), Positives = 59/119 (49%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PV
Sbjct: 413 ESSPVKSTPVESSPVESSPVESSPVKSTPVESSPVESSPVESSPVESSPVESSPVESTPV 472

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PVE  PV   PV+  PV   PV+  PV   PV+  PV   PV+  PV   P
Sbjct: 473 ESSPVESTPVESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSP 531

 Score =  103 bits (256), Expect = 8e-21
 Identities = 55/119 (46%), Positives = 59/119 (49%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PV
Sbjct: 423 ESSPVESSPVESSPVKSTPVESSPVESSPVESSPVESSPVESSPVESTPVESSPVESTPV 482

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           E  PV   PV+  PV   PV+  PV   PV+  PV   PV+  PV   PVE  PV   P
Sbjct: 483 ESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVESSPVESTP 541

 Score =  101 bits (252), Expect = 2e-20
 Identities = 54/115 (46%), Positives = 58/115 (50%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PV
Sbjct: 433 ESSPVKSTPVESSPVESSPVESSPVESSPVESSPVESTPVESSPVESTPVESTPVESSPV 492

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 348
           +  PV   PV+  PV   PV+  PV   PV+  PV   PVE  PV   PVE  PV
Sbjct: 493 KSTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVESSPVESTPVESSPV 547

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/111 (49%), Positives = 55/111 (49%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PV
Sbjct: 478 ESTPVESTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVKSTPVESSPVESSPV 537

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 336
           E  PV   PVE      PPVE  PV   PVE  PV   PVE  PV   PVE
Sbjct: 538 ESTPVESSPVESSIHIDPPVESSPVESTPVESSPVESTPVESSPVESSPVE 588

 Score =  100 bits (248), Expect = 7e-20
 Identities = 56/124 (45%), Positives = 60/124 (48%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   PV+  PV   PV
Sbjct: 443 ESSPVESSPVESSPVESSPVESSPVESTPVESSPVESTPVESTPVESSPVKSTPVESSPV 502

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPV 348
           +  PV   PV+  PV   PV+  PV   PVE  PV   PVE  PV       PPVE  PV
Sbjct: 503 KSTPVESSPVKSTPVESSPVKSTPVESSPVESSPVESTPVESSPVESSIHIDPPVESSPV 562

Query: 349 YKPP 360
              P
Sbjct: 563 ESTP 566

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 57/120 (47%), Positives = 59/120 (49%), Gaps = 3/120 (2%)
 Frame = +1

Query: 10  PPVYK--PPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           PPV    PPV    PV   PVE  PV   PVE  PV   PVE  PV   PVE  PV   P
Sbjct: 392 PPVSSSVPPVSSSTPVKSTPVESSPVKSTPVESSPVESSPVESSPVKSTPVESSPVESSP 451

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           VE  PV   PVE  PV   PVE  PV   PVE  PV   PV+  PV   PV+  PV   P
Sbjct: 452 VESSPVESSPVESSPVESTPVESSPVESTPVESTPVESSPVKSTPVESSPVKSTPVESSP 511

[122][TOP]
>UniRef100_B4R4F7 GD16675 n=1 Tax=Drosophila simulans RepID=B4R4F7_DROSI
          Length = 1284

 Score =  107 bits (267), Expect = 4e-22
 Identities = 47/115 (40%), Positives = 66/115 (57%)
 Frame = +1

Query: 13   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
            P+  PP E P   +PP E P   +PP + P   +PP E PP Y PP  +PP  +PP  +P
Sbjct: 1146 PITSPPTEPPT--EPPTEPPT--QPPTQPPT--QPPTE-PPTYGPPTNEPPTVQPPTHQP 1198

Query: 193  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
            P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP ++PP   P
Sbjct: 1199 PTVQPPTVQPPTNQPPTVQPPTVQPPTHQPPTNEPPTNRPPTDQPPTKRPPSPSP 1253

 Score =  103 bits (258), Expect = 5e-21
 Identities = 43/108 (39%), Positives = 64/108 (59%), Gaps = 2/108 (1%)
 Frame = +1

Query: 43   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVE 216
            P+  PP E P   +PP E P   +PP + P  P  +PP   PP  +PP  +PP ++PP  
Sbjct: 1146 PITSPPTEPPT--EPPTEPPT--QPPTQPPTQPPTEPPTYGPPTNEPPTVQPPTHQPPTV 1201

Query: 217  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            +PP  +PP  +PP  +PP  +PP ++PP  +PP  +PP ++PP  +PP
Sbjct: 1202 QPPTVQPPTNQPPTVQPPTVQPPTHQPPTNEPPTNRPPTDQPPTKRPP 1249

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 32/77 (41%), Positives = 47/77 (61%)
 Frame = +1

Query: 7    KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
            +PP Y PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 1177 EPPTYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTNQPPTVQPPTVQPPTHQPPTNEPPTN 1236

Query: 187  KPPVYKPPVEKPPVYKP 237
            +PP  +PP ++PP   P
Sbjct: 1237 RPPTDQPPTKRPPSPSP 1253

[123][TOP]
>UniRef100_C7ZH41 Predicted protein n=1 Tax=Nectria haematococca mpVI 77-13-4
           RepID=C7ZH41_NECH7
          Length = 234

 Score =  107 bits (267), Expect = 4e-22
 Identities = 71/121 (58%), Positives = 77/121 (63%), Gaps = 2/121 (1%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EK P YK PV+KP  YK P EK PVYK P +K P YK P EK P YK PV+K P YK P 
Sbjct: 68  EKKPEYKAPVKKPS-YKAP-EKKPVYKAPAKK-PAYKAP-EKKPEYKAPVKK-PAYKAP- 121

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKP 357
           EK P YK P +K P YK P EK P YK PV+K P YK P EK PVYK P +KP    YK 
Sbjct: 122 EKKPEYKAPAKK-PAYKAP-EKKPEYKAPVKK-PAYKAP-EKKPVYKAPAKKPAHNTYKA 177

Query: 358 P 360
           P
Sbjct: 178 P 178

 Score =  103 bits (257), Expect = 6e-21
 Identities = 69/125 (55%), Positives = 76/125 (60%), Gaps = 6/125 (4%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           EK PVYK P +K P YK P EK P YK PV+K P YK P EK P YK P +K P YK P 
Sbjct: 86  EKKPVYKAPAKK-PAYKAP-EKKPEYKAPVKK-PAYKAP-EKKPEYKAPAKK-PAYKAP- 139

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPP--VYKPPVEKPP-- 345
           EK P YK PV+K P YK P EK PVYK P +KP    YK P +KP    YK P +KP   
Sbjct: 140 EKKPEYKAPVKK-PAYKAP-EKKPVYKAPAKKPAHNTYKAPEKKPEHNTYKAPAKKPAHN 197

Query: 346 VYKPP 360
            YK P
Sbjct: 198 TYKAP 202

[124][TOP]
>UniRef100_A7RX60 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis
           RepID=A7RX60_NEMVE
          Length = 533

 Score =  107 bits (266), Expect = 5e-22
 Identities = 58/115 (50%), Positives = 65/115 (56%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG  STG  +TG  STG   TG  STG   TG  STG  +
Sbjct: 51  TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYF 110

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG  STG  +TG   TG   TG  STGG +TG  STG  +TG  S
Sbjct: 111 TGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALS 165

 Score =  106 bits (264), Expect = 9e-22
 Identities = 61/116 (52%), Positives = 71/116 (61%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           G L TG + TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + T
Sbjct: 252 GALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFT 311

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           G L TG   TG L TG + TG L TG + TG L TGG+ TG L TGG+ TG L TG
Sbjct: 312 GALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTG 367

 Score =  105 bits (262), Expect = 2e-21
 Identities = 57/112 (50%), Positives = 64/112 (57%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG  STG  +TG  STG   TG  STG   TG  STG  +
Sbjct: 61  TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYF 120

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG  STG   TG   TG  +TG  STGG  TG  STG  +TG  STG  +TG
Sbjct: 121 TGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTG 172

 Score =  105 bits (261), Expect = 2e-21
 Identities = 57/115 (49%), Positives = 64/115 (55%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TG  +TG  STG  +TG  STG  +TG  STG   TG  STG   TG  STG  +
Sbjct: 41  TGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCF 100

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG  STG  +TG  STG   TG   TG  +TG  STGG +TG  S
Sbjct: 101 TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALS 155

 Score =  105 bits (261), Expect = 2e-21
 Identities = 57/115 (49%), Positives = 64/115 (55%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG  STG  +TG  STG   TG  STG   TG  STG  +
Sbjct: 71  TGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYF 130

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG   TG   TG  STGG +TG  STG   TG  STG  +TG   TG  +TG  S
Sbjct: 131 TGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALS 185

 Score =  105 bits (261), Expect = 2e-21
 Identities = 57/115 (49%), Positives = 64/115 (55%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG  STG  +TG  STG   TG  STG   TG   TG  +
Sbjct: 81  TGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYF 140

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STGG  TG  STG  +TG  STG   TG   TG  +TG  STG  +TG  S
Sbjct: 141 TGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALS 195

 Score =  104 bits (260), Expect = 3e-21
 Identities = 56/115 (48%), Positives = 63/115 (54%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG   TG  +TG  STG  +TG  STG   TG  STG   TG  STG  +
Sbjct: 261 TGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCF 320

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG   TG   TG   TG  +TG   TGG  TG  STGG +TG  STG  +TG  S
Sbjct: 321 TGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALS 375

 Score =  104 bits (260), Expect = 3e-21
 Identities = 56/115 (48%), Positives = 63/115 (54%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG  STG  +TG  STG   TG   TG   TG   TG  +
Sbjct: 281 TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYF 340

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG   TGG  TG  STGG +TG  STG   TG  STG  +TG   TG  +TG  S
Sbjct: 341 TGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALS 395

 Score =  104 bits (259), Expect = 4e-21
 Identities = 61/118 (51%), Positives = 71/118 (60%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           G L TG   TG L TG + TG L TG + TG L TG + TG L TG + TG L TG + T
Sbjct: 242 GALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFT 301

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGF 6
           G L TG + TG L TG   TG L TG + TG L TG + TG L TGG+ TG L TGG+
Sbjct: 302 GALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGY 359

 Score =  104 bits (259), Expect = 4e-21
 Identities = 61/116 (52%), Positives = 70/116 (60%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           G L TG + TG L TG + TG L TG + TG L TG + TG L TG + TG L TG   T
Sbjct: 262 GALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFT 321

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           G L TG + TG L TG + TG L TGG+ TG L TGG+ TG L TG   TG L TG
Sbjct: 322 GALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTG 377

 Score =  104 bits (259), Expect = 4e-21
 Identities = 61/116 (52%), Positives = 70/116 (60%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           G L TG + TG L TG + TG L TG + TG L TG + TG L TG   TG L TG + T
Sbjct: 272 GALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFT 331

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           G L TG + TG L TGG+ TG L TGG+ TG L TG   TG L TG + TG L TG
Sbjct: 332 GALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTG 387

 Score =  103 bits (257), Expect = 6e-21
 Identities = 56/112 (50%), Positives = 63/112 (56%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG  STG  +TG  STG   TG   TG   TG  STGG +
Sbjct: 91  TGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYF 150

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG  STG   TG  STG  +TG   TG   TG  STG  +TG  STG  +TG
Sbjct: 151 TGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYFTG 202

 Score =  103 bits (257), Expect = 6e-21
 Identities = 56/112 (50%), Positives = 63/112 (56%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STGG +TG  STG  +TG  STG  +TG   TG   TG  STG   TG  STG  +
Sbjct: 141 TGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYF 200

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG   TG   TG  STG  +TG  STG   TG  STG  +TG  STG  +TG
Sbjct: 201 TGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTG 252

 Score =  103 bits (256), Expect = 8e-21
 Identities = 56/115 (48%), Positives = 63/115 (54%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG  STG  +TG   TG   TG  STGG  TG  STG  +
Sbjct: 101 TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYF 160

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG   TG  +TG  STG   TG  STG  +TG   TG  +TG  S
Sbjct: 161 TGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALS 215

 Score =  103 bits (256), Expect = 8e-21
 Identities = 56/115 (48%), Positives = 63/115 (54%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG   TG  +TG  STGG  TG  STG   TG  STG  +
Sbjct: 111 TGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYF 170

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG   TG   TG  STG  +TG  STG   TG   TG  +TG  STG  +TG  S
Sbjct: 171 TGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALS 225

 Score =  103 bits (256), Expect = 8e-21
 Identities = 56/115 (48%), Positives = 63/115 (54%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG   TG  +TG  STGG +TG  STG   TG  STG   TG   TG  +
Sbjct: 121 TGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCF 180

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG  STG  +TG   TG   TG  STG  +TG  STG  +TG  S
Sbjct: 181 TGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALS 235

 Score =  103 bits (256), Expect = 8e-21
 Identities = 56/115 (48%), Positives = 63/115 (54%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TG  +TG  STGG +TG  STG  +TG  STG   TG   TG   TG  STG  +
Sbjct: 131 TGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYF 190

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG   TG  +TG  STG   TG  STG  +TG  STG  +TG  S
Sbjct: 191 TGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALS 245

 Score =  103 bits (256), Expect = 8e-21
 Identities = 55/112 (49%), Positives = 62/112 (55%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TG  +TG  STG  +TG  STG  +TG  STG   TG  STG   TG   TG  +
Sbjct: 271 TGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYF 330

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG   TG   TG   TGG +TG  STGG  TG  STG  +TG  STG  +TG
Sbjct: 331 TGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTG 382

 Score =  103 bits (256), Expect = 8e-21
 Identities = 55/112 (49%), Positives = 62/112 (55%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG  STG  +TG   TG   TG   TG   TG   TGG +
Sbjct: 291 TGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYF 350

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG  STGG  TG  STG  +TG  STG   TG   TG  +TG  STG  +TG
Sbjct: 351 TGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTG 402

 Score =  102 bits (255), Expect = 1e-20
 Identities = 55/115 (47%), Positives = 62/115 (53%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TG  +TG  STG  +TG   TG  +TG  STG   TG  STG   TG  STG  +
Sbjct: 251 TGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYF 310

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG   TG  +TG   TG   TG   TGG +TG  STGG +TG  S
Sbjct: 311 TGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALS 365

 Score =  102 bits (254), Expect = 1e-20
 Identities = 57/119 (47%), Positives = 64/119 (53%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           GG  TG  STG  +TG  STG  +TG   TG  +TG  STG   TG  STG   TG   T
Sbjct: 147 GGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCT 206

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           G  +TG  STG   TG  STG  +TG  STG   TG  STG  +TG   TG  +TG  S
Sbjct: 207 GVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALS 265

 Score =  102 bits (254), Expect = 1e-20
 Identities = 61/116 (52%), Positives = 69/116 (59%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           G L TG + TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + T
Sbjct: 282 GALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFT 341

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           G L TGG+ TG L TGG+ TG L TG   TG L TG + TG L TG   TG L TG
Sbjct: 342 GALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTG 397

 Score =  102 bits (254), Expect = 1e-20
 Identities = 61/116 (52%), Positives = 69/116 (59%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           G L TG + TG L TG + TG L TG   TG L TG + TG L TG + TG L TGG+ T
Sbjct: 292 GALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFT 351

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           G L TGG+ TG L TG   TG L TG + TG L TG   TG L TG + TG L TG
Sbjct: 352 GALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTG 407

 Score =  102 bits (254), Expect = 1e-20
 Identities = 61/116 (52%), Positives = 69/116 (59%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           G L TG + TG L TG   TG L TG + TG L TG + TG L TGG+ TG L TGG+ T
Sbjct: 302 GALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFT 361

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           G L TG   TG L TG + TG L TG   TG L TG + TG L TG + TG L TG
Sbjct: 362 GALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTG 417

 Score =  102 bits (254), Expect = 1e-20
 Identities = 61/116 (52%), Positives = 69/116 (59%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           G L TG + TG L TG + TG L TGG+ TG L TGG+ TG L TG   TG L TG + T
Sbjct: 322 GALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFT 381

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           G L TG   TG L TG + TG L TG + TG L TG   TG L TG + TG L TG
Sbjct: 382 GALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTG 437

 Score =  102 bits (254), Expect = 1e-20
 Identities = 61/116 (52%), Positives = 69/116 (59%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           G L TG + TG L TGG+ TG L TGG+ TG L TG   TG L TG + TG L TG   T
Sbjct: 332 GALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFT 391

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           G L TG + TG L TG + TG L TG   TG L TG + TG L TG + TG L TG
Sbjct: 392 GALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTG 447

 Score =  101 bits (251), Expect = 3e-20
 Identities = 56/115 (48%), Positives = 63/115 (54%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG   TG  +TG   TG   TG  STG   TG  STG  +
Sbjct: 11  TGALSTGVYFTGALSTGVYFTGALFTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYF 70

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG  STG  +TG  STG   TG  STG  +TG  STG  +TG  S
Sbjct: 71  TGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALS 125

 Score =  101 bits (251), Expect = 3e-20
 Identities = 59/124 (47%), Positives = 68/124 (54%), Gaps = 5/124 (4%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGL-----YTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*T 195
           G L TG + TG L+TG + TG L     +TG  STG  +TG  STG   TG  STG   T
Sbjct: 22  GALSTGVYFTGALFTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFT 81

Query: 194 GGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYT 15
           G  STG  +TG  STG   TG  STG  +TG  STG   TG  STG  +TG   TG  +T
Sbjct: 82  GALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFT 141

Query: 14  GGFS 3
           G  S
Sbjct: 142 GALS 145

 Score =  101 bits (251), Expect = 3e-20
 Identities = 54/112 (48%), Positives = 61/112 (54%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG   TG  +TG   TG   TG   TGG  TG  STGG +
Sbjct: 301 TGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYF 360

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG  STG   TG  STG  +TG   TG   TG  STG  +TG   TG  +TG
Sbjct: 361 TGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTG 412

 Score =  101 bits (251), Expect = 3e-20
 Identities = 54/112 (48%), Positives = 61/112 (54%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TGG +TG  STGG +TG  STG  +TG  STG   TG   TG   TG  STG  +
Sbjct: 341 TGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYF 400

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG   TG   TG   TG  +TG  STG   TG   TG  +TG  STG  +TG
Sbjct: 401 TGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTG 452

 Score =  100 bits (250), Expect = 4e-20
 Identities = 54/115 (46%), Positives = 61/115 (53%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG   TG  +TG   TG  +TG   TGG  TG  STGG  TG  STG  +
Sbjct: 311 TGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCF 370

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG   TG  +TG  STG   TG   TG  +TG   TG  +TG  S
Sbjct: 371 TGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALS 425

 Score =  100 bits (250), Expect = 4e-20
 Identities = 54/115 (46%), Positives = 61/115 (53%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TG  +TG   TGG +TG  STGG +TG  STG   TG  STG   TG   TG  +
Sbjct: 331 TGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCF 390

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG   TG  +TG   TG   TG  STG  +TG   TG  +TG  S
Sbjct: 391 TGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALS 445

 Score =  100 bits (249), Expect = 5e-20
 Identities = 61/116 (52%), Positives = 68/116 (58%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           G L TG   TG L TG + TG L TG + TG L TGG+ TG L TGG+ TG L TG   T
Sbjct: 312 GALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFT 371

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           G L TG + TG L TG   TG L TG + TG L TG + TG L TG   TG L TG
Sbjct: 372 GALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTG 427

 Score =  100 bits (249), Expect = 5e-20
 Identities = 61/116 (52%), Positives = 68/116 (58%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           G L TGG+ TG L TGG+ TG L TG   TG L TG + TG L TG   TG L TG + T
Sbjct: 342 GALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFT 401

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           G L TG + TG L TG   TG L TG + TG L TG + TG L TG   TG L TG
Sbjct: 402 GALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTG 457

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/116 (47%), Positives = 62/116 (53%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFST 180
           GG  TG  STGG +TG  STG  +TG  STG  +TG   TG   TG  STG   TG   T
Sbjct: 347 GGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCT 406

Query: 179 GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           G  +TG   TG   TG  STG  +TG   TG   TG  STG  +TG   TG  +TG
Sbjct: 407 GVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYFTG 462

 Score =  100 bits (248), Expect = 7e-20
 Identities = 55/112 (49%), Positives = 62/112 (55%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG  STG  +TG  STG   TG   TG   TG  STG  +
Sbjct: 211 TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYF 270

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG   TG   TG  STG  +TG  STG   TG  STG  +TG  STG  +TG
Sbjct: 271 TGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTG 322

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 55/112 (49%), Positives = 62/112 (55%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG   TG  +TG   TG  +TG  STG   TG  STG   TG  STG  +
Sbjct: 21  TGALSTGVYFTGALFTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYF 80

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG  STG   TG  STG  +TG  STG   TG  STG  +TG  STG  +TG
Sbjct: 81  TGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFTG 132

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 55/115 (47%), Positives = 62/115 (53%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG   TG  +TG  STG   TG  STG   TG  STG  +
Sbjct: 181 TGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYF 240

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG   TG  +TG  STG   TG   TG  +TG  STG  +TG  S
Sbjct: 241 TGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALS 295

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 55/115 (47%), Positives = 62/115 (53%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG   TG  +TG  STG  +TG  STG   TG  STG   TG  STG  +
Sbjct: 191 TGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCF 250

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG   TG   TG  STG  +TG   TG   TG  STG  +TG  STG  +TG  S
Sbjct: 251 TGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALS 305

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 55/115 (47%), Positives = 62/115 (53%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TG  +TG  STG  +TG  STG  +TG  STG   TG  STG   TG   TG  +
Sbjct: 201 TGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYF 260

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG   TG  +TG  STG   TG  STG  +TG  STG  +TG  S
Sbjct: 261 TGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALS 315

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 55/115 (47%), Positives = 62/115 (53%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TG  +TG  STG  +TG  STG  +TG   TG   TG   TG   TG  STG  +
Sbjct: 1   TGALCTGVYFTGALSTGVYFTGALSTGVYFTGALFTGVYFTGALCTGVYFTGALSTGVYF 60

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG  STG  +TG  STG   TG  STG  +TG  STG  +TG  S
Sbjct: 61  TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALS 115

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 54/115 (46%), Positives = 61/115 (53%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG   TG  +TG  STG  +TG   TG   TG  STG   TG  STG  +
Sbjct: 241 TGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYF 300

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG  STG  +TG   TG   TG   TG  +TG   TGG +TG  S
Sbjct: 301 TGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALS 355

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 53/112 (47%), Positives = 60/112 (53%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TG  +TG   TG  +TG   TGG +TG  STGG  TG  STG   TG  STG  +
Sbjct: 321 TGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYF 380

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG   TG   TG  STG  +TG   TG   TG   TG  +TG  STG  +TG
Sbjct: 381 TGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTG 432

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 54/112 (48%), Positives = 61/112 (54%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG   TG  +TG  STG  +TG  STG   TG   TG   TG  STG  +
Sbjct: 161 TGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYF 220

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG  STG   TG  STG  +TG  STG   TG   TG  +TG  STG  +TG
Sbjct: 221 TGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTG 272

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 54/112 (48%), Positives = 61/112 (54%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG  STG  +TG  STG  +TG   TG   TG  STG   TG   TG  +
Sbjct: 221 TGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYF 280

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG  STG   TG  STG  +TG  STG   TG  STG  +TG   TG  +TG
Sbjct: 281 TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTG 332

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 58/119 (48%), Positives = 68/119 (57%), Gaps = 5/119 (4%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFS-----TGGL*TGGFSTGGL*TGGFS 183
           TG  STG  +TG  STG  +TG   TG  +TG  S     TG L TG + TG L TG + 
Sbjct: 231 TGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYF 290

Query: 182 TGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGF 6
           TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + TG L TGG+
Sbjct: 291 TGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGY 349

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 54/115 (46%), Positives = 61/115 (53%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TG  +TG  STG  +TG  STG  +TG   TG   TG  STG   TG  STG  +
Sbjct: 171 TGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYF 230

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG  STG  +TG   TG   TG  STG  +TG   TG  +TG  S
Sbjct: 231 TGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALS 285

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 53/112 (47%), Positives = 60/112 (53%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG   TG  +TG  STG  +TG   TG   TG   TG   TG   TG  +
Sbjct: 421 TGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGVYF 480

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTG 12
           TG  STG   TG  STG  +TG  STG   TG  STG  +TG  STG  +TG
Sbjct: 481 TGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVCFTGALSTGVYFTG 532

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 53/115 (46%), Positives = 60/115 (52%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TG  +TG  STG  +TG   TG  +TG  STG   TG   TG   TG   TG  +
Sbjct: 411 TGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYF 470

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG   TG   TG  STG  +TG  STG   TG  STG  +TG  STG  +TG  S
Sbjct: 471 TGALCTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVCFTGALS 525

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 59/121 (48%), Positives = 67/121 (55%), Gaps = 5/121 (4%)
 Frame = -2

Query: 359 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFS-----TGGL*TGGFSTGGL*T 195
           GG  TG  STG  +TG  STG  +TG   TG  +TG  S     TG L TG + TG L T
Sbjct: 357 GGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCT 416

Query: 194 GGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYT 15
           G   TG L TG + TG L TG + TG L TG   TG L TG + TG L TG + TG L T
Sbjct: 417 GVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCT 476

Query: 14  G 12
           G
Sbjct: 477 G 477

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 52/115 (45%), Positives = 59/115 (51%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG   TG  +TG   TG  +TG  STG   TG   TG   TG  STG  +
Sbjct: 391 TGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCF 450

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG   TG   TG   TG  +TG   TG   TG  STG  +TG  STG  +TG  S
Sbjct: 451 TGALCTGVYFTGALCTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVCFTGALS 505

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 52/115 (45%), Positives = 59/115 (51%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TG  +TG   TG  +TG  STG  +TG   TG   TG  STG   TG   TG  +
Sbjct: 401 TGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYF 460

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG   TG   TG   TG  +TG  STG   TG  STG  +TG  STG  +TG  S
Sbjct: 461 TGALCTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALS 515

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/115 (44%), Positives = 58/115 (50%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG  STG  +TG   TG  +TG  STG  +TG   TG   TG   TG   TG  STG  +
Sbjct: 371 TGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYF 430

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG   TG   TG  STG  +TG   TG   TG   TG  +TG   TG  +TG  S
Sbjct: 431 TGALCTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGVYFTGALS 485

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/115 (44%), Positives = 58/115 (50%)
 Frame = -2

Query: 347 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*TGGFSTGGL*TGGFSTGGLY 168
           TG   TG  +TG  STG  +TG   TG  +TG   TG   TG  STG   TG   TG  +
Sbjct: 381 TGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYF 440

Query: 167 TGGFSTGGL*TGGFSTGGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFS 3
           TG  STG   TG   TG  +TG   TG   TG   TG  +TG  STG  +TG  S
Sbjct: 441 TGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGVYFTGALSTGVYFTGALS 495

[125][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0K5_ARATH
          Length = 760

 Score =  105 bits (263), Expect = 1e-21
 Identities = 58/122 (47%), Positives = 59/122 (48%), Gaps = 5/122 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVY PP   PP   PPV  PP   PP   PPVY PP   PP    P   PPVY PP   
Sbjct: 433 PPVYSPPPPPPP--PPPVYSPPPPPPPPPPPPVYSPPPPPPP----PPPPPPVYSPPPPS 486

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYK 354
           PP   PPV  PP   PP   PPVY PP   PPVY  P   P     PVY      PP + 
Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPP--PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHS 544

Query: 355 PP 360
           PP
Sbjct: 545 PP 546

 Score =  103 bits (258), Expect = 5e-21
 Identities = 57/120 (47%), Positives = 57/120 (47%), Gaps = 3/120 (2%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK---PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           PP   P    PP      PP   PPVY PP   PP   PPV  PP   PP   PPVY PP
Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPP--PPPVYSPPPPPPPPPPPPVYSPP 467

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
              PP    P   PPVY PP   PP   PPV  PP   PP   PPVY PP   PPVY  P
Sbjct: 468 PPPPP----PPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP--PPPVYSSP 521

 Score =  103 bits (258), Expect = 5e-21
 Identities = 58/119 (48%), Positives = 59/119 (49%), Gaps = 7/119 (5%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 204
           PP   PPVY PP   PP   PPV  PP   PP   PPVY PP   PP    P   PPVY 
Sbjct: 428 PPSPPPPVYSPPPPPPP--PPPVYSPPPPPPPPPPPPVYSPPPPPPP----PPPPPPVYS 481

Query: 205 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVY--KPP 360
           PP   PP   PPV  PP   PP   PPVY PP   PPVY  P   P     PVY  +PP
Sbjct: 482 PPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP--PPPVYSSPPPPPSPAPTPVYCTRPP 538

 Score =  101 bits (252), Expect = 2e-20
 Identities = 56/123 (45%), Positives = 59/123 (47%), Gaps = 6/123 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPV-EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           PPVY PP   PP   PPV   PP   PP   PPVY PP   PP   PPV  PP   PP  
Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505

Query: 187 KPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 351
            PPVY PP   PPVY  P   P     PVY      PP + PP   PP + PP  +P  Y
Sbjct: 506 PPPVYSPP--PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP---PPQFSPPPPEPYYY 560

Query: 352 KPP 360
             P
Sbjct: 561 SSP 563

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 55/125 (44%), Positives = 59/125 (47%), Gaps = 8/125 (6%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVY PP   P    PP   PPVY PP   PP   PPV  PP   PP   PPVY PP   
Sbjct: 461 PPVYSPPPPPP----PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP--P 514

Query: 190 PPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPP 345
           PPVY  P   P     PVY      PP + PP   PP + PP  +P  Y    PP   PP
Sbjct: 515 PPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP---PPQFSPPPPEPYYYSSPPPPHSSPP 571

Query: 346 VYKPP 360
            + PP
Sbjct: 572 PHSPP 576

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 57/123 (46%), Positives = 59/123 (47%), Gaps = 6/123 (4%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVE 186
           PP   PPV  PP   PP   PPVY PP   PP   PP V  PP   PP   PPVY PP  
Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPP-- 498

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVY 351
            PP   PP   PPVY PP   PPVY  P   P     PVY      PP + PP   PP +
Sbjct: 499 -PP--PPPPPPPPVYSPP--PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP---PPQF 550

Query: 352 KPP 360
            PP
Sbjct: 551 SPP 553

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 54/125 (43%), Positives = 58/125 (46%), Gaps = 8/125 (6%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP   PP   PPVY PP   PP   PPV  PP   PP   PPVY PP   PPVY  P   
Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP--PPPVYSSPPPP 524

Query: 190 P-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPPVYKPPVEKPP 345
           P     PVY      PP + PP   PP + PP  +P  Y    PP   PP + PP   PP
Sbjct: 525 PSPAPTPVYCTRPPPPPPHSPP---PPQFSPPPPEPYYYSSPPPPHSSPPPHSPP---PP 578

Query: 346 VYKPP 360
              PP
Sbjct: 579 HSPPP 583

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 55/131 (41%), Positives = 60/131 (45%), Gaps = 14/131 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYK 174
           PPVY PP   PP   PPV  PP   PP   PPVY PP   PPVY  P   P     PVY 
Sbjct: 477 PPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP--PPPVYSSPPPPPSPAPTPVYC 534

Query: 175 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPPVYKPP---VEKPPVY---KP 327
                PP + PP   PP + PP  +P  Y    PP   PP + PP      PP+Y    P
Sbjct: 535 TRPPPPPPHSPP---PPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSP 591

Query: 328 PVEKPPVYKPP 360
           P    PV  PP
Sbjct: 592 PPPPTPVSSPP 602

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 54/130 (41%), Positives = 57/130 (43%), Gaps = 12/130 (9%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           +PPV  P +  P +  PP   P    PP    P   PP   PPVY PP   PP       
Sbjct: 395 RPPVVTP-LPPPSLPSPPPPAPIFSTPPTLTSP--PPPSPPPPVYSPPPPPPP------- 444

Query: 187 KPPVYKPPVEKPP------VYK------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 330
            PPVY PP   PP      VY       PP   PPVY PP   PP   PPV  PP   PP
Sbjct: 445 PPPVYSPP-PPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503

Query: 331 VEKPPVYKPP 360
              PPVY PP
Sbjct: 504 PPPPPVYSPP 513

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 54/131 (41%), Positives = 59/131 (45%), Gaps = 14/131 (10%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYK 174
           PP   PPV  PP   PP   PPVY PP   PPVY  P   P     PVY      PP + 
Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPP--PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHS 544

Query: 175 PPVEKPPVYKPPVEKPPVYK---PPVEKPPVYKPP---VEKPPVY---KPPVEKPPVYKP 327
           PP   PP + PP  +P  Y    PP   PP + PP      PP+Y    PP    PV  P
Sbjct: 545 PP---PPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSP 601

Query: 328 PVEKPPVYKPP 360
           P    PVY PP
Sbjct: 602 P--PTPVYSPP 610

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 54/136 (39%), Positives = 60/136 (44%), Gaps = 19/136 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEK 159
           PPVY PP   P     PVY PP   PPVY  P   P     PVY      PP + PP   
Sbjct: 492 PPVYSPPPPPPPPPPPPVYSPP--PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP--- 546

Query: 160 PPVYKPPVEKPPVYK---PPVEKPPVYKPP---VEKPPVY---KPPVEKPPVYKPPVEKP 312
           PP + PP  +P  Y    PP   PP + PP      PP+Y    PP    PV  PP    
Sbjct: 547 PPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPP--PT 604

Query: 313 PVYKPPVEKPPVYKPP 360
           PVY PP   P +  PP
Sbjct: 605 PVYSPPPPPPCIEPPP 620

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 50/129 (38%), Positives = 58/129 (44%), Gaps = 12/129 (9%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPPVYKPPVEK---PPVY---KPPVEKP 162
           PP + PP   PP + PP  +P  Y    PP   PP + PP      PP+Y    PP    
Sbjct: 540 PPPHSPP---PPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPT 596

Query: 163 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEK 339
           PV  PP    PVY PP   PP  +PP   P + Y PP   P V+      PPVY      
Sbjct: 597 PVSSPP--PTPVYSPP-PPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPP 653

Query: 340 PPVY--KPP 360
           PPVY   PP
Sbjct: 654 PPVYYSSPP 662

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 49/128 (38%), Positives = 57/128 (44%), Gaps = 12/128 (9%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPPVYKPP---VEKPPVY- 171
           PVY      PP + PP   PP + PP  +P  Y    PP   PP + PP      PP+Y 
Sbjct: 531 PVYCTRPPPPPPHSPP---PPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYP 587

Query: 172 --KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKP 342
              PP    PV  PP    PVY PP   PP  +PP   P + Y PP   P V+      P
Sbjct: 588 YLSPPPPPTPVSSPP--PTPVYSPP-PPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPP 644

Query: 343 PVY--KPP 360
           PVY   PP
Sbjct: 645 PVYYSSPP 652

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 47/127 (37%), Positives = 54/127 (42%), Gaps = 10/127 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK---PPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKP--PV 168
           PP + PP  +P  Y    PP   PP + PP     PP   P +  PP   P    P  PV
Sbjct: 547 PPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPV 606

Query: 169 YKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEK 339
           Y PP   PP  +PP   P + Y PP   P V+      PPVY      PPVY   PP   
Sbjct: 607 YSPP-PPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPP 665

Query: 340 PPVYKPP 360
           P  Y  P
Sbjct: 666 PVHYSSP 672

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 44/120 (36%), Positives = 48/120 (40%), Gaps = 3/120 (2%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVE 186
           PP + PP    P   PP    PV  PP    PVY PP   PP  +PP   P + Y PP  
Sbjct: 576 PPPHSPPPPIYPYLSPPPPPTPVSSPP--PTPVYSPP-PPPPCIEPPPPPPCIEYSPPPP 632

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            P V+      PPVY      PPVY   PP   P  Y  P      Y  P   P  Y  P
Sbjct: 633 PPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSP 692

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 47/129 (36%), Positives = 53/129 (41%), Gaps = 9/129 (6%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVY-------KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 159
           Q  P   K  + +PPV        +    +PPV  P +  P +  PP   P    PP   
Sbjct: 366 QRSPGQCKAFLSRPPVNCGSFSCGRSVSPRPPVVTP-LPPPSLPSPPPPAPIFSTPPTLT 424

Query: 160 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP--VEKPPVYKPPV 333
            P   PP   PPVY PP   PP        PPVY PP   PP   PP     PP   PP 
Sbjct: 425 SP--PPPSPPPPVYSPPPPPPP-------PPPVYSPP-PPPPPPPPPPVYSPPPPPPPPP 474

Query: 334 EKPPVYKPP 360
             PPVY PP
Sbjct: 475 PPPPVYSPP 483

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 44/118 (37%), Positives = 47/118 (39%), Gaps = 6/118 (5%)
 Frame = +1

Query: 10  PPVYKPPVEKPP---VYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKP 177
           PP    PV  PP   VY PP   PP  +PP   P + Y PP   P V+      PPVY  
Sbjct: 591 PPPPPTPVSSPPPTPVYSPP-PPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYS 649

Query: 178 PVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
               PPVY   PP   P  Y  P      Y  P   P  Y  P   PP   P  E PP
Sbjct: 650 SPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSP--PPPPSAPCEESPP 705

[126][TOP]
>UniRef100_Q9M7N8 Proline-rich protein 4 n=1 Tax=Arabidopsis thaliana
           RepID=Q9M7N8_ARATH
          Length = 448

 Score =  105 bits (263), Expect = 1e-21
 Identities = 85/204 (41%), Positives = 101/204 (49%), Gaps = 87/204 (42%)
 Frame = +1

Query: 10  PPVYKPPVEKPP---VYKPPVEKP-----PVYKPPVEKP-----PVYKPP---------- 120
           PP Y PPVE PP   VY+PP +K      PVY PP +K      PVYKPP          
Sbjct: 183 PPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIP 242

Query: 121 ----------VEKPP---VYKPP--VEKPP---VYKPP--VEKPP---VYKPP------- 210
                     +E PP   VYKPP  +E PP   VYKPP  +E PP   V+KPP       
Sbjct: 243 KKPCPPKPPKIEHPPPVPVYKPPPKIEHPPPVPVYKPPPKIEHPPPVPVHKPPKKPCPPK 302

Query: 211 -VEKPPV--YKPPVEKP-----------PVYKPP---------VEKP---PVYKPP--VE 306
            V+ PPV  +KPP +KP           PV+KPP         +E P   PVYKPP  +E
Sbjct: 303 KVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIE 362

Query: 307 KPPVYKPP-VEKP-----PVYKPP 360
            PP+Y PP V+KP     P+YKPP
Sbjct: 363 HPPIYIPPIVKKPCPPPVPIYKPP 386

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 67/140 (47%), Positives = 79/140 (56%), Gaps = 24/140 (17%)
 Frame = +1

Query: 13  PVYKPP--VEKPP---VYKPP--------VEKPPV--YKPPVEKPPVYKPPVEKPPVYKP 147
           PVYKPP  +E PP   V+KPP        V+ PPV  +KPP +KP   K  V+ PPV   
Sbjct: 275 PVYKPPPKIEHPPPVPVHKPPKKPCPPKKVDPPPVPVHKPPTKKPCPPK-KVDPPPV--- 330

Query: 148 PVEKPP----VYKPPVEKP---PVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 300
           PV KPP    +  P +E P   PVYKPP  +E PP+Y PP+ K P   PPV   P+YKPP
Sbjct: 331 PVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPC-PPPV---PIYKPP 386

Query: 301 VEKPPVYKPPVEKPPVYKPP 360
           V  P   KP     PVYKPP
Sbjct: 387 VVIPK--KPCPPPVPVYKPP 404

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 58/133 (43%), Positives = 71/133 (53%), Gaps = 20/133 (15%)
 Frame = +1

Query: 13  PVYKPPVEKP-----------PVYKPPVEKPPVYKPP--VEKPP---VYKPPVEKPPVYK 144
           PV+KPP +KP           PV+KPP   P +  PP  +E PP   VYKPP   P +  
Sbjct: 310 PVHKPPTKKPCPPKKVDPPPVPVHKPP---PKIVIPPPKIEHPPPVPVYKPP---PKIEH 363

Query: 145 PPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPV-EKPP 315
           PP+  PP+ K P   P P+YKPPV  P   KP     PVYKPPV   P    PP+ + PP
Sbjct: 364 PPIYIPPIVKKPCPPPVPIYKPPVVIPK--KPCPPPVPVYKPPVVVIPKKPCPPLPQLPP 421

Query: 316 VYK-PPVEKPPVY 351
           + K PP+  PP Y
Sbjct: 422 LPKFPPL--PPKY 432

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 42/99 (42%), Positives = 52/99 (52%), Gaps = 4/99 (4%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PVYKPP   P +  PP+  PP+ K P   P P+YKPPV  P   KP     PVYKPPV  
Sbjct: 353 PVYKPP---PKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPK--KPCPPPVPVYKPPVVV 407

Query: 190 PPVYK-PPV-EKPPVYK-PPVEKPPVYKPPVEKPPVYKP 297
            P    PP+ + PP+ K PP+    ++ P   K P   P
Sbjct: 408 IPKKPCPPLPQLPPLPKFPPLPPKYIHHPKFGKWPPLPP 446

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 39/91 (42%), Positives = 48/91 (52%), Gaps = 3/91 (3%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PP 180
           E PP+Y PP+ K P   PPV   P+YKPPV  P   KP     PVYKPPV   P    PP
Sbjct: 362 EHPPIYIPPIVKKPC-PPPV---PIYKPPVVIPK--KPCPPPVPVYKPPVVVIPKKPCPP 415

Query: 181 V-EKPPVYK-PPVEKPPVYKPPVEKPPVYKP 267
           + + PP+ K PP+    ++ P   K P   P
Sbjct: 416 LPQLPPLPKFPPLPPKYIHHPKFGKWPPLPP 446

[127][TOP]
>UniRef100_Q9SKP9 Putative proline-rich protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9SKP9_ARATH
          Length = 321

 Score =  105 bits (261), Expect = 2e-21
 Identities = 60/121 (49%), Positives = 74/121 (61%), Gaps = 4/121 (3%)
 Frame = +1

Query: 10  PPVYKPPVEKP--PVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           PP+  P ++KP  P+YKPPV  P    PP +   P+YKPPV   P+YKPPV   P+YKPP
Sbjct: 173 PPLTFPKIKKPCPPIYKPPVVIPKKPCPPKIAHKPIYKPPV---PIYKPPV---PIYKPP 226

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKP 357
           V  P    PP    P+YKPPV   P+YKPPV  P    PP+ K P+YK PV    P++KP
Sbjct: 227 VVIPKKPCPPKIHKPIYKPPV---PIYKPPVVIPKKTFPPLHK-PIYKHPVPIYKPIFKP 282

Query: 358 P 360
           P
Sbjct: 283 P 283

 Score =  102 bits (254), Expect = 1e-20
 Identities = 59/124 (47%), Positives = 70/124 (56%), Gaps = 7/124 (5%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 186
           PP+YKPPV  P    PP +   P+YKPPV   P+YKPPV   P+YKPPV  P    PP  
Sbjct: 185 PPIYKPPVVIPKKPCPPKIAHKPIYKPPV---PIYKPPV---PIYKPPVVIPKKPCPPKI 238

Query: 187 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP------PVYKPPVEKPPVYKPPVEKPPV 348
             P+YKPPV   P+YKPPV  P    PP+ KP      P+YKP  + P V  P    PP+
Sbjct: 239 HKPIYKPPV---PIYKPPVVIPKKTFPPLHKPIYKHPVPIYKPIFKPPVVVIPKKPCPPL 295

Query: 349 YKPP 360
            K P
Sbjct: 296 PKFP 299

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 56/120 (46%), Positives = 68/120 (56%), Gaps = 19/120 (15%)
 Frame = +1

Query: 55  PPVEKPPVYKPPVEK--PPVYKPPVEKP-----------PVYKPPVEKPPVYKPPVEKPP 195
           PP+  PP+  P ++K  PP+YKPPV  P           P+YKPPV   P+YKPPV   P
Sbjct: 168 PPLNLPPLTFPKIKKPCPPIYKPPVVIPKKPCPPKIAHKPIYKPPV---PIYKPPV---P 221

Query: 196 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP------PVYKP 357
           +YKPPV  P    PP    P+YKPPV   P+YKPPV  P    PP+ KP      P+YKP
Sbjct: 222 IYKPPVVIPKKPCPPKIHKPIYKPPV---PIYKPPVVIPKKTFPPLHKPIYKHPVPIYKP 278

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 45/101 (44%), Positives = 53/101 (52%), Gaps = 16/101 (15%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKP----------PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 162
           P+YKPPV   P+YKPPV  P          P+YKPPV   P+YKPPV  P    PP+ KP
Sbjct: 214 PIYKPPV---PIYKPPVVIPKKPCPPKIHKPIYKPPV---PIYKPPVVIPKKTFPPLHKP 267

Query: 163 ------PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 267
                 P+YKP  + P V  P    PP+ K P   PP Y P
Sbjct: 268 IYKHPVPIYKPIFKPPVVVIPKKPCPPLPKFP-HFPPKYIP 307

[128][TOP]
>UniRef100_Q9FSG1 Putative extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG1_NICSY
          Length = 311

 Score =  105 bits (261), Expect = 2e-21
 Identities = 69/131 (52%), Positives = 70/131 (53%), Gaps = 16/131 (12%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKP 177
           PPVYK     PPVYK   P   PPVYK P   PPVYK     PPV  YK P   PPVYK 
Sbjct: 67  PPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPVYKYKSPPPPPPVYKS 124

Query: 178 PVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYK-------PPVEK---PPVY 321
           P   PPVYK     PPV  YK P   PPVYK P   PPVYK       PPV K   PP+Y
Sbjct: 125 P--PPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPPPVHKSPPPPIY 180

Query: 322 KPPVEKPPVYK 354
           K     PPVYK
Sbjct: 181 KYKSPPPPVYK 191

 Score =  105 bits (261), Expect = 2e-21
 Identities = 70/135 (51%), Positives = 72/135 (53%), Gaps = 18/135 (13%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKP 177
           PPVYK   P   PPVYK P   PPVYK     PPV  YK P   PPVYK P   PPVYK 
Sbjct: 77  PPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKY 132

Query: 178 PVEKPPV--YKPPVEKPPVYKPPVEKPPVYK-------PPVEK---PPVYKPPVEKPPV- 318
               PPV  YK P   PPVYK P   PPVYK       PPV K   PP+YK     PPV 
Sbjct: 133 KSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVY 190

Query: 319 -YKPPVEKPPVYKPP 360
            YK P   PP+YK P
Sbjct: 191 KYKSPPPPPPMYKSP 205

 Score =  105 bits (261), Expect = 2e-21
 Identities = 70/135 (51%), Positives = 72/135 (53%), Gaps = 18/135 (13%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYK-------PPVEK- 159
           PPVYK P   PPVYK     PPVYK   P   PPVYK P   PPVYK       PPV K 
Sbjct: 119 PPVYKSP--PPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPPPVHKS 174

Query: 160 --PPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPV- 318
             PP+YK     PPV  YK P   PP+YK P   PPVY  K P   PPVYK     PPV 
Sbjct: 175 PPPPIYKYKSPPPPVYKYKSPPPPPPMYKSP--PPPVYKHKSPPPPPPVYKYKSPPPPVY 232

Query: 319 -YKPPVEKPPVYKPP 360
            YK P   PPVYK P
Sbjct: 233 KYKSPPPPPPVYKSP 247

 Score =  103 bits (258), Expect = 5e-21
 Identities = 69/131 (52%), Positives = 71/131 (54%), Gaps = 16/131 (12%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKP 177
           PPVYK P   PPVYK     PPVYK   P   PPVYK P   PPVYK     PPV  YK 
Sbjct: 89  PPVYKSP--PPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPVYKYKS 144

Query: 178 PVEKPPVYKPPVEKPPVYK-------PPVEK---PPVYKPPVEKPPV--YKPPVEKPPVY 321
           P   PPVYK P   PPVYK       PPV K   PP+YK     PPV  YK P   PP+Y
Sbjct: 145 PPPPPPVYKSP--PPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPPPMY 202

Query: 322 KPPVEKPPVYK 354
           K P   PPVYK
Sbjct: 203 KSP--PPPVYK 211

 Score =  103 bits (258), Expect = 5e-21
 Identities = 67/127 (52%), Positives = 70/127 (55%), Gaps = 10/127 (7%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPV--Y 171
           PP+YK     PPVYK   P   PP+YK P   PPVYK   P   PPVYK     PPV  Y
Sbjct: 177 PPIYKYKSPPPPVYKYKSPPPPPPMYKSP--PPPVYKHKSPPPPPPVYKYKSPPPPVYKY 234

Query: 172 KPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEK 339
           K P   PPVYK P   PP+  YK P   PPVYK P   PPV  YK P   PPVYK P   
Sbjct: 235 KSPPPPPPVYKSP--PPPIYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPPPVYKSP--P 288

Query: 340 PPVYKPP 360
           PPVYK P
Sbjct: 289 PPVYKSP 295

 Score =  103 bits (257), Expect = 6e-21
 Identities = 70/137 (51%), Positives = 73/137 (53%), Gaps = 20/137 (14%)
 Frame = +1

Query: 10  PPVYK--PPVEKPPVYKPPVEKPPVYK-------PPVEK---PPVYKPPVEKPPV--YKP 147
           PPVYK   P   PPVYK P   PPVYK       PPV K   PP+YK     PPV  YK 
Sbjct: 137 PPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKS 194

Query: 148 PVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPP 315
           P   PP+YK P   PPVY  K P   PPVYK     PPV  YK P   PPVYK P   PP
Sbjct: 195 PPPPPPMYKSP--PPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPP 250

Query: 316 V--YKPPVEKPPVYKPP 360
           +  YK P   PPVYK P
Sbjct: 251 IYKYKSPPPPPPVYKSP 267

 Score =  103 bits (257), Expect = 6e-21
 Identities = 73/145 (50%), Positives = 76/145 (52%), Gaps = 28/145 (19%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK-------PPVEK---PPVYKPPVEKPPVYK--PPVEKPPVYKPPV 153
           PPVYK P   PPVYK       PPV K   PP+YK     PPVYK   P   PP+YK P 
Sbjct: 149 PPVYKSP--PPPVYKYKSPPPPPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSP- 205

Query: 154 EKPPVYK--PPVEKPPVYKPPVEKPPVYK-------PPVEK---PPV--YKPPVEKPPVY 291
             PPVYK   P   PPVYK     PPVYK       PPV K   PP+  YK P   PPVY
Sbjct: 206 -PPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPIYKYKSPPPPPPVY 264

Query: 292 KPPVEKPPV--YKPPVEKPPVYKPP 360
           K P   PPV  YK P   PPVYK P
Sbjct: 265 KSP--PPPVYKYKSPPPPPPVYKSP 287

 Score =  100 bits (250), Expect = 4e-20
 Identities = 67/130 (51%), Positives = 70/130 (53%), Gaps = 16/130 (12%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPP 180
           P+Y+ P   PPVYK     PPVYK   P   PPVYK P   PPVYK     PPV  YK P
Sbjct: 60  PIYRSP--PPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPVYKYKSP 115

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYK-------PPV 333
              PPVYK P   PPVYK     PPV  YK P   PPVYK P   PPVYK       PPV
Sbjct: 116 PPPPPVYKSP--PPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPPPV 171

Query: 334 EK---PPVYK 354
            K   PP+YK
Sbjct: 172 HKSPPPPIYK 181

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 65/123 (52%), Positives = 67/123 (54%), Gaps = 8/123 (6%)
 Frame = +1

Query: 10  PPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKP 177
           PPVYK     P  P+Y+ P   PPVYK     PPV  YK P   PPVYK P   PPVYK 
Sbjct: 47  PPVYKYKSPPPPLPIYRSP--PPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKY 102

Query: 178 PVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPP 345
               PPV  YK P   PPVYK P   PPVYK     PPV  YK P   PPVYK P   PP
Sbjct: 103 KSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPP 158

Query: 346 VYK 354
           VYK
Sbjct: 159 VYK 161

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 63/128 (49%), Positives = 65/128 (50%), Gaps = 16/128 (12%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEKPPVYKP-------PVEK---PPVYKPPVEKPPV--YKPPVEKPPV 168
           PP  K  VY  P   PPVYK        P+ +   PPVYK     PPV  YK P   PPV
Sbjct: 34  PPPTKKYVYSSP--PPPVYKYKSPPPPLPIYRSPPPPVYKYKSPPPPVYKYKSPPPPPPV 91

Query: 169 YKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVE 336
           YK P   PPVYK     PPV  YK P   PPVYK P   PPVYK     PPV  YK P  
Sbjct: 92  YKSP--PPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPVYKYKSPPP 147

Query: 337 KPPVYKPP 360
            PPVYK P
Sbjct: 148 PPPVYKSP 155

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 55/115 (47%), Positives = 56/115 (48%), Gaps = 3/115 (2%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK---PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           PPVYK     PPVYK   PP   P VYK P   PP+YK        YK P   PPVYK P
Sbjct: 219 PPVYKYKSPPPPVYKYKSPPPPPP-VYKSP--PPPIYK--------YKSPPPPPPVYKSP 267

Query: 181 VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
              PPVYK        YK P   PPVYK P   PPVYK P   PP Y      PP
Sbjct: 268 --PPPVYK--------YKSPPPPPPVYKSP--PPPVYKSP---PPPYHYYYTSPP 307

[129][TOP]
>UniRef100_P11728 Early nodulin-75 (Fragment) n=1 Tax=Medicago sativa
           RepID=NO75_MEDSA
          Length = 97

 Score =  105 bits (261), Expect = 2e-21
 Identities = 57/109 (52%), Positives = 67/109 (61%), Gaps = 2/109 (1%)
 Frame = +1

Query: 22  KPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 198
           +P V  PP ++PP+E PP  Y+PP EKPP   PP    P Y+PP +KPP  K P E PP 
Sbjct: 1   RPHVHPPPEHQPPLEHPPPEYQPPHEKPPHVHPP----PEYQPPYQKPPHEKSPYEPPPQ 56

Query: 199 -YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
            Y+PP EKPP  KPP E    Y+PP EKPP   P    PP Y+PP EKP
Sbjct: 57  EYQPPHEKPPQVKPPSE----YQPPHEKPPHEHP----PPEYQPPHEKP 97

 Score =  101 bits (251), Expect = 3e-20
 Identities = 55/103 (53%), Positives = 64/103 (62%), Gaps = 2/103 (1%)
 Frame = +1

Query: 10  PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPV 183
           PP ++PP+E PP  Y+PP EKPP   P    PP Y+PP +KPP  K P E PP  Y+PP 
Sbjct: 7   PPEHQPPLEHPPPEYQPPHEKPPHVHP----PPEYQPPYQKPPHEKSPYEPPPQEYQPPH 62

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 312
           EKPP  KPP E    Y+PP EKPP   P    PP Y+PP EKP
Sbjct: 63  EKPPQVKPPSE----YQPPHEKPPHEHP----PPEYQPPHEKP 97

 Score =  100 bits (249), Expect = 5e-20
 Identities = 53/105 (50%), Positives = 64/105 (60%), Gaps = 2/105 (1%)
 Frame = +1

Query: 52  KPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 228
           +P V  PP ++PP+E PP  Y+PP EKPP   PP    P Y+PP +KPP  K P E PP 
Sbjct: 1   RPHVHPPPEHQPPLEHPPPEYQPPHEKPPHVHPP----PEYQPPYQKPPHEKSPYEPPPQ 56

Query: 229 -YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            Y+PP EKPP  KPP E    Y+PP EKPP   PP E  P ++ P
Sbjct: 57  EYQPPHEKPPQVKPPSE----YQPPHEKPPHEHPPPEYQPPHEKP 97

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/95 (52%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYKP 177
           +  PP Y+PP EKPP   P    PP Y+PP +KPP  K P E PP  Y+PP EKPP  KP
Sbjct: 15  EHPPPEYQPPHEKPPHVHP----PPEYQPPYQKPPHEKSPYEPPPQEYQPPHEKPPQVKP 70

Query: 178 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 282
           P E    Y+PP EKPP   P    PP Y+PP EKP
Sbjct: 71  PSE----YQPPHEKPPHEHP----PPEYQPPHEKP 97

[130][TOP]
>UniRef100_Q6Q4B6 Proline-rich protein n=1 Tax=Gossypium barbadense
           RepID=Q6Q4B6_GOSBA
          Length = 152

 Score =  104 bits (260), Expect = 3e-21
 Identities = 54/104 (51%), Positives = 65/104 (62%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E P   KPP    PV+ PP  KPP Y+    KPPVY+PP ++ P  KPPV  PP  + P 
Sbjct: 26  ESPNYGKPPA---PVHNPPKLKPPPYE---HKPPVYEPPKKEKPEPKPPVYVPPKKEKPE 79

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 315
            KPPVYKP  +KPPVY+P   KPPVY PP ++ P  KPPV + P
Sbjct: 80  PKPPVYKPS-KKPPVYEPKPPKPPVYAPPKKERPEPKPPVHESP 122

 Score =  104 bits (260), Expect = 3e-21
 Identities = 54/104 (51%), Positives = 65/104 (62%)
 Frame = +1

Query: 34  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 213
           E P   KPP    PV+ PP  KPP Y+    KPPVY+PP ++ P  KPPV  PP  + P 
Sbjct: 26  ESPNYGKPPA---PVHNPPKLKPPPYE---HKPPVYEPPKKEKPEPKPPVYVPPKKEKPE 79

Query: 214 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
            KPPVYKP  +KPPVY+P   KPPVY PP ++ P  KPPV + P
Sbjct: 80  PKPPVYKPS-KKPPVYEPKPPKPPVYAPPKKERPEPKPPVHESP 122

 Score =  100 bits (249), Expect = 5e-20
 Identities = 52/99 (52%), Positives = 62/99 (62%)
 Frame = +1

Query: 64  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 243
           E P   KPP    PV+ PP  KPP Y+    KPPVY+PP ++ P  KPPV  PP  + P 
Sbjct: 26  ESPNYGKPPA---PVHNPPKLKPPPYE---HKPPVYEPPKKEKPEPKPPVYVPPKKEKPE 79

Query: 244 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            KPPVYKP  +KPPVY+P   KPPVY PP ++ P  KPP
Sbjct: 80  PKPPVYKPS-KKPPVYEPKPPKPPVYAPPKKERPEPKPP 117

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 41/75 (54%), Positives = 51/75 (68%)
 Frame = +1

Query: 1   QEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 180
           + KPPVY+PP ++ P  KPPV  PP  + P  KPPVYKP  +KPPVY+P   KPPVY PP
Sbjct: 49  EHKPPVYEPPKKEKPEPKPPVYVPPKKEKPEPKPPVYKPS-KKPPVYEPKPPKPPVYAPP 107

Query: 181 VEKPPVYKPPVEKPP 225
            ++ P  KPPV + P
Sbjct: 108 KKERPEPKPPVHESP 122

[131][TOP]
>UniRef100_Q39599 Extensin n=1 Tax=Catharanthus roseus RepID=Q39599_CATRO
          Length = 225

 Score =  104 bits (260), Expect = 3e-21
 Identities = 68/145 (46%), Positives = 70/145 (48%), Gaps = 28/145 (19%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-------------PP 150
           PP Y PP      YK P   PPV+K P   PP YK P   PPVYK             PP
Sbjct: 21  PPHYSPPYH----YKSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYKSPPPP 76

Query: 151 VEKPPVYKPPVEKPPVYK---PPVEKPPVYK------PPVEKPPVYK----PPVEKPP-V 288
             KP  YK P   PPVYK   PP  KP  YK      PP  KP  YK    PPV KPP V
Sbjct: 77  PHKPYKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYV 136

Query: 289 YKPPVEKPPVYK-PPVEKPPVYKPP 360
           YK P   P V+K PP   PPVYK P
Sbjct: 137 YKSPPPPPSVHKYPPPSPPPVYKSP 161

 Score =  104 bits (260), Expect = 3e-21
 Identities = 71/145 (48%), Positives = 73/145 (50%), Gaps = 27/145 (18%)
 Frame = +1

Query: 7   KPPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPPVYKPPVEKP 162
           K P   PPV K     PP YK P   PPVYK P   P  YK   PP  KP  YK P   P
Sbjct: 31  KSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYKSPPPPPHKPYKYKSPPPPP 90

Query: 163 PVYK---PPVEKPPVYK------PPVEKPPVYK----PPVEKPP-VYKPPVEKPPVYK-P 297
           PVYK   PP  KP  YK      PP  KP  YK    PPV KPP VYK P   P V+K P
Sbjct: 91  PVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVHKYP 150

Query: 298 PVEKPPVYK----PPVEKPPVYKPP 360
           P   PPVYK    PP +KP  YK P
Sbjct: 151 PPSPPPVYKSPPSPPPKKPYKYKSP 175

 Score =  102 bits (253), Expect = 2e-20
 Identities = 68/148 (45%), Positives = 72/148 (48%), Gaps = 31/148 (20%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYK-------------PPVEKPPVYKPPVEKPPVYK---PPVEKPPVY 141
           PP YK P   PPVYK             PP  KP  YK P   PPVYK   PP  KP  Y
Sbjct: 47  PPFYKSPPPPPPVYKSPPPPPYKYKSPPPPPHKPYKYKSPPPPPPVYKSPPPPPHKPYKY 106

Query: 142 K------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKPPVYK-- 294
           K      PP  KP  YK P   PPVYKPP     VYK P   P V+K PP   PPVYK  
Sbjct: 107 KSPPPPPPPPHKPYKYKSP-PPPPVYKPPY----VYKSPPPPPSVHKYPPPSPPPVYKSP 161

Query: 295 --PPVEKPPVYK----PPVEKPPVYKPP 360
             PP +KP  YK    PP+ K P+  PP
Sbjct: 162 PSPPPKKPYKYKSPPPPPIHKSPLPSPP 189

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 64/141 (45%), Positives = 70/141 (49%), Gaps = 23/141 (16%)
 Frame = +1

Query: 7   KPPVYKPPVEKPPVYK---PPVEKPPVYK------PPVEKPPVYK----PPVEKPP-VYK 144
           KP  YK P   PPVYK   PP  KP  YK      PP  KP  YK    PPV KPP VYK
Sbjct: 79  KPYKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYK 138

Query: 145 PPVEKPPVYK-PPVEKPPVYK----PPVEKPPVYK----PPVEKPPVYKPPVEKPPVYKP 297
            P   P V+K PP   PPVYK    PP +KP  YK    PP+ K P+  PP +KP  YK 
Sbjct: 139 SPPPPPSVHKYPPPSPPPVYKSPPSPPPKKPYKYKSPPPPPIHKSPLPSPP-KKPYKYKY 197

Query: 298 PVEKPPVYKPPVEKPPVYKPP 360
           P   P    PP     +Y  P
Sbjct: 198 PPPTPVYKSPPPPHHYLYTSP 218

[132][TOP]
>UniRef100_C0S6D3 Putative uncharacterized protein n=1 Tax=Paracoccidioides
           brasiliensis Pb03 RepID=C0S6D3_PARBP
          Length = 1089

 Score =  104 bits (260), Expect = 3e-21
 Identities = 48/105 (45%), Positives = 48/105 (45%)
 Frame = +1

Query: 28  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 207
           P E  P   PP E PP   PP E PP   PP E PP   P  E P    PP E PP   P
Sbjct: 601 PAEYSPAEDPPTEDPPAEDPPAEGPPAEGPPAEGPPAEDPLAEGPTAEDPPAEDPPAEDP 660

Query: 208 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 342
           P E PP   PP E P    PP E PP   PP E P    PP E P
Sbjct: 661 PAEDPPAEDPPAEDPAAENPPAEGPPAEDPPAEGPTAKDPPAEDP 705

 Score =  104 bits (259), Expect = 3e-21
 Identities = 54/128 (42%), Positives = 56/128 (43%), Gaps = 10/128 (7%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPV------YKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 153
           + PPV   PV   PV      Y P    P E PP   PP E PP   PP E PP   PP 
Sbjct: 578 DDPPVEDNPVGASPVEDLSDEYLPAEYSPAEDPPTEDPPAEDPPAEGPPAEGPPAEGPPA 637

Query: 154 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 333
           E P    P  E PP   PP E PP   PP E PP   P  E PP   PP E PP   P  
Sbjct: 638 EDPLAEGPTAEDPPAEDPPAEDPPAEDPPAEDPPAEDPAAENPPAEGPPAEDPPAEGPTA 697

Query: 334 EKPPVYKP 357
           + PP   P
Sbjct: 698 KDPPAEDP 705

 Score =  104 bits (259), Expect = 3e-21
 Identities = 53/122 (43%), Positives = 53/122 (43%), Gaps = 10/122 (8%)
 Frame = +1

Query: 25  PPVEKPPVYKPPVEK----------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 174
           PPVE  PV   PVE            P   PP E PP   PP E PP   PP E PP   
Sbjct: 580 PPVEDNPVGASPVEDLSDEYLPAEYSPAEDPPTEDPPAEDPPAEGPPAEGPPAEGPPAED 639

Query: 175 PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 354
           P  E P    PP E PP   PP E PP   PP E P    PP E PP   PP E P    
Sbjct: 640 PLAEGPTAEDPPAEDPPAEDPPAEDPPAEDPPAEDPAAENPPAEGPPAEDPPAEGPTAKD 699

Query: 355 PP 360
           PP
Sbjct: 700 PP 701

 Score =  103 bits (256), Expect = 8e-21
 Identities = 48/111 (43%), Positives = 49/111 (44%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 192
           P    P E PP   PP E PP   PP E PP   PP E P    P  E PP   PP E P
Sbjct: 601 PAEYSPAEDPPTEDPPAEDPPAEGPPAEGPPAEGPPAEDPLAEGPTAEDPPAEDPPAEDP 660

Query: 193 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 345
           P   PP E PP   P  E PP   PP E PP   P  + PP   P  E  P
Sbjct: 661 PAEDPPAEDPPAEDPAAENPPAEGPPAEDPPAEGPTAKDPPAEDPTAEDLP 711

 Score =  102 bits (254), Expect = 1e-20
 Identities = 50/115 (43%), Positives = 50/115 (43%), Gaps = 1/115 (0%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           E  P   PP E PP   PP E PP   PP E PP   P  E P    PP E PP   PP 
Sbjct: 603 EYSPAEDPPTEDPPAEDPPAEGPPAEGPPAEGPPAEDPLAEGPTAEDPPAEDPPAEDPPA 662

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKPP 345
           E PP   PP E P    PP E PP   PP E P    PP E P     P  E  P
Sbjct: 663 EDPPAEDPPAEDPAAENPPAEGPPAEDPPAEGPTAKDPPAEDPTAEDLPATESSP 717

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 45/110 (40%), Positives = 47/110 (42%)
 Frame = +1

Query: 28  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 207
           PVE+        + PPV   PV   PV     E  P    P E PP   PP E PP   P
Sbjct: 566 PVEETTTGDSQADDPPVEDNPVGASPVEDLSDEYLPAEYSPAEDPPTEDPPAEDPPAEGP 625

Query: 208 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 357
           P E PP   PP E P    P  E PP   PP E PP   PP E PP   P
Sbjct: 626 PAEGPPAEGPPAEDPLAEGPTAEDPPAEDPPAEDPPAEDPPAEDPPAEDP 675

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 41/101 (40%), Positives = 43/101 (42%)
 Frame = +1

Query: 58  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 237
           PVE+        + PPV   PV   PV     E  P    P E PP   PP E PP   P
Sbjct: 566 PVEETTTGDSQADDPPVEDNPVGASPVEDLSDEYLPAEYSPAEDPPTEDPPAEDPPAEGP 625

Query: 238 PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           P E PP   PP E P    P  E PP   PP E PP   PP
Sbjct: 626 PAEGPPAEGPPAEDPLAEGPTAEDPPAEDPPAEDPPAEDPP 666

[133][TOP]
>UniRef100_Q9M6T6 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9M6T6_ARATH
          Length = 448

 Score =  104 bits (259), Expect = 3e-21
 Identities = 84/204 (41%), Positives = 101/204 (49%), Gaps = 87/204 (42%)
 Frame = +1

Query: 10  PPVYKPPVEKPP---VYKPPVEKP-----PVYKPPVEKP-----PVYKPP---------- 120
           PP Y PPVE PP   VY+PP +K      PVY PP +K      PVYKPP          
Sbjct: 183 PPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIP 242

Query: 121 ----------VEKPP---VYKPP--VEKPP---VYKPP--VEKPP---VYKPP------- 210
                     +E PP   V+KPP  +E PP   VYKPP  +E PP   V+KPP       
Sbjct: 243 KKPCPPKPPKIEHPPPVPVFKPPPKIEHPPPVPVYKPPPKIEHPPPVPVHKPPKKPCPPK 302

Query: 211 -VEKPPV--YKPPVEKP-----------PVYKPP---------VEKP---PVYKPP--VE 306
            V+ PPV  +KPP +KP           PV+KPP         +E P   PVYKPP  +E
Sbjct: 303 KVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIE 362

Query: 307 KPPVYKPP-VEKP-----PVYKPP 360
            PP+Y PP V+KP     P+YKPP
Sbjct: 363 HPPIYIPPIVKKPCPPPVPIYKPP 386

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 67/140 (47%), Positives = 79/140 (56%), Gaps = 24/140 (17%)
 Frame = +1

Query: 13  PVYKPP--VEKPP---VYKPP--------VEKPPV--YKPPVEKPPVYKPPVEKPPVYKP 147
           PVYKPP  +E PP   V+KPP        V+ PPV  +KPP +KP   K  V+ PPV   
Sbjct: 275 PVYKPPPKIEHPPPVPVHKPPKKPCPPKKVDPPPVPVHKPPTKKPCPPK-KVDPPPV--- 330

Query: 148 PVEKPP----VYKPPVEKP---PVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 300
           PV KPP    +  P +E P   PVYKPP  +E PP+Y PP+ K P   PPV   P+YKPP
Sbjct: 331 PVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPC-PPPV---PIYKPP 386

Query: 301 VEKPPVYKPPVEKPPVYKPP 360
           V  P   KP     PVYKPP
Sbjct: 387 VVIPK--KPCPPPVPVYKPP 404

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 58/133 (43%), Positives = 71/133 (53%), Gaps = 20/133 (15%)
 Frame = +1

Query: 13  PVYKPPVEKP-----------PVYKPPVEKPPVYKPP--VEKPP---VYKPPVEKPPVYK 144
           PV+KPP +KP           PV+KPP   P +  PP  +E PP   VYKPP   P +  
Sbjct: 310 PVHKPPTKKPCPPKKVDPPPVPVHKPP---PKIVIPPPKIEHPPPVPVYKPP---PKIEH 363

Query: 145 PPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPV-EKPP 315
           PP+  PP+ K P   P P+YKPPV  P   KP     PVYKPPV   P    PP+ + PP
Sbjct: 364 PPIYIPPIVKKPCPPPVPIYKPPVVIPK--KPCPPPVPVYKPPVVVIPKKPCPPLPQLPP 421

Query: 316 VYK-PPVEKPPVY 351
           + K PP+  PP Y
Sbjct: 422 LPKFPPL--PPKY 432

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 42/99 (42%), Positives = 52/99 (52%), Gaps = 4/99 (4%)
 Frame = +1

Query: 13  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PVYKPP   P +  PP+  PP+ K P   P P+YKPPV  P   KP     PVYKPPV  
Sbjct: 353 PVYKPP---PKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPK--KPCPPPVPVYKPPVVV 407

Query: 190 PPVYK-PPV-EKPPVYK-PPVEKPPVYKPPVEKPPVYKP 297
            P    PP+ + PP+ K PP+    ++ P   K P   P
Sbjct: 408 IPKKPCPPLPQLPPLPKFPPLPPKYIHHPKFGKWPPLPP 446

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 39/91 (42%), Positives = 48/91 (52%), Gaps = 3/91 (3%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PP 180
           E PP+Y PP+ K P   PPV   P+YKPPV  P   KP     PVYKPPV   P    PP
Sbjct: 362 EHPPIYIPPIVKKPC-PPPV---PIYKPPVVIPK--KPCPPPVPVYKPPVVVIPKKPCPP 415

Query: 181 V-EKPPVYK-PPVEKPPVYKPPVEKPPVYKP 267
           + + PP+ K PP+    ++ P   K P   P
Sbjct: 416 LPQLPPLPKFPPLPPKYIHHPKFGKWPPLPP 446

[134][TOP]
>UniRef100_Q9LJ64 Extensin protein-like n=1 Tax=Arabidopsis thaliana
           RepID=Q9LJ64_ARATH
          Length = 956

 Score =  104 bits (259), Expect = 3e-21
 Identities = 60/119 (50%), Positives = 73/119 (61%)
 Frame = +1

Query: 4   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 183
           + PPV+ PP   PPV+ PP   PPV+ PP   PP++ PP   PPVY PP   PPV+ PP 
Sbjct: 640 QSPPVHSPP-PPPPVHSPP---PPVFSPP---PPMHSPP---PPVYSPP---PPVHSPP- 685

Query: 184 EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
             PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP
Sbjct: 686 -PPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP 728

 Score =  102 bits (255), Expect = 1e-20
 Identities = 60/117 (51%), Positives = 71/117 (60%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PP++ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   
Sbjct: 658 PPVFSPP---PPMHSPP---PPVYSPP---PPVHSPP--PPPVHSPP---PPVHSPP--- 700

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV  PP   PPV+ PP
Sbjct: 701 PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVQSPP--PPPVFSPP 743

 Score =  102 bits (254), Expect = 1e-20
 Identities = 60/117 (51%), Positives = 71/117 (60%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PP++ PP   PPVY PP   PPV+ PP   PPV+ PP   
Sbjct: 651 PPVHSPP---PPVFSPP---PPMHSPP---PPVYSPP---PPVHSPP--PPPVHSPP--- 693

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV  PP
Sbjct: 694 PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVQSPP 735

 Score =  102 bits (253), Expect = 2e-20
 Identities = 60/117 (51%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   
Sbjct: 672 PPVYSPP---PPVHSPP--PPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP--- 714

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPV+ PP   PPV  PP   PPV+ PP    P+Y PP   PPV+ PP
Sbjct: 715 PPVHSPP---PPVHSPP---PPVQSPP--PPPVFSPP-PPAPIYSPP--PPPVHSPP 760

 Score =  100 bits (250), Expect = 4e-20
 Identities = 59/117 (50%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PP++ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   
Sbjct: 665 PPMHSPP---PPVYSPP---PPVHSPP--PPPVHSPP---PPVHSPP---PPVHSPP--- 707

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPV+ PP   PPV+ PP   PPV  PP   PPV+ PP    P+Y PP
Sbjct: 708 PPVHSPP---PPVHSPP---PPVHSPP---PPVQSPP--PPPVFSPP-PPAPIYSPP 752

 Score =  100 bits (248), Expect = 7e-20
 Identities = 59/117 (50%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   
Sbjct: 679 PPVHSPP--PPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP--- 721

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPV  PP   PPV+ PP    P+Y PP   PPV+ PP   PPV+ PP
Sbjct: 722 PPVHSPP---PPVQSPP--PPPVFSPP-PPAPIYSPP--PPPVHSPP---PPVHSPP 767

 Score =  100 bits (248), Expect = 7e-20
 Identities = 59/117 (50%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   
Sbjct: 687 PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP--- 728

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV  PP   PPV+ PP    P+Y PP   PPV+ PP   PPV+ PP   PPV+ PP
Sbjct: 729 PPVQSPP--PPPVFSPP-PPAPIYSPP--PPPVHSPP---PPVHSPP--PPPVHSPP 775

 Score =  100 bits (248), Expect = 7e-20
 Identities = 59/117 (50%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV  PP   
Sbjct: 694 PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVQSPP--P 736

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP    P+Y PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP
Sbjct: 737 PPVFSPP-PPAPIYSPP--PPPVHSPP---PPVHSPP--PPPVHSPP---PPVHSPP 782

 Score =  100 bits (248), Expect = 7e-20
 Identities = 59/117 (50%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV  PP   PPV+ PP   
Sbjct: 701 PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVQSPP--PPPVFSPP-PP 745

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
            P+Y PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP
Sbjct: 746 APIYSPP--PPPVHSPP---PPVHSPP--PPPVHSPP---PPVHSPP---PPVHSPP 789

 Score =  100 bits (248), Expect = 7e-20
 Identities = 59/117 (50%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPV+ PP   PPV  PP   PPV+ PP    P+Y PP   
Sbjct: 708 PPVHSPP---PPVHSPP---PPVHSPP---PPVQSPP--PPPVFSPP-PPAPIYSPP--P 753

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP
Sbjct: 754 PPVHSPP---PPVHSPP--PPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP 796

 Score =  100 bits (248), Expect = 7e-20
 Identities = 59/117 (50%), Positives = 70/117 (59%)
 Frame = +1

Query: 10  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 189
           PPV+ PP   PPV+ PP   PPV  PP   PPV+ PP    P+Y PP   PPV+ PP   
Sbjct: 715 PPVHSPP---PPVHSPP---PPVQSPP--PPPVFSPP-PPAPIYSPP--PPPVHSPP--- 760

Query: 190 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 360
           PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP
Sbjct: 761 PPVHSPP--PPPVHSPP---PPVHSP