AV424201 ( MWM037c12_r )

[UP]


[1][TOP]
>UniRef100_C6TFZ1 Putative uncharacterized protein (Fragment) n=1 Tax=Glycine max
           RepID=C6TFZ1_SOYBN
          Length = 229

 Score =  162 bits (409), Expect = 1e-38
 Identities = 82/135 (60%), Positives = 92/135 (68%), Gaps = 14/135 (10%)
 Frame = +1

Query: 46  MESSKIHAYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKP-------------- 183
           MESSKI+AYLFLCMLFLSSA PILGCG CGKP PKKHKP K P  P              
Sbjct: 1   MESSKIYAYLFLCMLFLSSATPILGCGYCGKP-PKKHKPGKTPKTPTVPVVKPPVTIPPI 59

Query: 184 VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPIL 363
           VKPP  +PPIV PP  +PPIV PPV +PP+  PPVTVPP+ +PP+VKP     PG  P  
Sbjct: 60  VKPPVTIPPIVNPPVTIPPIVNPPVTIPPIVNPPVTVPPVVLPPIVKP-----PGFLP-- 112

Query: 364 PPVPVLNPPSTPTPT 408
              P+LNPPSTPTP+
Sbjct: 113 ---PILNPPSTPTPS 124

[2][TOP]
>UniRef100_A4Q7K6 Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor
           n=1 Tax=Medicago truncatula RepID=A4Q7K6_MEDTR
          Length = 234

 Score =  133 bits (334), Expect = 7e-30
 Identities = 74/136 (54%), Positives = 91/136 (66%), Gaps = 15/136 (11%)
 Frame = +1

Query: 52  SSKIHAYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKP-GKP--VKPPGIVPPIVKP 222
           SSK +AYL +CMLF+SSA PILGCGTCGKP PKKHKP KKP  KP  VKPP  +PP +  
Sbjct: 5   SSKFYAYLIICMLFISSATPILGCGTCGKP-PKKHKPGKKPIVKPPIVKPPVTIPPTLPI 63

Query: 223 PGIVPPIVKPPVILPPVTVPPVTVPP-ITVPPV--VKPTLP-----PIPGVTPILPPVPV 378
           P ++P +  PP +  P  +P + +PP + +PP   + PTLP     PIP V P LP  PV
Sbjct: 64  PPVLPHLPIPPTLPIPPVLPHLPIPPTLPIPPTLPIPPTLPIPPTLPIPPVLPHLPVPPV 123

Query: 379 LNPP----STPTPTTP 414
           LNPP    STP+PT+P
Sbjct: 124 LNPPSSGGSTPSPTSP 139

[3][TOP]
>UniRef100_A9PFC8 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PFC8_POPTR
          Length = 198

 Score =  130 bits (326), Expect = 6e-29
 Identities = 66/124 (53%), Positives = 84/124 (67%), Gaps = 1/124 (0%)
 Frame = +1

Query: 46  MESSKIHAYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVK-PPGIVPPIVKP 222
           M+S+KI A+LFLCM+F+SSAAP L CG+CGK    KH   K P  P+  PP  VPPIVKP
Sbjct: 1   MDSTKISAFLFLCMIFISSAAPTLDCGSCGKHPKNKHP--KTPKAPITLPPLPVPPIVKP 58

Query: 223 PGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPT 402
           P  +PP+  PP++ PPVT+PPVT+PP+TVPP+   T+PP+    P   P P   PP +P 
Sbjct: 59  PVTLPPLPVPPIVKPPVTLPPVTLPPVTVPPI---TVPPVTTKPPKGKPCP---PPPSPK 112

Query: 403 PTTP 414
            T P
Sbjct: 113 DTCP 116

[4][TOP]
>UniRef100_B7FHN1 Putative uncharacterized protein n=1 Tax=Medicago truncatula
           RepID=B7FHN1_MEDTR
          Length = 234

 Score =  129 bits (323), Expect = 1e-28
 Identities = 73/143 (51%), Positives = 89/143 (62%), Gaps = 22/143 (15%)
 Frame = +1

Query: 52  SSKIHAYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGI 231
           SSK +AYL +CMLF+S A PILGCGTCGKP PKKHKP KKP        + PPIVKPP  
Sbjct: 5   SSKFYAYLIICMLFISLATPILGCGTCGKP-PKKHKPGKKPI-------VKPPIVKPPVT 56

Query: 232 VPPIVKPPVILPPVTVPP-VTVPPI----TVPPV--VKPTLP-----------PIPGVTP 357
           +PP +  P +LP + +PP + +PP+     +PP   + PTLP           PIP V P
Sbjct: 57  IPPTLPIPPVLPHLPIPPTLPIPPVLPHLPIPPTLPIPPTLPIPPTLPIPPTLPIPPVLP 116

Query: 358 ILPPVPVLNPP----STPTPTTP 414
            LP  PVLNPP    STP+PT+P
Sbjct: 117 HLPVPPVLNPPSSGGSTPSPTSP 139

[5][TOP]
>UniRef100_A7PF96 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PF96_VITVI
          Length = 266

 Score =  124 bits (310), Expect = 4e-27
 Identities = 78/153 (50%), Positives = 92/153 (60%), Gaps = 33/153 (21%)
 Frame = +1

Query: 46  MESSKIHAYLFLCMLFLSSAAPILGCGTCGKPVPKK-----------HKPSKKPGKP--- 183
           M+SSK+ A   +  LF+SSA PILGC  C KP P+            HKP K  GKP   
Sbjct: 1   MDSSKLSALFLIFTLFISSATPILGCAPCSKPPPQHKPPFHHKPPSHHKPPK--GKPPIT 58

Query: 184 ----VKPP----GIVPPIVKP----PGIVPPIVKPPVILPPVTV-----PPVTVPPITVP 312
               VKPP     +VPPIVKP    P +VPPIVKPP+ +PP+TV     PP+TVPPITVP
Sbjct: 59  RPPIVKPPITVPPVVPPIVKPPITLPPVVPPIVKPPITVPPITVPPIVKPPITVPPITVP 118

Query: 313 PVVKP--TLPPIPGVTPILPPVPVLNPPSTPTP 405
           P+VKP  T+PPI  V PI+ P PV  PP T  P
Sbjct: 119 PIVKPPITVPPIT-VPPIVKP-PVTVPPITVPP 149

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 37/65 (56%), Positives = 40/65 (61%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           P  KP   V PP  VPPIVKPP  VPPI  PP+I PP+TVPPV  PP+  PPV  P  PP
Sbjct: 119 PIVKPPITV-PPITVPPIVKPPVTVPPITVPPIIKPPITVPPVVTPPVNKPPVGTPCPPP 177

Query: 340 IPGVT 354
               T
Sbjct: 178 PASAT 182

[6][TOP]
>UniRef100_Q2PES8 Putative uncharacterized protein n=1 Tax=Trifolium pratense
           RepID=Q2PES8_TRIPR
          Length = 240

 Score =  116 bits (291), Expect = 7e-25
 Identities = 72/140 (51%), Positives = 81/140 (57%), Gaps = 30/140 (21%)
 Frame = +1

Query: 85  MLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVK----- 249
           MLF+SSA PILGCGTCG P PKKHKP KKP   VKPP   PP+  PP  VPP +      
Sbjct: 1   MLFISSATPILGCGTCGNP-PKKHKPGKKP--IVKPPSAKPPVTIPPVTVPPTLPIPNLP 57

Query: 250 ---------PPVILPPVTVPPVTVPPITVPPVVK--PTLP---------PIPGVT-PILP 366
                    PPV +P + VPPVTVP + VPPV+   P LP         P+P VT P LP
Sbjct: 58  IPPLPHLPVPPVTVPNLPVPPVTVPNLPVPPVIPHLPNLPVPPVTVPNLPVPPVTVPNLP 117

Query: 367 PVPVLNPP----STPTPTTP 414
             PVLNPP    STP  +TP
Sbjct: 118 IPPVLNPPSTGGSTPKGSTP 137

[7][TOP]
>UniRef100_P93705 Hypocotil specific n=1 Tax=Daucus carota RepID=P93705_DAUCA
          Length = 347

 Score =  110 bits (274), Expect = 6e-23
 Identities = 58/118 (49%), Positives = 73/118 (61%), Gaps = 8/118 (6%)
 Frame = +1

Query: 85  MLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVIL 264
           M F S+A P+L CG+C KP P  HKP+      VKPP + PPIVKPP + PP+VKPPV+ 
Sbjct: 1   MFFFSTANPVLDCGSCEKP-PPHHKPAPHKPPTVKPPVVKPPIVKPPVVKPPVVKPPVVK 59

Query: 265 PPVTVPPVTVPPITVPPVVKP-TLPP---IPGVTP--ILPPVP--VLNPPSTPTPTTP 414
           PP+  PP+  PP  +PP++ P  LPP    PGV P  +LPP+P  VL P   P    P
Sbjct: 60  PPIVKPPIVKPPGLLPPILPPGILPPGVLPPGVLPPGVLPPLPPGVLPPGILPPGVLP 117

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/81 (49%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTL-P 336
           P  KP   + PPG++PP V PPGI+PP + PP +LPP  +PP  +PP   PPV+ PT  P
Sbjct: 184 PGIKPPGGLLPPGVLPPGVLPPGILPPGILPPGVLPPGILPPGILPPGVKPPVLPPTTKP 243

Query: 337 PIPGVTPILPPVPVLNPPSTP 399
           P PG TP   P     PPS P
Sbjct: 244 PSPG-TPC--PPGAKTPPSAP 261

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 41/88 (46%), Positives = 53/88 (60%), Gaps = 10/88 (11%)
 Frame = +1

Query: 181 PVKPPGIVPPIVKPPGIVPPIVKPPV-ILPPVTVPPVTVPPITVPPVVKP--TLPP---I 342
           P  PPG++PP V PPG++PP +KPP  +LPP  +PP  +PP  +PP + P   LPP    
Sbjct: 165 PPLPPGVLPPGVLPPGVLPPGIKPPGGLLPPGVLPPGVLPPGILPPGILPPGVLPPGILP 224

Query: 343 PGVTP--ILPPV--PVLNPPSTPTPTTP 414
           PG+ P  + PPV  P   PPS  TP  P
Sbjct: 225 PGILPPGVKPPVLPPTTKPPSPGTPCPP 252

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/88 (48%), Positives = 50/88 (56%), Gaps = 3/88 (3%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           P   PG  V PPGI+PP V PPG++PP V PP+  P   +PP  +PP  +PP V P LPP
Sbjct: 99  PPLPPG--VLPPGILPPGVLPPGVLPPGVVPPIKPPGGLLPPGVLPPGVLPPGVLPPLPP 156

Query: 340 ---IPGVTPILPPVPVLNPPSTPTPTTP 414
               PGV P LPP  VL P   P    P
Sbjct: 157 GVLPPGVLPPLPP-GVLPPGVLPPGVLP 183

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 45/96 (46%), Positives = 54/96 (56%), Gaps = 11/96 (11%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPV-TVPPITVPPVVKP--T 330
           P   PG  V PPG++PP+  PPG++PP V PP +LPP   PP   +PP  +PP V P   
Sbjct: 152 PPLPPG--VLPPGVLPPL--PPGVLPPGVLPPGVLPPGIKPPGGLLPPGVLPPGVLPPGI 207

Query: 331 LPP---IPGVTP--ILPP---VPVLNPPSTPTPTTP 414
           LPP    PGV P  ILPP    P + PP  P  T P
Sbjct: 208 LPPGILPPGVLPPGILPPGILPPGVKPPVLPPTTKP 243

[8][TOP]
>UniRef100_B9T135 Lipid binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9T135_RICCO
          Length = 246

 Score =  107 bits (267), Expect = 4e-22
 Identities = 61/158 (38%), Positives = 80/158 (50%), Gaps = 33/158 (20%)
 Frame = +1

Query: 40  ISMESSKIHAYLFLCMLFLSSAAPILG--CGTCGKPVPKKHKPSKKPG------------ 177
           + MES+KI A LF+CM F SSAA  +   CG CG   P KH   K  G            
Sbjct: 1   MKMESTKILALLFICMFFTSSAATAVNPDCGACGHHKPPKHGGHKGGGGGLLPPIVKPPI 60

Query: 178 -----------KPVKPPGIVPPIVKPP----GIVPPIVKPPVILPPVTVPPVTVPPITVP 312
                       P+  P ++PP+VKPP     ++PP+VKPP+ LPPV +PPV  PPI +P
Sbjct: 61  NLPPVIPPVVKPPINLPPVIPPVVKPPINLPPVIPPVVKPPINLPPV-IPPVVKPPINLP 119

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPP----STPTPTTP 414
           PV+ P + P   + P+  P  + NPP      P P  P
Sbjct: 120 PVIPPVIKPPINLPPVTVPPVITNPPKGSGGKPCPPPP 157

[9][TOP]
>UniRef100_Q8VWX9 Extensin-like protein (Fragment) n=1 Tax=Cucumis sativus
           RepID=Q8VWX9_CUCSA
          Length = 219

 Score =  100 bits (250), Expect = 4e-20
 Identities = 59/132 (44%), Positives = 79/132 (59%), Gaps = 12/132 (9%)
 Frame = +1

Query: 46  MESSKIHAYLFLCMLFLSSAAPILGCGTCGKPVPKKHKP---SKKPGKPVKPPGI---VP 207
           ME SKI++   +CMLF+SSA+PILGCG+C    P+K KP   SK P  P+  P I   +P
Sbjct: 5   MEPSKIYSLFLICMLFISSASPILGCGSCSGKPPRKTKPGSGSKSPKGPITLPPIPIKIP 64

Query: 208 PIVKPPGI-VPPIVKPPVILPPVTVPPVT-VPPITVPPVVKPTLPPIPGVTPILPPVPVL 381
           P+V  P + +PP+V     +P V +PPV  +P + +PPVV     PIP   P+LP  P+L
Sbjct: 65  PVVPIPSVPIPPVVP----IPSVPIPPVVPIPSVPIPPVVPIPSVPIP---PVLPVPPIL 117

Query: 382 NPPS----TPTP 405
             PS    TP P
Sbjct: 118 GKPSPGVNTPCP 129

[10][TOP]
>UniRef100_Q9LIE9 Similarity to cell wall-plasma membrane linker protein n=1
           Tax=Arabidopsis thaliana RepID=Q9LIE9_ARATH
          Length = 334

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 46/96 (47%), Positives = 50/96 (52%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
           P P  HKP   P  P  P    P + PP   PP I PP   PPV+ PP   PPV  PP  
Sbjct: 151 PKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTP 210

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PPV+ P  P  P VTP  P  PV+ PP TPTP TP
Sbjct: 211 TPPVITPPTPTPPVVTPPTPTPPVVTPP-TPTPPTP 245

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/132 (39%), Positives = 59/132 (44%), Gaps = 19/132 (14%)
 Frame = +1

Query: 76  FLCMLFLSSAAPILGCG-TCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP 252
           FL +L L   A    C  T  KP P  HKP K P KP KPP + PP  KPP + PP  KP
Sbjct: 10  FLVLLLLGFVAVSYACDCTPPKPSPAPHKPPKHPVKPPKPPAVKPP--KPPAVKPPTPKP 67

Query: 253 PVILP------------PVTVPPVTVPPITVPPVVKPTLPPIPGVTPIL------PPVPV 378
           P + P            P TV P   PP   PP  KP   P P   P +      PP   
Sbjct: 68  PTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPST 127

Query: 379 LNPPSTPTPTTP 414
             PP+ P P+TP
Sbjct: 128 PKPPTKPPPSTP 139

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 41/93 (44%), Positives = 43/93 (46%)
 Frame = +1

Query: 130 CGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           C  P P    P   P  P  PP I PP   PP + PP   PPVI PP   PPV  PP   
Sbjct: 163 CPPPTPTPTPPVVTPPTPT-PPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPT 221

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           PPVV P  P  P VTP  P  P   P + P  T
Sbjct: 222 PPVVTPPTPTPPVVTPPTPTPPTPIPETCPIDT 254

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 45/102 (44%), Positives = 49/102 (48%), Gaps = 12/102 (11%)
 Frame = +1

Query: 136 KPVPKKHKP-SKKPGKPVKPPGIVPP--IVKPPGIVPPIVK---------PPVILPPVTV 279
           KP P   KP +K P    KPP   PP    KPP   PP            PPV+ PP   
Sbjct: 122 KPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPT 181

Query: 280 PPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PPV  PP   PPVV P  P  P +TP  P  PV+ PP TPTP
Sbjct: 182 PPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPP-TPTP 222

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 42/98 (42%), Positives = 44/98 (44%), Gaps = 11/98 (11%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVP--PIVKPPGIVPPIVKPPVILPPVT---------VPPVT 291
           P    P   P  P KPP   P  P  KPP   P   KPP   PP T          PPV 
Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTP---KPPHHKPPPTPCPPPTPTPTPPVV 175

Query: 292 VPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            PP   PPV+ P  P  P VTP  P  PV+ PP TPTP
Sbjct: 176 TPPTPTPPVITPPTPTPPVVTPPTPTPPVITPP-TPTP 212

[11][TOP]
>UniRef100_B1VSS3 Putative uncharacterized protein n=1 Tax=Streptomyces griseus
           subsp. griseus NBRC 13350 RepID=B1VSS3_STRGG
          Length = 366

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 52/103 (50%), Positives = 60/103 (58%), Gaps = 6/103 (5%)
 Frame = +1

Query: 124 GTCGKPV---PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV 294
           GT   PV   P    P  +P   + PP  VPPI  PP  VPP+  PP+ +PPVTVPPVTV
Sbjct: 260 GTTSPPVTTPPPTEVPVTEPPITI-PPVTVPPITVPPITVPPVTDPPITIPPVTVPPVTV 318

Query: 295 PPITVPPVVKPTLPPIPGVTPILPPVPVLNPPS---TPTPTTP 414
           PP+TVPP+   TLPP    TP     PV  PP+   TPTPT P
Sbjct: 319 PPVTVPPI---TLPP---TTP-----PVTRPPTATPTPTPTKP 350

[12][TOP]
>UniRef100_Q5DNZ7 Putative proline-rich protein (Fragment) n=1 Tax=Nicotiana tabacum
           RepID=Q5DNZ7_TOBAC
          Length = 195

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 44/82 (53%), Positives = 56/82 (68%), Gaps = 7/82 (8%)
 Frame = +1

Query: 190 PPGIVPPIVKPP----GIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKP--TLPPIPGV 351
           PP  VPP+VKPP     +VPP++KPP+ +PPVTVPPV  PPI +PP+VKP   LPPI G+
Sbjct: 26  PPVTVPPVVKPPINLPPVVPPVIKPPIGIPPVTVPPVLKPPIGLPPIVKPPINLPPI-GI 84

Query: 352 TPI-LPPVPVLNPPSTPTPTTP 414
            P+ +PPV   +P   P P  P
Sbjct: 85  PPVTVPPVITPSPKGKPCPPPP 106

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 38/67 (56%), Positives = 48/67 (71%), Gaps = 4/67 (5%)
 Frame = +1

Query: 202 VPPIVKPP----GIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPP 369
           VPP+VKPP     +VPP++KPP+ +PPVTVPPV  PPI +PPVV P + P  G+ P+  P
Sbjct: 1   VPPVVKPPINLPPVVPPVIKPPIGIPPVTVPPVVKPPINLPPVVPPVIKPPIGIPPVTVP 60

Query: 370 VPVLNPP 390
            PVL PP
Sbjct: 61  -PVLKPP 66

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 36/84 (42%), Positives = 52/84 (61%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           P  KP  P+  P +VPP++KPP  +PP+  PPV+ PP+ +PP+  PPI +PP+    +PP
Sbjct: 32  PVVKP--PINLPPVVPPVIKPPIGIPPVTVPPVLKPPIGLPPIVKPPINLPPI---GIPP 86

Query: 340 IPGVTPILPPVPVLNPPSTPTPTT 411
           +  V P++ P P    P  P PTT
Sbjct: 87  VT-VPPVITPSP-KGKPCPPPPTT 108

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 6/80 (7%)
 Frame = +1

Query: 184 VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPT--LPPIPGVTP 357
           VKPP  +PP+V PP I PPI  PPV +PPV  PP+ +PP+ VPPV+KP   +PP+  V P
Sbjct: 5   VKPPINLPPVV-PPVIKPPIGIPPVTVPPVVKPPINLPPV-VPPVIKPPIGIPPVT-VPP 61

Query: 358 IL-PPV---PVLNPPSTPTP 405
           +L PP+   P++ PP    P
Sbjct: 62  VLKPPIGLPPIVKPPINLPP 81

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = +1

Query: 232 VPPIVKPPVILPPVTVPPVTVPPITVPPV-VKPTLPPIPGVTPILPPV---PVLNPPSTP 399
           VPP+VKPP+ LPPV VPPV  PPI +PPV V P + P   + P++PPV   P+  PP T 
Sbjct: 1   VPPVVKPPINLPPV-VPPVIKPPIGIPPVTVPPVVKPPINLPPVVPPVIKPPIGIPPVTV 59

Query: 400 TP 405
            P
Sbjct: 60  PP 61

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 26/51 (50%), Positives = 30/51 (58%)
 Frame = +1

Query: 184 VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLP 336
           +KPP  +PPIVKPP  +PPI  PPV +PPV  P     P   PP  K T P
Sbjct: 63  LKPPIGLPPIVKPPINLPPIGIPPVTVPPVITPSPKGKPCPPPPTTKATCP 113

[13][TOP]
>UniRef100_Q9SET1 Cell wall-plasma membrane linker protein homolog n=1
           Tax=Arabidopsis thaliana RepID=Q9SET1_ARATH
          Length = 306

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 45/96 (46%), Positives = 49/96 (51%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
           P P  HKPS  P  P  P    P + PP    P I PP   PPV+ P    PPV  PP  
Sbjct: 123 PKPPHHKPSPTPCPPPTPTPTPPVVTPPTPTHPVITPPTPTPPVVTPATPTPPVITPPTP 182

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PPV+ P  P  P VTP  P  PV+ PP TPTP TP
Sbjct: 183 TPPVITPPTPTPPVVTPPTPTPPVVTPP-TPTPPTP 217

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 53/138 (38%), Positives = 59/138 (42%), Gaps = 25/138 (18%)
 Frame = +1

Query: 76  FLCMLFLSSAAPILGCG-TCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP 252
           FL +L L   A    C  T  KP P  HKP K P KP KPP + PP  KPP + PP  KP
Sbjct: 10  FLVLLLLGFVAVSYACDCTPPKPSPAPHKPPKHPVKPPKPPAVKPP--KPPAVKPPTPKP 67

Query: 253 PVILP--------------PVTVPPVTVPPITVPPVVKPTL----------PPIPGVTPI 360
           P + P              P+  PP   PP T  P  KP+           PP     P 
Sbjct: 68  PTVKPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPSPSTPKPSTTKPPPSTPKPPH 127

Query: 361 LPPVPVLNPPSTPTPTTP 414
             P P   PP TPTPT P
Sbjct: 128 HKPSPTPCPPPTPTPTPP 145

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/93 (46%), Positives = 46/93 (49%), Gaps = 3/93 (3%)
 Frame = +1

Query: 136 KPVPKKHKPS--KKPGKPVKPPGIVP-PIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
           KP P   KPS  K P    KPP   P P   PP    P   PPV+ PP    PV  PP  
Sbjct: 105 KPSPSTPKPSTTKPPPSTPKPPHHKPSPTPCPPPTPTPT--PPVVTPPTPTHPVITPPTP 162

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            PPVV P  P  P +TP  P  PV+ PP TPTP
Sbjct: 163 TPPVVTPATPTPPVITPPTPTPPVITPP-TPTP 194

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 38/90 (42%), Positives = 40/90 (44%), Gaps = 13/90 (14%)
 Frame = +1

Query: 130 CGKPVPKKHKPSKKPGKP----VKPPGIVPPIVKP-----PGIVPPIVKPPVILPPVTVP 282
           C  P P    P   P  P    + PP   PP+V P     P I PP   PPVI PP   P
Sbjct: 135 CPPPTPTPTPPVVTPPTPTHPVITPPTPTPPVVTPATPTPPVITPPTPTPPVITPPTPTP 194

Query: 283 PVTVPPITVPPVVKPTLP----PIPGVTPI 360
           PV  PP   PPVV P  P    PIP   PI
Sbjct: 195 PVVTPPTPTPPVVTPPTPTPPTPIPETCPI 224

[14][TOP]
>UniRef100_Q9SKI0 Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q9SKI0_ARATH
          Length = 291

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 54/124 (43%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +1

Query: 46  MESSKIHAY---LFL-CMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPI 213
           M+SSK+ +    LFL C+++L   +  L CG+C      KH P K P  PV PP  VP +
Sbjct: 1   MDSSKLSSLSLCLFLICIIYLPQHS--LACGSCNPRKGGKHSP-KAPKLPV-PPVTVPKL 56

Query: 214 VKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPS 393
             PP  VP +  PPV +P + VPPVT+P + VPPV  P L P+P VT    PVP +  P 
Sbjct: 57  PVPPVTVPKLPVPPVTVPKLPVPPVTIPKLPVPPVTVPKL-PVPPVTVPKLPVPPVTVPK 115

Query: 394 TPTP 405
            P P
Sbjct: 116 LPVP 119

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 37/91 (40%), Positives = 49/91 (53%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           VPK   P     K   PP  VP +  PP  VP +  PPV +P + VPPVTVP + +PP+ 
Sbjct: 93  VPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPLPPIS 152

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              +PP+ G    LPP+P++ P   P  T P
Sbjct: 153 GLPIPPVVGPNLPLPPLPIVGPILPPGTTPP 183

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/92 (47%), Positives = 55/92 (59%), Gaps = 6/92 (6%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGI-VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT--- 306
           PVP    P K P  PV  P + VPP+  P   VPP+  P + +PPVTVP + +PPI+   
Sbjct: 97  PVPPVTVP-KLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPLPPISGLP 155

Query: 307 VPPVVKPT--LPPIPGVTPILPPVPVLNPPST 396
           +PPVV P   LPP+P V PILP  P   PP+T
Sbjct: 156 IPPVVGPNLPLPPLPIVGPILP--PGTTPPAT 185

[15][TOP]
>UniRef100_Q8H7G8 Putative uncharacterized protein (Fragment) n=1 Tax=Arabidopsis
           thaliana RepID=Q8H7G8_ARATH
          Length = 198

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 54/124 (43%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +1

Query: 46  MESSKIHAY---LFL-CMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPI 213
           M+SSK+ +    LFL C+++L   +  L CG+C      KH P K P  PV PP  VP +
Sbjct: 1   MDSSKLSSLSLCLFLICIIYLPQHS--LACGSCNPRKGGKHSP-KAPKLPV-PPVTVPKL 56

Query: 214 VKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPS 393
             PP  +P +  PPV +P + VPPVTVP + VPPV  P L P+P VT    PVP +  P 
Sbjct: 57  PVPPVTIPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKL-PVPPVTVPKLPVPPVTVPK 115

Query: 394 TPTP 405
            P P
Sbjct: 116 LPVP 119

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/92 (47%), Positives = 55/92 (59%), Gaps = 6/92 (6%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGI-VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT--- 306
           PVP    P K P  PV  P + VPP+  P   VPP+  P + +PPVTVP + +PPI+   
Sbjct: 77  PVPPVTVP-KLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPVPPVTVPKLPLPPISGLP 135

Query: 307 VPPVVKPT--LPPIPGVTPILPPVPVLNPPST 396
           +PPVV P   LPP+P V PILP  P   PP+T
Sbjct: 136 IPPVVGPNLPLPPLPIVGPILP--PGTTPPAT 165

[16][TOP]
>UniRef100_Q9LIE8 Similarity to cell wall-plasma membrane linker protein n=1
           Tax=Arabidopsis thaliana RepID=Q9LIE8_ARATH
          Length = 1480

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/105 (45%), Positives = 53/105 (50%), Gaps = 13/105 (12%)
 Frame = +1

Query: 139 PVPKKHKPSK-KPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P P  HKP    P  PV  PP   PP   PP   PPI K PV  PP+  PP   PPIT+P
Sbjct: 186 PQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIP 245

Query: 313 PVVKP--TLPPIPGVTPILPPV--------PVLNPP-STPTPTTP 414
           PV  P  T PPI     I+PP+        P+ NPP S P  TTP
Sbjct: 246 PVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTTP 290

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +1

Query: 190 PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPP 369
           PP  +PP+  PP   PPI  PP+I+PP+  PPV  PPIT PP+ KP +   P  TP +  
Sbjct: 240 PPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAK 299

Query: 370 VPVLNPP-STPTPTTP 414
            P+  PP STP   TP
Sbjct: 300 PPIATPPISTPPAATP 315

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 52/127 (40%), Positives = 63/127 (49%), Gaps = 23/127 (18%)
 Frame = +1

Query: 103  AAPILGCGTCGKPVPKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
            A P +      KP P    P   P  PV KPP   PPI KPP ++PPI KPPV   P   
Sbjct: 986  AMPPIATPPTAKP-PVATPPIANP--PVEKPPVATPPIAKPPTVLPPIAKPPVETSPTAT 1042

Query: 280  PPVTVPPITVPPVVKP--TLPPI-------PGVT-------PILPPVPVLNPP------S 393
            PP   PP+ +PPVVKP   +PPI       P VT       PI+ P P++ PP      +
Sbjct: 1043 PPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIA 1102

Query: 394  TPTPTTP 414
            TP  +TP
Sbjct: 1103 TPPVSTP 1109

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 43/106 (40%), Positives = 55/106 (51%), Gaps = 2/106 (1%)
 Frame = +1

Query: 103  AAPILGCGTCGKPVPKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
            A P +      KP P    P + P  PV KPP   PP+  PP + PPIV PP+  PP+  
Sbjct: 1212 ATPPVATPPIAKP-PVATSPIETP--PVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAK 1268

Query: 280  PPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPP-STPTPTTP 414
             P+  PPI  PP+ KP +   P  TP +   P+  PP +TP P TP
Sbjct: 1269 SPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATP 1314

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 36/79 (45%), Positives = 43/79 (54%), Gaps = 2/79 (2%)
 Frame = +1

Query: 175  GKP--VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPG 348
            GKP    PP   PP+  PP   PPI+KPPV  PP+T PPV  PP+  PP+ KP +   P 
Sbjct: 1172 GKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPI 1231

Query: 349  VTPILPPVPVLNPPSTPTP 405
             TP +   PV  PP    P
Sbjct: 1232 ETPPVAKPPVTTPPVATPP 1250

 Score = 73.2 bits (178), Expect(2) = 2e-13
 Identities = 32/73 (43%), Positives = 39/73 (53%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           K P   PPI  PP   PPI  PPV  PP+T PP+  PPI +PP+  P +   P   P + 
Sbjct: 224 KSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPIS 283

Query: 367 PVPVLNPPSTPTP 405
             PV  PP+T  P
Sbjct: 284 KPPVTTPPTTTPP 296

 Score = 25.4 bits (54), Expect(2) = 2e-13
 Identities = 12/33 (36%), Positives = 16/33 (48%)
 Frame = +2

Query: 98  PLPPPFSVAAPAVSPSQRNTSPAKSPASP*SHQ 196
           P P P SV  P  +P    T+P  S   P +H+
Sbjct: 160 PPPKPPSVKPPPSTPKPPTTNPPPSTPQPPTHK 192

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 54/137 (39%), Positives = 63/137 (45%), Gaps = 32/137 (23%)
 Frame = +1

Query: 100  SAAPILGCGTCGKPVPKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVT 276
            +A P +     GKP P    P  KP  PV  PP   PPI+KPP   PPI KPPV  PPV 
Sbjct: 1161 TAMPSIATPPIGKP-PVATPPMAKP--PVASPPIATPPIIKPPVATPPITKPPVATPPVA 1217

Query: 277  VPP--------------------VTVPPITVPPVVKPTL--PPIP----GVTPILPP--- 369
             PP                    VT PP+  PP+VKP +  PPI       +PI PP   
Sbjct: 1218 TPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIG 1277

Query: 370  -VPVLNPP-STPTPTTP 414
              P+  PP +TP   TP
Sbjct: 1278 TPPIAKPPVATPPTATP 1294

 Score = 73.2 bits (178), Expect(2) = 4e-13
 Identities = 37/85 (43%), Positives = 43/85 (50%), Gaps = 7/85 (8%)
 Frame = +1

Query: 181  PVKPPGI-VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTP 357
            P+ PP I  PPI KPP   PP   PPV   P+  PPV  PP   PPV KP +   P VTP
Sbjct: 1270 PIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTP 1329

Query: 358  ILPPVPVLNPP------STPTPTTP 414
             +   P+  PP      +TP   TP
Sbjct: 1330 PVATPPIAKPPGARPPVATPPVATP 1354

 Score = 24.6 bits (52), Expect(2) = 4e-13
 Identities = 15/49 (30%), Positives = 22/49 (44%)
 Frame = +2

Query: 38   P*AWSPQRSMLTSSSACSSSPLPPPFSVAAPAVSPSQRNTSPAKSPASP 184
            P A SP  +   +    ++ P+  P  V  P V+P       AKSP +P
Sbjct: 1225 PVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAP 1273

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 40/93 (43%), Positives = 47/93 (50%), Gaps = 17/93 (18%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTL-------PPIP 345
           KPP   PP   PP   PP+ KPPV  PP+  PP   PPI+ PP+ KP +       PPI 
Sbjct: 432 KPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPIT 491

Query: 346 GVTPILPPV--------PVLNPP--STPTPTTP 414
             TP+ PPV        PV  PP  + PT T P
Sbjct: 492 TPTPVKPPVATPPLAIPPVAKPPVVTPPTATPP 524

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 39/106 (36%), Positives = 48/106 (45%), Gaps = 3/106 (2%)
 Frame = +1

Query: 100  SAAPILGCGTCGKP---VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPP 270
            +A P +      KP   +P    P         PP   PPI  PP  +PP+ KPPV+ PP
Sbjct: 710  TATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPP 769

Query: 271  VTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
               PP+  PPI   PV  P     P  TP +   PV  PP+T  PT
Sbjct: 770  TATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPT 815

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 40/105 (38%), Positives = 47/105 (44%), Gaps = 3/105 (2%)
 Frame = +1

Query: 100  SAAPILGCGTCGKP---VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPP 270
            +A P +      KP    P    P        KPP   PPI  PP   PPI+ PP+  PP
Sbjct: 790  TATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPP 849

Query: 271  VTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            V  PP   PPIT PP  KP +   P  TP +   PV  PP+   P
Sbjct: 850  VATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPP 894

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 33/74 (44%), Positives = 41/74 (55%)
 Frame = +1

Query: 190 PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPP 369
           PP   PPI  PP I+PPI  PPV  PP+T PP++ PP+T PP   P +   P  TP +  
Sbjct: 250 PPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPIST 309

Query: 370 VPVLNPPSTPTPTT 411
            P   PP+   P T
Sbjct: 310 PPAATPPAATPPIT 323

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 36/82 (43%), Positives = 41/82 (50%), Gaps = 6/82 (7%)
 Frame = +1

Query: 187  KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
            KPP + PPI KPP   PP   PP+  PP   PPV  PPI  PP+ KP +   P  TP + 
Sbjct: 837  KPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIA 896

Query: 367  PVPVLNPP------STPTPTTP 414
              PV  PP       TP P  P
Sbjct: 897  TSPVAKPPVAIPPIKTPPPAKP 918

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 38/108 (35%), Positives = 51/108 (47%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100  SAAPILGCGTCGKPVPKKHKPSKKP-GKP--VKPPGIVPPIVKPPGIVPPIVKPPVILPP 270
            +A P +      KP      P+  P  KP    PP + PP+  PP   PP  +PPV  PP
Sbjct: 1291 TATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPPVATPP 1350

Query: 271  VTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            V  PP+   P+  PP+ KP +   P  TP +   P+  PP+T   T P
Sbjct: 1351 VATPPIAKSPVATPPMTKPPVASSPIATPPIAKTPIATPPTTMPKTCP 1398

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 40/104 (38%), Positives = 52/104 (50%), Gaps = 1/104 (0%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIV-PPIVKPPGIVPPIVKPPVILPPVT 276
           +A P +      KP P    P+  P  P+  P  V PP+  PP  +PP+ KPPV+ PP  
Sbjct: 465 TAKPPISTPPISKP-PVATPPAATP--PITTPTPVKPPVATPPLAIPPVAKPPVVTPPTA 521

Query: 277 VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            PP+  PPI   PV  P     P  TP +   PV+ PP+T  PT
Sbjct: 522 TPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPT 565

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 41/93 (44%), Positives = 47/93 (50%), Gaps = 3/93 (3%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGI-VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P    P  KP  PV  P I  PP  KPP  +PPI  PPV  PPV  PP   PPI  PP+ 
Sbjct: 644 PIATSPVAKP--PVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIA 701

Query: 322 KPTLPPIPGVTPILPPVPVLNPPST--PTPTTP 414
            P +   P  TP +   P+  PP+T  PT T P
Sbjct: 702 TPPVVTPPTATPPVATPPIAKPPTTIPPTATPP 734

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 34/77 (44%), Positives = 42/77 (54%), Gaps = 1/77 (1%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           KPP  +PP   PP  +PPI  PP   PP+  PP+ +PP+  PPVV P     P  TP + 
Sbjct: 722 KPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIA 781

Query: 367 PVPVLNPPS-TPTPTTP 414
             PV  PP+ TP   TP
Sbjct: 782 KSPVATPPTATPPVATP 798

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 46/106 (43%), Positives = 51/106 (48%), Gaps = 16/106 (15%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVK-----PPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P    P K P  P KPP   PPI K     PP   PP+  PP+  PPV  PP T PP   
Sbjct: 389 PTATSPIKTP-PPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTAT 447

Query: 310 PPVVKPTL--PPI--------PGVTPILPPVPVLNPPS-TPTPTTP 414
           PPV KP +  PPI        P  TP +   PV  PP+ TP  TTP
Sbjct: 448 PPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTP 493

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 34/77 (44%), Positives = 40/77 (51%), Gaps = 1/77 (1%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK-PTLPPIPGVTPIL 363
           KPP + PP   PP   PP+ KPPV  PP+  PP   PPI+ PP+ K P   P     PI 
Sbjct: 552 KPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPIT 611

Query: 364 PPVPVLNPPSTPTPTTP 414
            P P   P +TP   TP
Sbjct: 612 TPPPAKPPVATPPIATP 628

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 40/106 (37%), Positives = 45/106 (42%), Gaps = 3/106 (2%)
 Frame = +1

Query: 103 AAPILGCGTCGKP---VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPV 273
           A P +      KP    P    P        KPP   PPI  PP   PP+  PP+  PPV
Sbjct: 621 ATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPV 680

Query: 274 TVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
             PPV  PP   PP+  P +   P VTP     PV  PP    PTT
Sbjct: 681 AKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTT 726

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 35/77 (45%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
 Frame = +1

Query: 190 PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTL--PPIPGVTPIL 363
           PP + PP   PP   PPI KPP  +PP   PPV +PPI  PP  KP +  PPI  + P+ 
Sbjct: 703 PPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPI-AIPPVA 761

Query: 364 PPVPVLNPPSTPTPTTP 414
            P  V  P +TP   TP
Sbjct: 762 KPPVVTPPTATPPIATP 778

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 40/93 (43%), Positives = 50/93 (53%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT-----VPP-VTVPPIT 306
            P +  P+  P     PP  +PP+VKPP  +PPI KPPV  PPVT     +PP VT PPI 
Sbjct: 1034 PVETSPTATP-PTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIV 1092

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
             PP+ K  +   P  TP +   P+  PP   TP
Sbjct: 1093 TPPIAKSPIATPPVSTPPIAKPPIATPPVATTP 1125

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 37/87 (42%), Positives = 44/87 (50%), Gaps = 10/87 (11%)
 Frame = +1

Query: 184 VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKP-------TLPPI 342
           + PP   PP+  PP   PPI KPPV  PP T PP+  PPI  PP+  P         PPI
Sbjct: 263 IMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPI 322

Query: 343 PGVTPILPPV---PVLNPPSTPTPTTP 414
             + P  PPV   P++ PP TP    P
Sbjct: 323 TTLPPAKPPVAISPIVTPPVTPIAQPP 349

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 40/112 (35%), Positives = 49/112 (43%), Gaps = 10/112 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPP----------GIVPPIVK 249
           +A P +      KP P    P K P  P KPP  +PPI  PP             PPI  
Sbjct: 640 TATPPIATSPVAKP-PVATPPIKTP-PPAKPPVAIPPIATPPVAKPPVATPPTATPPIAT 697

Query: 250 PPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PP+  PPV  PP   PP+  PP+ KP     P  TP +   P+  PP+   P
Sbjct: 698 PPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPP 749

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 39/92 (42%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = +1

Query: 142  VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
            +P   KP  +      PP   PP+  PP + PP+  PP+  PPV  PPVT PP  +PP+V
Sbjct: 1027 LPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIV 1086

Query: 322  KPTLPPIPGVTPILPPVPVLNPP-STPTPTTP 414
             P  PPI  VTP +   P+  PP STP    P
Sbjct: 1087 TP--PPI--VTPPIAKSPIATPPVSTPPIAKP 1114

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 35/74 (47%), Positives = 37/74 (50%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           KPP + PP   PP   PPI K PV  PP   PPV  PPI  PPVV P     P  TP + 
Sbjct: 512 KPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVA 571

Query: 367 PVPVLNPPSTPTPT 408
             PV  PP    PT
Sbjct: 572 KPPVATPPIATPPT 585

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 34/81 (41%), Positives = 41/81 (50%), Gaps = 6/81 (7%)
 Frame = +1

Query: 190 PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPP 369
           PP   PPI KPP  +PP   PPV +PP+  PP   PPI  PP+  P +   P VTP    
Sbjct: 713 PPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTAT 772

Query: 370 VPVLNPP------STPTPTTP 414
            P+  PP      +TP   TP
Sbjct: 773 PPIATPPIAKSPVATPPTATP 793

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 38/89 (42%), Positives = 45/89 (50%), Gaps = 1/89 (1%)
 Frame = +1

Query: 142  VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIV-PPIVKPPVILPPVTVPPVTVPPITVPPV 318
            +P   KP         PP  +PPIV PP IV PPI K P+  PPV+ PP+  PPI  PPV
Sbjct: 1062 IPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPV 1121

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
                +   P  TP     PV NPP   +P
Sbjct: 1122 ATTPIAKPPIATPPTANPPVANPPIAKSP 1150

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 39/106 (36%), Positives = 45/106 (42%), Gaps = 3/106 (2%)
 Frame = +1

Query: 103  AAPILGCGTCGKP---VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPV 273
            A P +      KP    P    P        KPP  +PPI  PP   PP+  PP+  PPV
Sbjct: 871  ATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPV 930

Query: 274  TVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
              PPV  PP   PP+    +   P VTP     PV  PP    PTT
Sbjct: 931  AKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTT 976

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 47/115 (40%), Positives = 56/115 (48%), Gaps = 13/115 (11%)
 Frame = +1

Query: 109  PILGCGTCGKPV---PKKHKPSKKPG---KPVKPPGIV-PPIVKPPGIVPPIVKPPVILP 267
            PI    T   PV   P    P  KP     P   P I  PPI KPP   PP+ KPPV  P
Sbjct: 1130 PIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASP 1189

Query: 268  PVTVPPVTVPPITVPPVVKPTLPPIPGVTPIL--PPV---PVLNPP-STPTPTTP 414
            P+  PP+  PP+  PP+ KP +   P  TP +  PPV   P+  PP + P  TTP
Sbjct: 1190 PIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTP 1244

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 44/113 (38%), Positives = 50/113 (44%), Gaps = 9/113 (7%)
 Frame = +1

Query: 103 AAPILGCGTCGKP---VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPV 273
           A P L      KP    P    P        K P   PP   PP   PPI KPPV+ PP 
Sbjct: 501 ATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPT 560

Query: 274 TVPPVTVPPITVPPVVKPTLPPIPGVTPIL--PPV---PVLNPP-STPTPTTP 414
           T PP   PP+  PPV  P +   P   P +  PP+   PV  PP +TP  TTP
Sbjct: 561 TTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTP 613

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 39/97 (40%), Positives = 44/97 (45%), Gaps = 6/97 (6%)
 Frame = +1

Query: 142  VPKKHKPSKKPGKPVKPPGIVPPIVK-----PPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
            +P   KP         PP   PPI K     PP   PP+  PP+  PPV  PP T PP  
Sbjct: 757  IPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTA 816

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPP-STPTPTTP 414
             PPV KP +   P  TP     P+L PP S P   TP
Sbjct: 817  TPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATP 853

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 40/111 (36%), Positives = 51/111 (45%), Gaps = 8/111 (7%)
 Frame = +1

Query: 106  APILGCGTCGKPV--PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV-----KPPVIL 264
            +P+    T   PV  P   KP         PP   PP+ KPP   PPI      KPP++ 
Sbjct: 783  SPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILT 842

Query: 265  PPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPP-STPTPTTP 414
            PP++ PPV  PP   PP+  P     P  TP +   P+  PP +TP   TP
Sbjct: 843  PPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATP 893

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 35/76 (46%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = +1

Query: 190 PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPP 369
           PP   PPI KPP   PP   PP   PPV  PPV  PPI  PP  KP +   P   P +  
Sbjct: 423 PPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVAT 482

Query: 370 VPVLNPP-STPTPTTP 414
            P   PP +TPTP  P
Sbjct: 483 PPAATPPITTPTPVKP 498

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 39/105 (37%), Positives = 45/105 (42%), Gaps = 3/105 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKP---VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPP 270
           +A P +      KP    P    P        KPP   PPI  PP   PPI  PP+   P
Sbjct: 540 TATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSP 599

Query: 271 VTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           V  PP   PPIT PP  KP +   P  TP +   PV  PP+   P
Sbjct: 600 VATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPP 644

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 41/103 (39%), Positives = 48/103 (46%)
 Frame = +1

Query: 100  SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
            +A P +      KP P    P K P  P KPP  +PPI       PP+ KPPV  PP   
Sbjct: 890  TATPPIATSPVAKP-PVAIPPIKTP-PPAKPPVAIPPIA-----TPPVAKPPVATPPTAT 942

Query: 280  PPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            PP+   PI  PPVV P     P  TP     P+  PP+T  PT
Sbjct: 943  PPIATSPIATPPVVTPPTATSPVATP-----PIAKPPTTTPPT 980

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/118 (38%), Positives = 50/118 (42%), Gaps = 14/118 (11%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKP---GKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPV 273
           A P +      KP       SK P        PP   PP  KPP   PPI  PP+  PPV
Sbjct: 576 ATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPV 635

Query: 274 TVPPVTVPPITVPPVVKPTL--PPIPGVTPILPPV--------PVLNPP-STPTPTTP 414
             PP   PPI   PV KP +  PPI    P  PPV        PV  PP +TP   TP
Sbjct: 636 ATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATP 693

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 36/81 (44%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = +1

Query: 184  VKPPGIVPPIVKPPGIVPPIVKPPVILPP-VTVPPVTVPPITVPPVVKP--TLPPI---P 345
            VKPP  +PPI KPP   PP+  PP  +PP VT PP+  PPI   P+  P  + PPI   P
Sbjct: 1056 VKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPP 1115

Query: 346  GVTPILPPVPVLNPPSTPTPT 408
              TP +   P+  PP    PT
Sbjct: 1116 IATPPVATTPIAKPPIATPPT 1136

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 37/81 (45%), Positives = 41/81 (50%), Gaps = 6/81 (7%)
 Frame = +1

Query: 190 PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTL--PPI---PGVT 354
           PP   PPI KPP + PP   PP   PPV  PPV  PPI  PP  KP +  PPI   P  T
Sbjct: 543 PPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVAT 602

Query: 355 PILPPVPVLNPP-STPTPTTP 414
           P     P+  PP + P   TP
Sbjct: 603 PPAATPPITTPPPAKPPVATP 623

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 36/91 (39%), Positives = 43/91 (47%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   KP         PP    P+ KPP   PPI  PP   PPV +PP+  PP+  PPV  
Sbjct: 628 PPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVAT 687

Query: 325 PTLPPIPGVTPILPPVPVLNPPS-TPTPTTP 414
           P     P  TP +   PV+ PP+ TP   TP
Sbjct: 688 PPTATPPIATPPIATPPVVTPPTATPPVATP 718

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 35/91 (38%), Positives = 49/91 (53%), Gaps = 3/91 (3%)
 Frame = +1

Query: 142  VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV-KPPVILPPVTVPPVTVPPITVPPV 318
            +P   KP        KPP   PP+  PP  +PPIV  PP++ PP+   P+  PP++ PP+
Sbjct: 1052 IPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPI 1111

Query: 319  VKPTL--PPIPGVTPILPPVPVLNPPSTPTP 405
             KP +  PP+   TPI  P P+  PP+   P
Sbjct: 1112 AKPPIATPPV-ATTPIAKP-PIATPPTANPP 1140

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 46/116 (39%), Positives = 53/116 (45%), Gaps = 15/116 (12%)
 Frame = +1

Query: 109  PILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPV 288
            P++   T   PV     P  KP     PP   PP+  PP   PP  KPPV  PP+  PPV
Sbjct: 954  PVVTPPTATSPVATP--PIAKP-PTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPV 1010

Query: 289  TVPPITVPPVVKP--TLPPI--------PGVTP--ILPPV---PVLNPPSTPTPTT 411
              PP+  PP+ KP   LPPI        P  TP    PPV   PV+ PP    P T
Sbjct: 1011 EKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPIT 1066

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 39/101 (38%), Positives = 47/101 (46%), Gaps = 11/101 (10%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P   KP         PP + PPIV PP   PPI K P+  PP+  PP+  PP+  PP   
Sbjct: 1234 PPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTAT 1293

Query: 325  PTL-------PPIPGVTPILPPV---PVLNPPS-TPTPTTP 414
            P +       PP+    P  PPV   PV  PP+ TP   TP
Sbjct: 1294 PPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATP 1334

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 37/92 (40%), Positives = 41/92 (44%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P   KP         PP    PI KPP   PP   PPV  PPV  PP   PP+  PP+ K
Sbjct: 1279 PPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAK 1338

Query: 325  P--TLPPI---PGVTPILPPVPVLNPPSTPTP 405
            P    PP+   P  TP +   PV  PP T  P
Sbjct: 1339 PPGARPPVATPPVATPPIAKSPVATPPMTKPP 1370

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 36/92 (39%), Positives = 46/92 (50%), Gaps = 7/92 (7%)
 Frame = +1

Query: 160  PSKKPGKPVK-PPGIVPPIVKPPGIVPPIVKPPVILP-----PVTVPPVTVPPITVPPVV 321
            P+ KP  P+  PP  +PP+ KPP + PP   PP+  P     PV  PP   PP+  PP+ 
Sbjct: 744  PTAKP--PIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIA 801

Query: 322  KPTLPPIPGVTPILPPVPVLNPP-STPTPTTP 414
            KP +   P   P     PV  PP +TP   TP
Sbjct: 802  KPPVATPPTTAPPTATPPVAKPPVATPPIATP 833

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 39/105 (37%), Positives = 46/105 (43%), Gaps = 3/105 (2%)
 Frame = +1

Query: 109  PILGCGTCGKPV--PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
            PIL       PV  P    P      P KPP   PPI  PP   PP+  PP   PP+   
Sbjct: 839  PILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATS 898

Query: 283  PVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPP-STPTPTTP 414
            PV  PP+ +PP+  P     P   P +   PV  PP +TP   TP
Sbjct: 899  PVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATP 943

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 38/102 (37%), Positives = 46/102 (45%), Gaps = 12/102 (11%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP----------PVTV 294
            P   KP         PP   PP+  PP   PPI   PV  PPV +P          PV +
Sbjct: 863  PPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAI 922

Query: 295  PPITVPPVVKPTLPPIPGVTPILPPVPVLNPP--STPTPTTP 414
            PPI  PPV KP +   P  TP +   P+  PP  + PT T+P
Sbjct: 923  PPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSP 964

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 31/73 (42%), Positives = 35/73 (47%)
 Frame = +1

Query: 190  PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPP 369
            PP + PP    P   PPI KPP   PP   PPV +PPI  PP  KP +   P   P +  
Sbjct: 953  PPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEK 1012

Query: 370  VPVLNPPSTPTPT 408
             PV  PP    PT
Sbjct: 1013 PPVATPPIAKPPT 1025

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 33/77 (42%), Positives = 40/77 (51%), Gaps = 1/77 (1%)
 Frame = +1

Query: 187  KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
            KPP   PP   PP  +PPI  PP   PPV  PP+  PP+  PPV  P +   P V P + 
Sbjct: 972  KPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIA 1031

Query: 367  PVPV-LNPPSTPTPTTP 414
              PV  +P +TP   TP
Sbjct: 1032 KPPVETSPTATPPTATP 1048

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 36/80 (45%), Positives = 41/80 (51%), Gaps = 4/80 (5%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           KPP   PP   PP   PPI  PP+  PP   PP   PPIT  P  KP +   P VTP + 
Sbjct: 284 KPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPPVAISPIVTPPVT 343

Query: 367 PV---PVLNPP-STPTPTTP 414
           P+   PV  PP +TP   TP
Sbjct: 344 PIAQPPVATPPTATPPVATP 363

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 40/101 (39%), Positives = 49/101 (48%), Gaps = 11/101 (10%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV-----PPVTVPPITV 309
           P   KP  +      PP   PPI  PP   PP+  PP   PP+T      PPV  PP+ +
Sbjct: 448 PPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAI 507

Query: 310 PPVVKPTLPPIPGVTPIL--PPV---PVLNPP-STPTPTTP 414
           PPV KP +   P  TP +  PP+   PV  PP +TP   TP
Sbjct: 508 PPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATP 548

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 36/84 (42%), Positives = 41/84 (48%), Gaps = 6/84 (7%)
 Frame = +1

Query: 181 PVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV-----PPVTVPPITVPPVVKPTLPPIP 345
           P KPP   PPI  PP   PP+  PP   PP+       PPV  PPI  PP  KP +   P
Sbjct: 615 PAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPP 674

Query: 346 GVTPILPPVPVLNPP-STPTPTTP 414
             TP +   PV  PP +TP   TP
Sbjct: 675 IATPPVAKPPVATPPTATPPIATP 698

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 31/81 (38%), Positives = 40/81 (49%), Gaps = 7/81 (8%)
 Frame = +1

Query: 193  PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPV 372
            P   PPI KPP   PP   PPV +PP+  PP   PP+  PP+  P +   P  TP +   
Sbjct: 964  PVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKP 1023

Query: 373  PVLNPP-------STPTPTTP 414
            P + PP       ++PT T P
Sbjct: 1024 PTVLPPIAKPPVETSPTATPP 1044

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 31/88 (35%), Positives = 40/88 (45%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P  + P+  P     PP + PPI K P   PP+  PP+  PP+  PPV   PI  PP+  
Sbjct: 1074 PVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIAT 1133

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            P     P   P +   P+  PP    PT
Sbjct: 1134 PPTANPPVANPPIAKSPIAKPPIATPPT 1161

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/102 (37%), Positives = 44/102 (43%), Gaps = 12/102 (11%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP----------PVTV 294
           P   KP         PP   PP+  PP   PPI   PV  PPV  P          PV +
Sbjct: 613 PPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAI 672

Query: 295 PPITVPPVVKPTLPPIPGVTPILPPVPVLNPP--STPTPTTP 414
           PPI  PPV KP +   P  TP +   P+  PP  + PT T P
Sbjct: 673 PPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPP 714

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/92 (39%), Positives = 43/92 (46%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P   KP         PP    P+ KPP  +PPI  PP   PPV +PP+  PP+  PPV  
Sbjct: 878  PPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVAT 937

Query: 325  P--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P    PPI   +PI  P  V  P +T    TP
Sbjct: 938  PPTATPPI-ATSPIATPPVVTPPTATSPVATP 968

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 37/92 (40%), Positives = 45/92 (48%), Gaps = 6/92 (6%)
 Frame = +1

Query: 157  KPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLP 336
            KP         PP   PPI K P   PPI  PP  +P +  PP+  PP+  PP+ KP + 
Sbjct: 1128 KPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVA 1187

Query: 337  PIPGVTP--ILPPV---PVLNPP-STPTPTTP 414
              P  TP  I PPV   P+  PP +TP   TP
Sbjct: 1188 SPPIATPPIIKPPVATPPITKPPVATPPVATP 1219

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 41/109 (37%), Positives = 53/109 (48%), Gaps = 5/109 (4%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           AAP +      KP P    P+  P  P+ KPP   PPI  PP   PP   PP+   P   
Sbjct: 273 AAPPITNPPISKP-PVTTPPTTTP--PIAKPPIATPPISTPPAATPPAATPPITTLPPAK 329

Query: 280 PPVTVPPITVPPVVKPTLPPI---PGVTPILPPVPVLNPPSTPTP-TTP 414
           PPV + PI  PPV     PP+   P  TP +   P+  PP++ +P +TP
Sbjct: 330 PPVAISPIVTPPVTPIAQPPVATPPTATPPVATPPIATPPTSKSPISTP 378

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 40/109 (36%), Positives = 49/109 (44%), Gaps = 8/109 (7%)
 Frame = +1

Query: 109  PILGCGTCGKPV--PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPV--- 273
            P++   T   PV  P   KP         PP  +PPI  PP   PPI  PP+ +PPV   
Sbjct: 704  PVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKP 763

Query: 274  ---TVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
               T P  T PPI  PP+ K  +   P  TP +   P+  PP    PTT
Sbjct: 764  PVVTPPTAT-PPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTT 811

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 30/76 (39%), Positives = 36/76 (47%), Gaps = 1/76 (1%)
 Frame = +1

Query: 190 PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPP 369
           PP    PI  PP   PP+  PP+   P+  PP   PP+  PP+ KP +   P  TP    
Sbjct: 388 PPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTAT 447

Query: 370 VPVLNPP-STPTPTTP 414
            PV  PP  TP   TP
Sbjct: 448 PPVAKPPVETPPIATP 463

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/93 (39%), Positives = 44/93 (47%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVK-PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
            P    P  KP  P+  PP    PI KPP   PP   PPV  PP+   P+  PPI  PP  
Sbjct: 1105 PVSTPPIAKP--PIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTA 1162

Query: 322  KPTL--PPI---PGVTPILPPVPVLNPPSTPTP 405
             P++  PPI   P  TP +   PV +PP    P
Sbjct: 1163 MPSIATPPIGKPPVATPPMAKPPVASPPIATPP 1195

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 29/65 (44%), Positives = 34/65 (52%)
 Frame = +1

Query: 187  KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
            KPPG  PP+  PP   PPI K PV  PP+T PPV   PI  PP+ K  +   P   P   
Sbjct: 1338 KPPGARPPVATPPVATPPIAKSPVATPPMTKPPVASSPIATPPIAKTPIATPPTTMPKTC 1397

Query: 367  PVPVL 381
            P+  L
Sbjct: 1398 PIDTL 1402

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 31/76 (40%), Positives = 37/76 (48%), Gaps = 1/76 (1%)
 Frame = +1

Query: 190  PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPP 369
            PP   PPI  PP    PI KPP+  PP   PPV  PPI   P+ KP +   P   P +  
Sbjct: 1109 PPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIAT 1168

Query: 370  VPVLNPP-STPTPTTP 414
             P+  PP +TP    P
Sbjct: 1169 PPIGKPPVATPPMAKP 1184

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 39/107 (36%), Positives = 45/107 (42%), Gaps = 8/107 (7%)
 Frame = +1

Query: 109  PILGCGTCGKPVPKKHKPSKKPGKP--VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
            PI+       P+ K        G P   KPP   PP   PP    PI KPPV  PP   P
Sbjct: 1255 PIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATP 1314

Query: 283  PV------TVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            PV      T P +T PPV  P +   PG  P +   PV  PP   +P
Sbjct: 1315 PVAKPPVATPPTVT-PPVATPPIAKPPGARPPVATPPVATPPIAKSP 1360

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 38/103 (36%), Positives = 44/103 (42%), Gaps = 11/103 (10%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           PV    +P         PP   PPI  PP    PI  PP+   PV  PP    PI  PP 
Sbjct: 341 PVTPIAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPP 400

Query: 319 VKPTL--PPI--------PGVTPILPPVPVLNPP-STPTPTTP 414
            KP +  PPI        P  TP +   P+  PP +TP  TTP
Sbjct: 401 AKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTP 443

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 33/98 (33%), Positives = 42/98 (42%), Gaps = 13/98 (13%)
 Frame = +1

Query: 160 PSKKPGKPVKP-------PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P  KP   + P       P   PP+  PP   PP+  PP+  PP +  P++ PPI+  PV
Sbjct: 326 PPAKPPVAISPIVTPPVTPIAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPV 385

Query: 319 VKPTLPPIPGVTPILPPVPVLNPP------STPTPTTP 414
             P     P  TP     PV  PP      +TP   TP
Sbjct: 386 ATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATP 423

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 29/74 (39%), Positives = 34/74 (45%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           K P   PPI + P   PP    P+  PP   PPV  PPI   P+  P     P  TP + 
Sbjct: 372 KSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIE 431

Query: 367 PVPVLNPPSTPTPT 408
             PV  PP+T  PT
Sbjct: 432 KPPVATPPTTTPPT 445

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 47/134 (35%), Positives = 55/134 (41%), Gaps = 21/134 (15%)
 Frame = +1

Query: 67  AYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVP-PIVKPPGIVPPI 243
           ++L L +L   +A     C    KP PK HKP K    P KPP + P P  KPP I PP 
Sbjct: 9   SFLILLLLNFFAATYARECSP-PKPSPKPHKPPKHSVVPPKPPAVKPHPHPKPPTIKPPP 67

Query: 244 VK------PPVILP-----------PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP-- 366
            K      PP + P           P   PP    P   PP +KP   P P   P  P  
Sbjct: 68  PKRHPHPKPPTVKPHPHPKPPTKPHPHPKPPTKPHPHPKPPTIKPPPHPKPRPHPKPPNV 127

Query: 367 -PVPVLNPPSTPTP 405
            P P   PP+ P P
Sbjct: 128 KPHPHPKPPTKPHP 141

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 38/96 (39%), Positives = 40/96 (41%), Gaps = 5/96 (5%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT-VP 312
           KP P    P+ KP    KPP    P  KPP    P  KPP I PP   P V  PP T  P
Sbjct: 117 KPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPPPKPPSVKPPPSTPKP 176

Query: 313 PVVKP----TLPPIPGVTPILPPVPVLNPPSTPTPT 408
           P   P      PP     P  P  PV +PP    PT
Sbjct: 177 PTTNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPT 212

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 43/105 (40%), Positives = 45/105 (42%), Gaps = 13/105 (12%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKP---VKPPGIVPPI-------VKPPGIVP-PIVKPPVILPPVTVP 282
           KP  K H   K P KP    KPP I PP         KPP + P P  KPP    P   P
Sbjct: 86  KPPTKPHPHPKPPTKPHPHPKPPTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKP 145

Query: 283 PVTVPPITVPPVVK-PTLPPIPGVTPILPPVPVLN-PPSTPTPTT 411
           P    P   PP +K P  PP     P  P  P  N PPSTP P T
Sbjct: 146 PTKHHPHPKPPTIKPPPKPPSVKPPPSTPKPPTTNPPPSTPQPPT 190

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 41/135 (30%), Positives = 48/135 (35%), Gaps = 43/135 (31%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-----------PGIVPPIVKPPGIVPPIVKPP---------- 255
           P P   KP   P  P KP           P   PP +KPP   PP VKPP          
Sbjct: 122 PKPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPPP-KPPSVKPPPSTPKPPTTN 180

Query: 256 ----------------VILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNP 387
                              PPV  PP+  PP  +PP+  P +   P  TP +   P   P
Sbjct: 181 PPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATP 240

Query: 388 P------STPTPTTP 414
           P      +TP  TTP
Sbjct: 241 PITIPPVATPPITTP 255

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 28/63 (44%), Positives = 32/63 (50%), Gaps = 3/63 (4%)
 Frame = +1

Query: 163  SKKPGK--PVK-PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTL 333
            +K PG   PV  PP   PPI K P   PP+ KPPV   P+  PP+   PI  PP   P  
Sbjct: 1337 AKPPGARPPVATPPVATPPIAKSPVATPPMTKPPVASSPIATPPIAKTPIATPPTTMPKT 1396

Query: 334  PPI 342
             PI
Sbjct: 1397 CPI 1399

[17][TOP]
>UniRef100_Q5JN60 Os01g0750600 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q5JN60_ORYSJ
          Length = 682

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/107 (44%), Positives = 57/107 (53%), Gaps = 2/107 (1%)
 Frame = +1

Query: 94  LSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIV--PPIVKPPGIVPPIVKPPVILP 267
           +SS AP         PV     P + P  PV PP +   PP+  PP   PP+  PPV  P
Sbjct: 1   MSSQAP-------SAPVTPAAPPPQTP--PVTPPPVTAPPPVSPPPVTPPPVTPPPVSPP 51

Query: 268 PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           PV+ PPVT PP++ PPV  P + P   V P  PPVP   PP TPTPT
Sbjct: 52  PVSPPPVTPPPVSPPPVTPPPVTPPTPVAP--PPVPPSPPPPTPTPT 96

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/93 (44%), Positives = 47/93 (50%), Gaps = 3/93 (3%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P +  P   P     PP   PP+  PP   PP+  PPV  PPVT PPV+ PP+T PPV  
Sbjct: 16  PPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPVSPPPVTPPPVSPPPVTPPPVTP 75

Query: 325 PT---LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PT    PP+P   P   P P    PS P P TP
Sbjct: 76  PTPVAPPPVPPSPPPPTPTPTPVTPSPPPPVTP 108

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 44/94 (46%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPP-IVKPPVILPPVTVPPVTVP-PITVP 312
           P P    P   P  PV PP + PP V PP + PP +  PPV  PPVT PPVT P P+  P
Sbjct: 24  PPPVTAPPPVSP-PPVTPPPVTPPPVSPPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPP 82

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PV     PP P  TP+ P  P   PP TP+P  P
Sbjct: 83  PVPPSPPPPTPTPTPVTPSPP---PPVTPSPPPP 113

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 43/100 (43%), Positives = 47/100 (47%), Gaps = 8/100 (8%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  PV PP + PP V PP + PP V PP + PP   PP  V P  VPP 
Sbjct: 30  PPPVSPPPVTPP--PVTPPPVSPPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPPPVPPS 87

Query: 319 VKPTLP--------PIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P        P P VTP  PP PV +PP    PT P
Sbjct: 88  PPPPTPTPTPVTPSPPPPVTP-SPPPPVASPPPPDVPTAP 126

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 40/130 (30%), Positives = 46/130 (35%), Gaps = 38/130 (29%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  PV PP + PP V PP + PP V PP + PP  V P  VPP   PP 
Sbjct: 35  PPPVTPPPVTPP--PVSPPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPPPVPPSPPPPT 92

Query: 319 VKPTL--------------------------------------PPIPGVTPILPPVPVLN 384
             PT                                       PP P   P  PP P ++
Sbjct: 93  PTPTPVTPSPPPPVTPSPPPPVASPPPPDVPTAPPPSNNPPSPPPSPSNVPASPPPPRIS 152

Query: 385 PPSTPTPTTP 414
               P P+TP
Sbjct: 153 LSPPPPPSTP 162

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 31/66 (46%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +1

Query: 220 PPGIVPPIVKPPVILPPVTVPPVTVPP-ITVPPVVKPTLPPIPGVTPILPPVPVLNPPST 396
           P   V P   PP   PPVT PPVT PP ++ PPV  P + P P   P + P PV  PP +
Sbjct: 6   PSAPVTPAAPPPQT-PPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPVSPPPVTPPPVS 64

Query: 397 PTPTTP 414
           P P TP
Sbjct: 65  PPPVTP 70

[18][TOP]
>UniRef100_B8A9G0 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8A9G0_ORYSI
          Length = 682

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/107 (44%), Positives = 57/107 (53%), Gaps = 2/107 (1%)
 Frame = +1

Query: 94  LSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIV--PPIVKPPGIVPPIVKPPVILP 267
           +SS AP         PV     P + P  PV PP +   PP+  PP   PP+  PPV  P
Sbjct: 1   MSSQAP-------SAPVTPAAPPPQTP--PVTPPPVTAPPPVSPPPVTPPPVTPPPVSPP 51

Query: 268 PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           PV+ PPVT PP++ PPV  P + P   V P  PPVP   PP TPTPT
Sbjct: 52  PVSPPPVTPPPVSPPPVTPPPVTPPTPVAP--PPVPPSPPPPTPTPT 96

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 41/93 (44%), Positives = 47/93 (50%), Gaps = 3/93 (3%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P +  P   P     PP   PP+  PP   PP+  PPV  PPVT PPV+ PP+T PPV  
Sbjct: 16  PPQTPPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPVSPPPVTPPPVSPPPVTPPPVTP 75

Query: 325 PT---LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PT    PP+P   P   P P    PS P P TP
Sbjct: 76  PTPVAPPPVPPSPPPPTPTPTPVTPSPPPPVTP 108

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 44/94 (46%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPP-IVKPPVILPPVTVPPVTVP-PITVP 312
           P P    P   P  PV PP + PP V PP + PP +  PPV  PPVT PPVT P P+  P
Sbjct: 24  PPPVTAPPPVSP-PPVTPPPVTPPPVSPPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPP 82

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PV     PP P  TP+ P  P   PP TP+P  P
Sbjct: 83  PVPPSPPPPTPTPTPVTPSPP---PPVTPSPPPP 113

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 43/100 (43%), Positives = 47/100 (47%), Gaps = 8/100 (8%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  PV PP + PP V PP + PP V PP + PP   PP  V P  VPP 
Sbjct: 30  PPPVSPPPVTPP--PVTPPPVSPPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPPPVPPS 87

Query: 319 VKPTLP--------PIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P        P P VTP  PP PV +PP    PT P
Sbjct: 88  PPPPTPTPTPVTPSPPPPVTP-SPPPPVASPPPPDVPTAP 126

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 41/130 (31%), Positives = 47/130 (36%), Gaps = 38/130 (29%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  PV PP + PP V PP + PP V PP + PP  V P  VPP   PP 
Sbjct: 35  PPPVTPPPVTPP--PVSPPPVSPPPVTPPPVSPPPVTPPPVTPPTPVAPPPVPPSPPPPT 92

Query: 319 VKPT--------------------------------------LPPIPGVTPILPPVPVLN 384
             PT                                      LPP P   P  PP P ++
Sbjct: 93  PTPTPVTPSPPPPVTPSPPPPVASPPPPDVPTAPPPSNNPPSLPPSPSNVPASPPPPRIS 152

Query: 385 PPSTPTPTTP 414
               P P+TP
Sbjct: 153 LSPPPPPSTP 162

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 31/66 (46%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +1

Query: 220 PPGIVPPIVKPPVILPPVTVPPVTVPP-ITVPPVVKPTLPPIPGVTPILPPVPVLNPPST 396
           P   V P   PP   PPVT PPVT PP ++ PPV  P + P P   P + P PV  PP +
Sbjct: 6   PSAPVTPAAPPPQT-PPVTPPPVTAPPPVSPPPVTPPPVTPPPVSPPPVSPPPVTPPPVS 64

Query: 397 PTPTTP 414
           P P TP
Sbjct: 65  PPPVTP 70

[19][TOP]
>UniRef100_C5Z6N9 Putative uncharacterized protein Sb10g025210 n=1 Tax=Sorghum
           bicolor RepID=C5Z6N9_SORBI
          Length = 309

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 44/110 (40%), Positives = 56/110 (50%), Gaps = 19/110 (17%)
 Frame = +1

Query: 139 PVPKKHKPSKKPG-KPVKPPGIV---------PPIVKPPGIVPPIVKPPVILPPVTVPPV 288
           P P   +P K P   PV  P +V         PP+ +PP + PP+  PP+I PPVT PPV
Sbjct: 81  PAPGHQQPPKSPSYPPVTRPPVVGPPKGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPV 140

Query: 289 TVPPITVPPVV-KPTLPPIPGVTPILPPV--------PVLNPPSTPTPTT 411
             PP+T PP+   PT PP+ G     PP+        P+  PPST  P T
Sbjct: 141 VGPPVTYPPITGPPTTPPVVGPPVTYPPITGPPSTTPPITGPPSTTPPVT 190

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 49/116 (42%), Positives = 59/116 (50%), Gaps = 25/116 (21%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPV----KPPGI--VPPIVKPPGIV---------PPIVKPPVILPPV 273
           P PK  KP K P  P     +PP     PP+ +P  +V         PP+ +PPV+ PPV
Sbjct: 67  PKPKNPKPPKGPAYPAPGHQQPPKSPSYPPVTRP-PVVGPPKGPVTRPPVTRPPVVGPPV 125

Query: 274 TVPPVTVPPITVPPVVKP--TLPPIPGVTPILPPV--------PVLNPPSTPTPTT 411
           T PP+  PP+T PPVV P  T PPI G  P  PPV        P+  PPST  P T
Sbjct: 126 TYPPIIGPPVTRPPVVGPPVTYPPITG-PPTTPPVVGPPVTYPPITGPPSTTPPIT 180

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 48/120 (40%), Positives = 55/120 (45%), Gaps = 15/120 (12%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           S  P+      G P     +P       V PP   PPI+ PP   PP+V PPV  PP+T 
Sbjct: 93  SYPPVTRPPVVGPPKGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVTYPPITG 152

Query: 280 PPVTV----PPITVPPVVKP--TLPPIPGVTPILPPV---PVLNPP------STPTPTTP 414
           PP T     PP+T PP+  P  T PPI G     PPV   PV  PP      STP P  P
Sbjct: 153 PPTTPPVVGPPVTYPPITGPPSTTPPITGPPSTTPPVTGPPVTYPPGGGGGSSTPCPPPP 212

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 37/76 (48%), Positives = 41/76 (53%)
 Frame = +1

Query: 181 PVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPI 360
           P+  P   PP+V PP   PPI  PP   PP+T PP T PP+T PPV  P        TP 
Sbjct: 149 PITGPPTTPPVVGPPVTYPPITGPPSTTPPITGPPSTTPPVTGPPVTYPPGGGGGSSTPC 208

Query: 361 LPPVPVLNPPSTPTPT 408
            PP     PPSTPTPT
Sbjct: 209 PPPP----PPSTPTPT 220

[20][TOP]
>UniRef100_Q00451 36.4 kDa proline-rich protein n=1 Tax=Solanum lycopersicum
           RepID=PRF1_SOLLC
          Length = 346

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 48/117 (41%), Positives = 55/117 (47%), Gaps = 27/117 (23%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIV----------------------KPPGIVPPIVKPPV 258
           P   KP K P    KPP  +PPIV                      KPP   PPIV PP+
Sbjct: 125 PSTPKPPKTPPFTPKPPSPIPPIVSPPIVYPPITPTPPIVHPPVTPKPPSPTPPIVSPPI 184

Query: 259 ILPPVT-VPPVTVPP-ITVPPVVKPTLPPIPGVT---PILPPVPVLNPPSTPTPTTP 414
           + PP+T  PPV  PP I  PP+V P   P P V    P +P  PV+ PP  PTP TP
Sbjct: 185 VYPPITPTPPVVSPPIIPTPPIVSPPFVPNPPVVIPPPYVPSPPVVTPPIVPTPPTP 241

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 40/96 (41%), Positives = 50/96 (52%), Gaps = 14/96 (14%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV------PPVT------VPPI 303
           P   P    KPP   P   KPP  +PPIV PP++ PP+T       PPVT       PPI
Sbjct: 120 PIVSPPSTPKPPKTPPFTPKPPSPIPPIVSPPIVYPPITPTPPIVHPPVTPKPPSPTPPI 179

Query: 304 TVPPVVKPTLPPIPGVT--PILPPVPVLNPPSTPTP 405
             PP+V P + P P V   PI+P  P+++PP  P P
Sbjct: 180 VSPPIVYPPITPTPPVVSPPIIPTPPIVSPPFVPNP 215

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 45/118 (38%), Positives = 54/118 (45%), Gaps = 28/118 (23%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPP---GIVPPIVKPPGIV-------PPIVKPPVI-------- 261
           KP      P   P KP  PP   G  PPIVKPP +        PPIV PP          
Sbjct: 76  KPPSTPKHPKHPPQKPCPPPSHHGPKPPIVKPPHVPRPPIVHPPPIVSPPSTPKPPKTPP 135

Query: 262 --------LPPVTVPPVTVPPIT-VPPVVKPTL-PPIPGVTPILPPVPVLNPPSTPTP 405
                   +PP+  PP+  PPIT  PP+V P + P  P  TP +   P++ PP TPTP
Sbjct: 136 FTPKPPSPIPPIVSPPIVYPPITPTPPIVHPPVTPKPPSPTPPIVSPPIVYPPITPTP 193

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 41/110 (37%), Positives = 47/110 (42%), Gaps = 18/110 (16%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPP----GIVPPIVKPP-------VILPPVTVPP 285
           P   KH P  KP    K P   P    PP    G  PPIVKPP       V  PP+  PP
Sbjct: 66  PTTPKHPPHVKPPSTPKHPKHPPQKPCPPPSHHGPKPPIVKPPHVPRPPIVHPPPIVSPP 125

Query: 286 VTVPPITVPPVVKPTLPPIPGVT-------PILPPVPVLNPPSTPTPTTP 414
            T  P   PP       PIP +        PI P  P+++PP TP P +P
Sbjct: 126 STPKPPKTPPFTPKPPSPIPPIVSPPIVYPPITPTPPIVHPPVTPKPPSP 175

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 49/132 (37%), Positives = 57/132 (43%), Gaps = 34/132 (25%)
 Frame = +1

Query: 112 ILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIV-----PPIVK-------PP 255
           ++ C  C  P P   K  K P K VKPP   PP VKPP        PP VK       PP
Sbjct: 4   LIACPYCPYP-PSTPKHPKLPPK-VKPPSTQPPHVKPPSTPKHPKDPPHVKPPSTPKQPP 61

Query: 256 VILPPVTV--PPVTVPPIT--------------------VPPVVKPTLPPIPGVTPILPP 369
            + PP T   PP   PP T                     PP+VKP   P P   PI+ P
Sbjct: 62  YVKPPTTPKHPPHVKPPSTPKHPKHPPQKPCPPPSHHGPKPPIVKPPHVPRP---PIVHP 118

Query: 370 VPVLNPPSTPTP 405
            P+++PPSTP P
Sbjct: 119 PPIVSPPSTPKP 130

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 33/75 (44%), Positives = 41/75 (54%), Gaps = 4/75 (5%)
 Frame = +1

Query: 190 PPGIVPPIVKPPGIVPP--IVKPPVILPP--VTVPPVTVPPITVPPVVKPTLPPIPGVTP 357
           PP + PPI+  P IV P  +  PPV++PP  V  PPV  PPI       PT PP P   P
Sbjct: 193 PPVVSPPIIPTPPIVSPPFVPNPPVVIPPPYVPSPPVVTPPIV------PT-PPTPCPPP 245

Query: 358 ILPPVPVLNPPSTPT 402
             PP  + +PP+ PT
Sbjct: 246 PPPPAIIPSPPAQPT 260

[21][TOP]
>UniRef100_C5Y908 Putative uncharacterized protein Sb06g030490 n=1 Tax=Sorghum
           bicolor RepID=C5Y908_SORBI
          Length = 217

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 55/136 (40%), Positives = 73/136 (53%), Gaps = 15/136 (11%)
 Frame = +1

Query: 46  MESSKIHAYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPP 225
           MES+K+ A L L ML LSS+   L      K  P+ H  S + G P      +PPI  P 
Sbjct: 1   MESTKLSALLVLAMLALSSSPLALAWE---KAEPECH--SCESGSPPSTGVPLPPISIPS 55

Query: 226 GIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPI-LPPVPVLN------ 384
             +PP+  P V LPPV++P V +P + VPPV   TLPP+ G+ P+ LPP+P++       
Sbjct: 56  VPLPPVSIPSVPLPPVSIPSVPIPKLPVPPV---TLPPVSGLPPVSLPPIPIIGGSPTKK 112

Query: 385 --------PPSTPTPT 408
                   PPS PTPT
Sbjct: 113 GHRKACPPPPSPPTPT 128

[22][TOP]
>UniRef100_UPI0001A7B3CA lipid binding / structural constituent of cell wall n=1
           Tax=Arabidopsis thaliana RepID=UPI0001A7B3CA
          Length = 275

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 52/126 (41%), Positives = 60/126 (47%), Gaps = 10/126 (7%)
 Frame = +1

Query: 67  AYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV 246
           +++ L +L L + +    C    KP P   KP K P KP KPP + PP   P    PP V
Sbjct: 10  SFVILLLLGLLAVSYACDCSDPPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPK---PPTV 66

Query: 247 KPPVILPPVTVPPVTVPPITV----PPVVKPTLPPI------PGVTPILPPVPVLNPPST 396
           KPP    P   PP T  P TV    PP VKP  PP       P V P  PP P + PP  
Sbjct: 67  KPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKP--PPPPTVKPPPP 124

Query: 397 PTPTTP 414
           PTP TP
Sbjct: 125 PTPYTP 130

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 43/95 (45%), Positives = 44/95 (46%), Gaps = 2/95 (2%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKP--VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           KP P    P+ KP  P  VKPP   PP VKPP    P   PP    P T PP TV P   
Sbjct: 96  KPPPP---PTVKPPPPPYVKPPP--PPTVKPPPPPTPYTPPPPT--PYTPPPPTVKP-PP 147

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PPVV P  PP P      P  P   PP TP P  P
Sbjct: 148 PPVVTPP-PPTP-----TPEAPCPPPPPTPYPPPP 176

[23][TOP]
>UniRef100_UPI0001A7B0BB lipid binding / structural constituent of cell wall n=1
           Tax=Arabidopsis thaliana RepID=UPI0001A7B0BB
          Length = 370

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 52/126 (41%), Positives = 60/126 (47%), Gaps = 10/126 (7%)
 Frame = +1

Query: 67  AYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV 246
           +++ L +L L + +    C    KP P   KP K P KP KPP + PP   P    PP V
Sbjct: 10  SFVILLLLGLLAVSYACDCSDPPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPK---PPTV 66

Query: 247 KPPVILPPVTVPPVTVPPITV----PPVVKPTLPPI------PGVTPILPPVPVLNPPST 396
           KPP    P   PP T  P TV    PP VKP  PP       P V P  PP P + PP  
Sbjct: 67  KPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKP--PPPPTVKPPPP 124

Query: 397 PTPTTP 414
           PTP TP
Sbjct: 125 PTPYTP 130

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 43/95 (45%), Positives = 44/95 (46%), Gaps = 2/95 (2%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKP--VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           KP P    P+ KP  P  VKPP   PP VKPP    P   PP    P T PP TV P   
Sbjct: 96  KPPPP---PTVKPPPPPYVKPPP--PPTVKPPPPPTPYTPPPPT--PYTPPPPTVKP-PP 147

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PPVV P  PP P      P  P   PP TP P  P
Sbjct: 148 PPVVTPP-PPTP-----TPEAPCPPPPPTPYPPPP 176

[24][TOP]
>UniRef100_Q9MAW3 TrPRP2 n=1 Tax=Trifolium repens RepID=Q9MAW3_TRIRP
          Length = 343

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 43/92 (46%), Positives = 52/92 (56%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   KP       VKPP   PP+VKPP   PP+ KPPV++PPV  PPV  PP+  PPVVK
Sbjct: 97  PPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVK 156

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+     + PPV   PV+ PP    P
Sbjct: 157 PPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPP 188

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 42/93 (45%), Positives = 51/93 (54%), Gaps = 5/93 (5%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           +P  +KP        KPP + PP+ KPP   PP+VKPPV  PPV  PPV  PP+  PPVV
Sbjct: 136 MPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVV 195

Query: 322 KPTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           KP +  PP+     + PPV   PV  PP    P
Sbjct: 196 KPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPP 228

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 40/87 (45%), Positives = 48/87 (55%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP       VKPP   PP+VKPP   PP+ KPPV+ PPV  PPV  PP+  PPV K
Sbjct: 157 PPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYK 216

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P V P +   PV+ PP    P
Sbjct: 217 PPVYKPPVVKPPIYKPPVVKPPVYKPP 243

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 43/88 (48%), Positives = 50/88 (56%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+VKPP   PP+VKPPV  PPV  PPV +PP+  PPV 
Sbjct: 88  PVEKPPVYKP--PVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVY 145

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P V P +   PV  PP    P
Sbjct: 146 KPPVYKPPVVKPPVYKPPVYKPPVVKPP 173

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 37/87 (42%), Positives = 48/87 (55%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP + PP+ KPP + PP+ KPPV  PPV +PPV  PP+  PPV K
Sbjct: 92  PPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYK 151

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV+ PP    P
Sbjct: 152 PPVVKPPVYKPPVYKPPVVKPPVYKPP 178

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 42/92 (45%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP       V PP   PP+ KPP   PP+VKPPV  PPV  PPV  PP+  PPVVK
Sbjct: 122 PPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVK 181

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+     + PPV   PV  PP    P
Sbjct: 182 PPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPP 213

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/93 (49%), Positives = 52/93 (55%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P    P  KP  PV KPP + PP+ KPP   PP+VKPPV  PPV  PPV  PPI  PPVV
Sbjct: 178 PVVKPPVYKP--PVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVV 235

Query: 322 KPTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           KP +  PP+       PPV   PV+ PP    P
Sbjct: 236 KPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPP 268

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/87 (44%), Positives = 47/87 (54%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP       VKPP   PP+ KPP + PPI KPPV+ PPV  PPV  PP+  PPV K
Sbjct: 197 PPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYK 256

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV+ PP    P
Sbjct: 257 PPVVKPPVYKPPVYKPPVVKPPVYKPP 283

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 43/92 (46%), Positives = 50/92 (54%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+VKPP   PP+VKPPV  PPV  PPV  PP+  PPVVK
Sbjct: 202 PPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVK 261

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+     + PPV   PV  PP    P
Sbjct: 262 PPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPP 293

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/92 (44%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   KP       VKPP   PP+ KPP ++PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 107 PPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYK 166

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+     + PPV   PV  PP    P
Sbjct: 167 PPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPP 198

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 40/92 (43%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+VKPP   PP+ KPPV+ PP+  PPV  PP+  PPV K
Sbjct: 187 PPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEK 246

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+     + PPV   PV  PP    P
Sbjct: 247 PPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPP 278

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/92 (44%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+VKPP   PP+ KPPV+ PPV  PPV  PP+  PPV K
Sbjct: 237 PPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPPVEK 296

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 297 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 328

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 39/87 (44%), Positives = 46/87 (52%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+VKPP   PP+VKPPV  PPV  PPV  PP+  PPV K
Sbjct: 147 PPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYK 206

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV+ PP    P
Sbjct: 207 PPVVKPPVYKPPVYKPPVVKPPIYKPP 233

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 40/87 (45%), Positives = 46/87 (52%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   KP       VKPP   PP+ KPP + PP+ KPPV  PPV  PPV  PP+  PPVVK
Sbjct: 167 PPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVK 226

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P V P +   PV  PP    P
Sbjct: 227 PPIYKPPVVKPPVYKPPVEKPPVYKPP 253

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 39/87 (44%), Positives = 45/87 (51%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP       VKPP   PP+VKPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 212 PPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYK 271

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 272 PPVVKPPVYKPPVEKPPVYKPPVEKPP 298

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 41/92 (44%), Positives = 50/92 (54%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPVVK
Sbjct: 62  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVK 121

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+     ++PPV   PV  PP    P
Sbjct: 122 PPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPP 153

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/87 (42%), Positives = 45/87 (51%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+VKPP   PP+ KPPV+ PPV  PPV  PP+  PP+ K
Sbjct: 172 PPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYK 231

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 232 PPVVKPPVYKPPVEKPPVYKPPVYKPP 258

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 38/85 (44%), Positives = 44/85 (51%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+VKPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 252 PPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 311

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTP 399
           P +   P   P +   PV  PP  P
Sbjct: 312 PPVEKPPVYKPPVEKPPVYEPPHHP 336

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/88 (45%), Positives = 49/88 (55%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P    P  KP  PV KPP ++PP+ KPP   PP+ KPPV+ PPV  PPV  PP+  PPV 
Sbjct: 118 PVVKPPVYKP--PVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVY 175

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV+ PP    P
Sbjct: 176 KPPVVKPPVYKPPVYKPPVVKPPVYKPP 203

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 41/92 (44%), Positives = 48/92 (52%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP + PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPVVK
Sbjct: 217 PPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVK 276

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 277 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 308

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/92 (43%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV+ PPV  PPV  PP+  PPV K
Sbjct: 72  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYK 131

Query: 325 P--TLPPIPGVTPILPPV---PVLNPPSTPTP 405
           P   +PP+       PPV   PV+ PP    P
Sbjct: 132 PPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPP 163

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 39/87 (44%), Positives = 46/87 (52%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPVVK
Sbjct: 52  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVK 111

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P V P +   PV  PP    P
Sbjct: 112 PPVYKPPVVKPPVYKPPVYKPPVVMPP 138

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 41/92 (44%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+VKPPV  PPV  PPV  PP+  PPV K
Sbjct: 227 PPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEK 286

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 287 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 318

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 45/110 (40%), Positives = 52/110 (47%)
 Frame = +1

Query: 76  FLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPP 255
           FL +L  +  A   G     KP P    P   P   VKPP   PP+ KPP   PP+ KPP
Sbjct: 6   FLVLLLFALFAIPQGLANYEKP-PVYTPPVYTP-PIVKPPVYKPPVEKPPVYKPPVEKPP 63

Query: 256 VILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           V  PPV  PPV  PP+  PPV KP +   P   P +   PV  PP    P
Sbjct: 64  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPP 113

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 38/87 (43%), Positives = 46/87 (52%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 42  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 101

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P V P +   PV+ PP    P
Sbjct: 102 PPVYKPPVVKPPVYKPPVVKPPVYKPP 128

[25][TOP]
>UniRef100_Q9FUF1 Putative proline-rich protein (Fragment) n=1 Tax=Solanum
           lycopersicum RepID=Q9FUF1_SOLLC
          Length = 158

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 41/79 (51%), Positives = 53/79 (67%), Gaps = 6/79 (7%)
 Frame = +1

Query: 184 VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKP--TLPP--IPGV 351
           + PP  +PPIVKPP  +PP+  PP++ PPV +PPV +PP+TVPP+VKP   LPP  IP V
Sbjct: 14  ILPPVGIPPIVKPPVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVKPPVDLPPIGIPPV 73

Query: 352 T--PILPPVPVLNPPSTPT 402
           T  P++ P P    P  PT
Sbjct: 74  TVPPVIKPSPKGKKPCPPT 92

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 38/83 (45%), Positives = 50/83 (60%), Gaps = 9/83 (10%)
 Frame = +1

Query: 160 PSKKPGKPVK-PPGIVPPIVKPPGI-----VPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P  KP  PVK PP  +PPIVKPP       +PP+  PP++ PPV +PP+ +PP+TVPPV+
Sbjct: 22  PIVKP--PVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVKPPVDLPPIGIPPVTVPPVI 79

Query: 322 KPT---LPPIPGVTPILPPVPVL 381
           KP+     P P  T    P+  L
Sbjct: 80  KPSPKGKKPCPPTTKATCPIDTL 102

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 2/64 (3%)
 Frame = +1

Query: 205 PPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKP--TLPPIPGVTPILPPVPV 378
           PPI  PP + PP++ PPV +PP+  PPV +PP+ +PP+VKP   LPP+ G+ P+  P P+
Sbjct: 1   PPIGIPPIVKPPVILPPVGIPPIVKPPVKLPPVGIPPIVKPPVDLPPV-GIPPVTVP-PI 58

Query: 379 LNPP 390
           + PP
Sbjct: 59  VKPP 62

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 29/60 (48%), Positives = 36/60 (60%)
 Frame = +1

Query: 235 PPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PPI  PP++ PPV +PPV +PPI  PPV    LPP+ G+ PI+ P   L P   P  T P
Sbjct: 1   PPIGIPPIVKPPVILPPVGIPPIVKPPV---KLPPV-GIPPIVKPPVDLPPVGIPPVTVP 56

[26][TOP]
>UniRef100_O23370 Cell wall protein like n=1 Tax=Arabidopsis thaliana
           RepID=O23370_ARATH
          Length = 428

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 52/126 (41%), Positives = 60/126 (47%), Gaps = 10/126 (7%)
 Frame = +1

Query: 67  AYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV 246
           +++ L +L L + +    C    KP P   KP K P KP KPP + PP   P    PP V
Sbjct: 10  SFVILLLLGLLAVSYACDCSDPPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPK---PPTV 66

Query: 247 KPPVILPPVTVPPVTVPPITV----PPVVKPTLPPI------PGVTPILPPVPVLNPPST 396
           KPP    P   PP T  P TV    PP VKP  PP       P V P  PP P + PP  
Sbjct: 67  KPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKP--PPPPTVKPPPP 124

Query: 397 PTPTTP 414
           PTP TP
Sbjct: 125 PTPYTP 130

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 43/95 (45%), Positives = 44/95 (46%), Gaps = 2/95 (2%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKP--VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           KP P    P+ KP  P  VKPP   PP VKPP    P   PP    P T PP TV P   
Sbjct: 96  KPPPP---PTVKPPPPPYVKPPP--PPTVKPPPPPTPYTPPPPT--PYTPPPPTVKP-PP 147

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PPVV P  PP P      P  P   PP TP P  P
Sbjct: 148 PPVVTPP-PPTP-----TPEAPCPPPPPTPYPPPP 176

[27][TOP]
>UniRef100_B0WFS6 Putative uncharacterized protein n=1 Tax=Culex quinquefasciatus
           RepID=B0WFS6_CULQU
          Length = 557

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/112 (41%), Positives = 65/112 (58%), Gaps = 10/112 (8%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKP----PGIVPPIVKPPVIL 264
           ++ A +   G+     P    P+     PV  P ++PP+  P    P ++PP+  PPV L
Sbjct: 401 TTVASVATIGSGSDTSPDSGLPTVPGLPPVTIPPVLPPLTLPPVTIPPVLPPVTLPPVTL 460

Query: 265 PPVTVPPV----TVPPITVPPVVKP-TLPPIPGVTPILPPVPVLN-PPSTPT 402
           PPVT+PPV    T+PP+T+PPV+ P TLPP+  + P+LPPV  L  PP  PT
Sbjct: 461 PPVTIPPVLPALTLPPVTIPPVLPPVTLPPVT-LPPVLPPVAGLTLPPILPT 511

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 44/88 (50%), Positives = 57/88 (64%), Gaps = 10/88 (11%)
 Frame = +1

Query: 181 PVKPPGIVPPIVKPPGIVPPIVKPPVI----LPPVTVPPVTVPPITVPPV-VKPTLPPIP 345
           PV  P ++PP+  PP  +PP+  PPV+    LPPVT+PPV +PP+T+PPV + P LPP+ 
Sbjct: 443 PVTIPPVLPPVTLPPVTLPPVTIPPVLPALTLPPVTIPPV-LPPVTLPPVTLPPVLPPVA 501

Query: 346 GVT--PILPPVPVL---NPPSTPTPTTP 414
           G+T  PILP VP L    PP    PT P
Sbjct: 502 GLTLPPILPTVPNLVATMPPGGGHPTVP 529

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 1/82 (1%)
 Frame = +1

Query: 172 PGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKP-TLPPIPG 348
           P  P  PP  +PP++ PP  +PP+  PPV LPPVT+PPVT+PP+T+PPV+   TLPP+  
Sbjct: 422 PTVPGLPPVTIPPVL-PPLTLPPVTIPPV-LPPVTLPPVTLPPVTIPPVLPALTLPPVT- 478

Query: 349 VTPILPPVPVLNPPSTPTPTTP 414
           + P+LPPV +  PP T  P  P
Sbjct: 479 IPPVLPPVTL--PPVTLPPVLP 498

[28][TOP]
>UniRef100_Q4VT04 Arabinogalactan protein (Fragment) n=1 Tax=Picea sitchensis
           RepID=Q4VT04_PICSI
          Length = 148

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 40/98 (40%), Positives = 50/98 (51%), Gaps = 6/98 (6%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGK---PVKPPGIVP---PIVKPPGIVPPIVKPPVI 261
           +A P+       KP P    P+K P K   P KPP + P   P+  PP   PP+  PPV 
Sbjct: 48  TATPVAPAHAPXKPAPPVTAPAKPPVKAPPPTKPPAVAPAKSPVATPPVSAPPVATPPVS 107

Query: 262 LPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           +PPV  PPV VPP+ VPP   P +PP     P+  P P
Sbjct: 108 VPPVAAPPVAVPPVAVPPASPPAIPP-----PVQAPAP 140

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 41/97 (42%), Positives = 48/97 (49%), Gaps = 7/97 (7%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPV----KPPGIVPPIVKPPGIVP---PIVKPPVILPPVTVPPVTVP 297
           PV   H P K P  PV    KPP   PP  KPP + P   P+  PPV  PPV  PPV+VP
Sbjct: 51  PVAPAHAPXK-PAPPVTAPAKPPVKAPPPTKPPAVAPAKSPVATPPVSAPPVATPPVSVP 109

Query: 298 PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           P+  PPV  P +   P   P +PP     P   P P+
Sbjct: 110 PVAAPPVAVPPVAVPPASPPAIPP-----PVQAPAPS 141

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 42/119 (35%), Positives = 57/119 (47%), Gaps = 13/119 (10%)
 Frame = +1

Query: 88  LFLSSAAPILGCG----TCGKPVPKKHKPSKKPGKPVKPPGI-VPPIV---KPPGIVPPI 243
           + L++AAP         T   P+P    P+  P  P   P    PP+    KPP   PP 
Sbjct: 19  IVLATAAPTXAAKPPTTTPAAPLPTPKPPTATPVAPAHAPXKPAPPVTAPAKPPVKAPPP 78

Query: 244 VKPPVILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPP--VPVLNPPSTPTP 405
            KPP + P   PV  PPV+ PP+  PPV   ++PP+      +PP  VP  +PP+ P P
Sbjct: 79  TKPPAVAPAKSPVATPPVSAPPVATPPV---SVPPVAAPPVAVPPVAVPPASPPAIPPP 134

[29][TOP]
>UniRef100_Q39353 Cell wall-plasma membrane linker protein n=1 Tax=Brassica napus
           RepID=Q39353_BRANA
          Length = 376

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 49/116 (42%), Positives = 55/116 (47%), Gaps = 24/116 (20%)
 Frame = +1

Query: 139 PVPKKHKP-------SKKPGKPV----KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPP 285
           P P  HKP       +  P  PV     PP   PP+V PP   PP+V PP   PPV  PP
Sbjct: 159 PKPPTHKPPTVCPPPTPTPTPPVVTPPTPPTPTPPVVTPPTPAPPVVTPPTPTPPVVTPP 218

Query: 286 VTVPPIT---VPPVVKPTLPPIPGVTPILPPV--------PVLNPPSTP--TPTTP 414
              PP+     PPVV P  P  P VTP  PPV        PV+ PP+ P  TP TP
Sbjct: 219 TPTPPVVTPPTPPVVTPPTPTPPVVTPPTPPVVTPPTPTPPVVTPPTPPVVTPPTP 274

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 48/105 (45%), Positives = 52/105 (49%), Gaps = 12/105 (11%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVP--PIVKPPGI--------VPPIVKPPVILPPVTVPP 285
           KP P   KP  KP   VKPP   P  P  KPP +         PP+V PP   PP   PP
Sbjct: 137 KPPPSTPKPPTKP-PTVKPPPSTPKPPTHKPPTVCPPPTPTPTPPVVTPPT--PPTPTPP 193

Query: 286 VTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTP--TPTTP 414
           V  PP   PPVV P  P  P VTP  P  PV+ PP+ P  TP TP
Sbjct: 194 VVTPPTPAPPVVTPPTPTPPVVTPPTPTPPVVTPPTPPVVTPPTP 238

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/113 (42%), Positives = 54/113 (47%), Gaps = 11/113 (9%)
 Frame = +1

Query: 109 PILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPP---VILPPVTV 279
           P++   T   P P    P       V PP   PP+V PP   PP+V PP   V+ PP   
Sbjct: 180 PVVTPPTPPTPTPPVVTPPTPAPPVVTPPTPTPPVVTPPTPTPPVVTPPTPPVVTPPTPT 239

Query: 280 PPVTVPPITVPPVVKPTLPPIPGVTPILPPV--------PVLNPPSTPTPTTP 414
           PPV  PP   PPVV P  P  P VTP  PPV        PV+ PP TPTP  P
Sbjct: 240 PPVVTPP--TPPVVTPPTPTPPVVTPPTPPVVTPPTPTPPVVTPP-TPTPPKP 289

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 53/126 (42%), Positives = 58/126 (46%), Gaps = 14/126 (11%)
 Frame = +1

Query: 76  FLCMLFLSSAAPILGCGTCG--KPVPKKHKPSKKPGKPVKPPGIVPPI----------VK 219
           FL +L L   A    C  C   KP P+ HKP K P KP KPP   PP            K
Sbjct: 10  FLILLLLGFLAVSFAC-ECSPPKPSPRPHKPPKHPVKPPKPPAAKPPKPPAVKPPKPPTK 68

Query: 220 PPGIVP-PIVKPPVILP-PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPS 393
           PP + P P  KPP + P P   PP    PI  PP +KP  PP     P  PP  V  PPS
Sbjct: 69  PPTLKPHPHPKPPTVRPHPHPKPPTKPHPIPKPPTIKP--PPSTPKPPTKPPT-VKPPPS 125

Query: 394 TPTPTT 411
           TP P T
Sbjct: 126 TPKPPT 131

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 48/105 (45%), Positives = 51/105 (48%), Gaps = 15/105 (14%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVP------PIVKPPGIVP--PIVKPPVILPPVTVPPVT 291
           KP P   KP  KP   VKPP   P      P VKPP   P  P  KPP + PP T  P T
Sbjct: 121 KPPPSTPKPPTKP-PTVKPPPSTPKPPTKPPTVKPPPSTPKPPTHKPPTVCPPPTPTP-T 178

Query: 292 VPPIT-------VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            P +T        PPVV P  P  P VTP  P  PV+ PP TPTP
Sbjct: 179 PPVVTPPTPPTPTPPVVTPPTPAPPVVTPPTPTPPVVTPP-TPTP 222

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 41/100 (41%), Positives = 46/100 (46%), Gaps = 7/100 (7%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVP-PIVKPPVILPPVTVP-PVTVPPITV 309
           KP P    P+ KP      P   PP VKPP   P P  KPP + PP + P P T PP   
Sbjct: 94  KPHPIPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVK 153

Query: 310 PPVVKPTLPPIPGVTPILPPV-----PVLNPPSTPTPTTP 414
           PP   P  P     T   PP      PV+ PP+ PTPT P
Sbjct: 154 PPPSTPKPPTHKPPTVCPPPTPTPTPPVVTPPTPPTPTPP 193

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/102 (39%), Positives = 47/102 (46%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P++   T   PV     P+     P  PP + PP   PP + PP   PPV+ PP   P
Sbjct: 201 APPVVTPPTPTPPVVTPPTPTPPVVTPPTPPVVTPPTPTPPVVTPPT--PPVVTPPTPTP 258

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           PV  PP   PPVV P  P  P VTP  P  P   P + P  T
Sbjct: 259 PVVTPP--TPPVVTPPTPTPPVVTPPTPTPP--KPETCPIDT 296

[30][TOP]
>UniRef100_B8HGT7 LPXTG-motif cell wall anchor domain protein n=1 Tax=Arthrobacter
           chlorophenolicus A6 RepID=B8HGT7_ARTCA
          Length = 485

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 38/79 (48%), Positives = 45/79 (56%), Gaps = 2/79 (2%)
 Frame = +1

Query: 184 VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPIL 363
           V PP + PP+V PP + PP+V PPV+ PPV  PPV  PP+  PPVV P            
Sbjct: 359 VNPPVVAPPVVTPPVVTPPVVNPPVVTPPVVTPPVVNPPVVTPPVVTP------------ 406

Query: 364 PPVPVLNPPSTPTP--TTP 414
              PV+NPPS  TP  TTP
Sbjct: 407 ---PVVNPPSVTTPAVTTP 422

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 27/55 (49%), Positives = 33/55 (60%)
 Frame = +1

Query: 184 VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPG 348
           V PP + PP+V PP + PP+V PPV+ PPV  PPV  PP+  PP V       PG
Sbjct: 369 VTPPVVTPPVVNPPVVTPPVVTPPVVNPPVVTPPVVTPPVVNPPSVTTPAVTTPG 423

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 25/48 (52%), Positives = 32/48 (66%), Gaps = 1/48 (2%)
 Frame = +1

Query: 184 VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPP-VTVPPITVPPVVK 324
           V PP + PP+V PP + PP+V PPV+ PPV  PP VT P +T P  V+
Sbjct: 379 VNPPVVTPPVVTPPVVNPPVVTPPVVTPPVVNPPSVTTPAVTTPGTVQ 426

[31][TOP]
>UniRef100_UPI0001982E0B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982E0B
          Length = 222

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 36/84 (42%), Positives = 37/84 (44%)
 Frame = +1

Query: 163 SKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI 342
           S  P     PP   PP   PP   PP   PP   PP T PP T PP T PP   P   P 
Sbjct: 54  SSPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPP 113

Query: 343 PGVTPILPPVPVLNPPSTPTPTTP 414
           P   P   P P   PP+TP P TP
Sbjct: 114 PATPPPATPPPATPPPATPPPATP 137

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/92 (41%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P      P+  P  PV  P   PP   PP   PP   PP   PP T PP T PP T PP 
Sbjct: 45  PTAVTSPPASSP-PPVSAP---PPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA 100

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P   P P   P   P P   PP+TP P TP
Sbjct: 101 TPPPATPPPATPPPATPPPATPPPATPPPATP 132

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 35/89 (39%), Positives = 36/89 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P      P   P     PP   PP   PP   PP   PP   PP T PP T PP T PP 
Sbjct: 51  PPASSPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA 110

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
             P   P P   P   P P   PP+TP P
Sbjct: 111 TPPPATPPPATPPPATPPPATPPPATPPP 139

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 42/116 (36%), Positives = 48/116 (41%), Gaps = 4/116 (3%)
 Frame = +1

Query: 79  LCMLF--LSSAAPILG-CGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKP-PGIVPPIV 246
           +C++F  +   AP  G   T   P P     S        P    PP+  P P   PP  
Sbjct: 12  VCIVFAGVGGQAPAGGPTATPAPPTPTTPAASPPTAVTSPPASSPPPVSAPPPATPPPAT 71

Query: 247 KPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   PP T PP T PP T PP   P   P P   P   P P   PP+TP P TP
Sbjct: 72  PPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATP 127

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/108 (32%), Positives = 37/108 (34%), Gaps = 18/108 (16%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P     PP   PP   PP   PP   PP   PP T PP T PP T PP   
Sbjct: 73  PPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATP 132

Query: 325 PTLPPIPG------------------VTPILPPVPVLNPPSTPTPTTP 414
           P   P P                    +P L P P+ N P  P    P
Sbjct: 133 PPATPPPAHLASPPAAVPAPAPSTKVKSPALAPSPLTNSPPAPPAEAP 180

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/97 (37%), Positives = 41/97 (42%), Gaps = 6/97 (6%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP-PVTVPPITVPP 315
           P P    P+  P  P  PP   PP   PP   PP   PP   PP   P P T PP T PP
Sbjct: 62  PPPATPPPATPP--PATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPP 119

Query: 316 VVKPTLPPIPGVTP--ILPPVPVLNPPS---TPTPTT 411
              P   P P   P    PP  + +PP+    P P+T
Sbjct: 120 ATPPPATPPPATPPPATPPPAHLASPPAAVPAPAPST 156

[32][TOP]
>UniRef100_A7QW77 Chromosome chr3 scaffold_199, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7QW77_VITVI
          Length = 290

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 36/84 (42%), Positives = 37/84 (44%)
 Frame = +1

Query: 163 SKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI 342
           S  P     PP   PP   PP   PP   PP   PP T PP T PP T PP   P   P 
Sbjct: 122 SSPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPP 181

Query: 343 PGVTPILPPVPVLNPPSTPTPTTP 414
           P   P   P P   PP+TP P TP
Sbjct: 182 PATPPPATPPPATPPPATPPPATP 205

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 44/146 (30%), Positives = 55/146 (37%), Gaps = 9/146 (6%)
 Frame = +1

Query: 4   ILHTLFLTKRETISMESSKIHAYLFLCMLFLSSAAPILGCGTCGKPVPKKHK-PSKKPGK 180
           I+H +     +  +M+   +     +C++F          G    P P     P+  P  
Sbjct: 55  IVHRIGCQCAQLNTMDCKSLLVLGLVCIVFAGVGGQAPAGGPTATPAPPTPTTPAASPPT 114

Query: 181 PVKPP--------GIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLP 336
            V  P           PP   PP   PP   PP   PP T PP T PP T PP   P   
Sbjct: 115 AVTSPPASSPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPAT 174

Query: 337 PIPGVTPILPPVPVLNPPSTPTPTTP 414
           P P   P   P P   PP+TP P TP
Sbjct: 175 PPPATPPPATPPPATPPPATPPPATP 200

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 35/89 (39%), Positives = 36/89 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P      P   P     PP   PP   PP   PP   PP   PP T PP T PP T PP 
Sbjct: 119 PPASSPPPVSAPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA 178

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
             P   P P   P   P P   PP+TP P
Sbjct: 179 TPPPATPPPATPPPATPPPATPPPATPPP 207

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/108 (32%), Positives = 37/108 (34%), Gaps = 18/108 (16%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P     PP   PP   PP   PP   PP   PP T PP T PP T PP   
Sbjct: 141 PPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATP 200

Query: 325 PTLPPIPG------------------VTPILPPVPVLNPPSTPTPTTP 414
           P   P P                    +P L P P+ N P  P    P
Sbjct: 201 PPATPPPAHLASPPAAVPAPAPSTKVKSPALAPSPLTNSPPAPPAEAP 248

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/97 (37%), Positives = 41/97 (42%), Gaps = 6/97 (6%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP-PVTVPPITVPP 315
           P P    P+  P  P  PP   PP   PP   PP   PP   PP   P P T PP T PP
Sbjct: 130 PPPATPPPATPP--PATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPP 187

Query: 316 VVKPTLPPIPGVTP--ILPPVPVLNPPS---TPTPTT 411
              P   P P   P    PP  + +PP+    P P+T
Sbjct: 188 ATPPPATPPPATPPPATPPPAHLASPPAAVPAPAPST 224

[33][TOP]
>UniRef100_Q9SXE7 T3P18.6 n=1 Tax=Arabidopsis thaliana RepID=Q9SXE7_ARATH
          Length = 297

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 42/93 (45%), Positives = 53/93 (56%), Gaps = 4/93 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIV--PPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           PV  +  P  +P   V PP IV  PPI +PP I+PPI  PPV  PP  +PP+T PP  +P
Sbjct: 96  PVVVRPPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPPITTPPGLLP 155

Query: 313 PVVKP--TLPPIPGVTPILPPVPVLNPPSTPTP 405
           PV  P   LPP+     +LP  P++NPP    P
Sbjct: 156 PVTTPPGLLPPVTTPPGLLP--PIINPPPVTVP 186

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/70 (48%), Positives = 42/70 (60%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           P  +P     PPG++PPI  PPG++PP+  PP +LPPVT PP  +PPI  PP V    PP
Sbjct: 130 PPIQPPPVTTPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPPGLLPPIINPPPV-TVPPP 188

Query: 340 IPGVTPILPP 369
             G  P  PP
Sbjct: 189 SSGYPPYGPP 198

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 57/169 (33%), Positives = 74/169 (43%), Gaps = 52/169 (30%)
 Frame = +1

Query: 55  SKIHAYLFLCMLFLSSAAP--ILGCGTCGKPVPKKHKP----------SKKP-------- 174
           S++ A  F+ ++F     P  I  C  C +P P   KP          SK P        
Sbjct: 3   SRVLASFFVFLIFTVITLPPTIQACTPCTRPHPPVPKPPQHGGGGGGGSKPPPHHGGKGG 62

Query: 175 -------GKPVKPP---------GIVPPIVKPPGIV---PPIVKPPVIL--------PPV 273
                  GK   PP         G  PP+V+PP +V   PPI++PP ++        PP+
Sbjct: 63  GKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPPVVVRPPPIIRPPPVVYPPPIVRPPPI 122

Query: 274 TVPPVTVPPITVPPVVKPT--LPPIPGVTPILPPV---PVLNPPSTPTP 405
           T PP+ +PPI  PPV  P   LPPI     +LPPV   P L PP T  P
Sbjct: 123 TRPPIIIPPIQPPPVTTPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPP 171

[34][TOP]
>UniRef100_Q41289 Putative proline-rich protein n=1 Tax=Solanum palustre
           RepID=Q41289_SOLBR
          Length = 407

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/117 (39%), Positives = 53/117 (45%), Gaps = 27/117 (23%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIV----------------------KPPGIVPPIVKPPV 258
           P   KP   P    KPP   PPIV                      KPP   PPIV PP+
Sbjct: 189 PSTPKPPTTPPFTPKPPSPTPPIVSPPIVYPPITPIPPIVHPPVTPKPPSPTPPIVSPPI 248

Query: 259 ILPPVT-VPPVTVPPIT-VPPVVKPTLPPIPGVT---PILPPVPVLNPPSTPTPTTP 414
           +  P+T  PP+  PPIT  PP+V P   P P V    P +P  PV+ PP  PTP TP
Sbjct: 249 VYAPITPTPPIVSPPITPTPPIVSPPFVPNPPVVIPPPYVPSPPVVTPPIVPTPPTP 305

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 41/106 (38%), Positives = 53/106 (50%), Gaps = 7/106 (6%)
 Frame = +1

Query: 109 PILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT-VPP 285
           PIL      +P      P   P    KPP   P   KPP   PPIV PP++ PP+T +PP
Sbjct: 167 PILKPPHVPRPPIVHPPPIVSPPSTPKPPTTPPFTPKPPSPTPPIVSPPIVYPPITPIPP 226

Query: 286 VTVPPIT------VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           +  PP+T       PP+V P +       PI P  P+++PP TPTP
Sbjct: 227 IVHPPVTPKPPSPTPPIVSPPIV----YAPITPTPPIVSPPITPTP 268

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 43/100 (43%), Positives = 53/100 (53%), Gaps = 10/100 (10%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIV-PPIVKP-PVILPPVTVPPVTVPPIT- 306
           KP      P +KP  P    G  PPI+KPP +  PPIV P P++ PP T  P T PP T 
Sbjct: 143 KPPSTPKHPPQKPCPPPSHHGPKPPILKPPHVPRPPIVHPPPIVSPPSTPKPPTTPPFTP 202

Query: 307 -----VPPVVKPTL--PPIPGVTPILPPVPVLNPPSTPTP 405
                 PP+V P +  PPI  + PI+ P PV   P +PTP
Sbjct: 203 KPPSPTPPIVSPPIVYPPITPIPPIVHP-PVTPKPPSPTP 241

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 52/132 (39%), Positives = 58/132 (43%), Gaps = 16/132 (12%)
 Frame = +1

Query: 67  AYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIV---- 234
           A + L +L L +      C  C  P P   K  K P K VKPP   PP VKPP       
Sbjct: 7   ARVLLLLLQLGTLFIAHACPYCPYP-PSTPKHPKLPXK-VKPPSTQPPHVKPPSTPKYPK 64

Query: 235 -PPIVK-------PPVILPPVT--VPPVTVPPITVPPVVK-PTLPPIPGVTP-ILPPVPV 378
            PP VK       PP + PP T   PP   PP T PP VK P+ P  P   P + PP   
Sbjct: 65  DPPHVKPPSTPKQPPYVRPPTTPKYPPHVKPPSTQPPHVKPPSTPKYPKDPPHVKPPSTP 124

Query: 379 LNPPSTPTPTTP 414
             PP    PTTP
Sbjct: 125 KQPPYVKPPTTP 136

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 47/125 (37%), Positives = 57/125 (45%), Gaps = 35/125 (28%)
 Frame = +1

Query: 145 PKKHKPSKKPGKP--VKPPGI--VPPIVKPP-----------------GIVPPIVKPP-- 255
           P   KP   P +P  VKPP     PP VKPP                 G  PPI+KPP  
Sbjct: 115 PPHVKPPSTPKQPPYVKPPTTPKYPPHVKPPSTPKHPPQKPCPPPSHHGPKPPILKPPHV 174

Query: 256 -----VILPPVTVPPVTVPPITVPPVV-KPTLPPIPGVTP--ILPPV----PVLNPPSTP 399
                V  PP+  PP T  P T PP   KP  P  P V+P  + PP+    P+++PP TP
Sbjct: 175 PRPPIVHPPPIVSPPSTPKPPTTPPFTPKPPSPTPPIVSPPIVYPPITPIPPIVHPPVTP 234

Query: 400 TPTTP 414
            P +P
Sbjct: 235 KPPSP 239

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 37/97 (38%), Positives = 44/97 (45%), Gaps = 10/97 (10%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVK--PPGIVPPIVKPPVILPPVTV-----PPVTVPPI 303
           PK     K P  P +PP + PP     PP + PP  +PP + PP T      PP   PP 
Sbjct: 63  PKDPPHVKPPSTPKQPPYVRPPTTPKYPPHVKPPSTQPPHVKPPSTPKYPKDPPHVKPPS 122

Query: 304 T--VPPVVKPTLPPIPGVTP-ILPPVPVLNPPSTPTP 405
           T   PP VKP  P  P   P + PP    +PP  P P
Sbjct: 123 TPKQPPYVKP--PTTPKYPPHVKPPSTPKHPPQKPCP 157

[35][TOP]
>UniRef100_A9VE05 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9VE05_MONBE
          Length = 1536

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 41/108 (37%), Positives = 51/108 (47%), Gaps = 4/108 (3%)
 Frame = +1

Query: 94   LSSAAPILGCGTCGKPVPKKHKPSKKPG----KPVKPPGIVPPIVKPPGIVPPIVKPPVI 261
            + + AP        KP P    P+ KP        KPP + PP  KPP + PP  KPPV+
Sbjct: 1230 VDAEAPTADSSAAAKP-PVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVV 1288

Query: 262  LPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
             PP   PP+  PP   PPVV+P     P V P     PV+ PP+   P
Sbjct: 1289 EPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPP 1336

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/87 (42%), Positives = 43/87 (49%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P   KP        KPP + PP  KPP + PP  KPPV+ PP   PPV  PP   PPVV+
Sbjct: 1270 PPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVE 1329

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTP 405
            P     P V P     PV+ PP+   P
Sbjct: 1330 PPAAKPPLVEPPAAKPPVVEPPAAKPP 1356

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 36/87 (41%), Positives = 43/87 (49%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P   KP        KPP + PP  KPP + PP  KPPV+ PP   PPV  PP   PP+V+
Sbjct: 1280 PPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVE 1339

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTP 405
            P     P V P     PV+ PP+   P
Sbjct: 1340 PPAAKPPVVEPPAAKPPVVEPPAAKPP 1366

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/108 (38%), Positives = 52/108 (48%), Gaps = 5/108 (4%)
 Frame = +1

Query: 97   SSAA---PILGCGTCGKPV--PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI 261
            SSAA   P++       PV  P   KP        KPP + PP  KPP + PP  KPP++
Sbjct: 1239 SSAAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLV 1298

Query: 262  LPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
             PP   PPV  PP   PPVV+P     P V P     P++ PP+   P
Sbjct: 1299 EPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPP 1346

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 35/84 (41%), Positives = 42/84 (50%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P   KP        KPP + PP  KPP + PP  KPPV+ PP   PP+  PP   PPVV+
Sbjct: 1290 PPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVE 1349

Query: 325  PTLPPIPGVTPILPPVPVLNPPST 396
            P     P V P     PV+ P +T
Sbjct: 1350 PPAAKPPVVEPPAAKPPVVEPTAT 1373

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 33/89 (37%), Positives = 41/89 (46%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P  +  KP  +P     P        KPP + PP  KPPV+ PP   PPV  PP   PPV
Sbjct: 1218 PASEVAKPKTEPVDAEAPTADSSAAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPV 1277

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            V+P     P V P     P++ PP+   P
Sbjct: 1278 VEPPAAKPPVVEPPAAKPPLVEPPAAKPP 1306

[36][TOP]
>UniRef100_B3MPJ3 GF14619 n=1 Tax=Drosophila ananassae RepID=B3MPJ3_DROAN
          Length = 2240

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 41/100 (41%), Positives = 50/100 (50%), Gaps = 4/100 (4%)
 Frame = +1

Query: 127  TCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
            T    +P +  P +    P  PP  +PP   PP  +PP    PV LPP T+PP T PP T
Sbjct: 946  TATPTLPPQTLPPQTLPPPTLPPLTLPPQTLPPQTLPPDTPLPVTLPPATLPPATQPPAT 1005

Query: 307  VPPVVKPTLPPIPGVT----PILPPVPVLNPPSTPTPTTP 414
            VPP   PT+PP P  T     + PP+ V   P  P PT P
Sbjct: 1006 VPP---PTIPPTPPSTQSAQTLPPPIHVYTTPDVPAPTAP 1042

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 38/97 (39%), Positives = 47/97 (48%), Gaps = 19/97 (19%)
 Frame = +1

Query: 181  PVKPPGIVPPIVKPPGIVPPIVK-------------PPVILPPVTVPPVTVPPITVPPVV 321
            PV  P +    + P  +VPP V              PP  LPP T+PP T+PP+T+PP  
Sbjct: 916  PVVVPVVTAAPIPPATVVPPQVTEAPTAAPTATPTLPPQTLPPQTLPPPTLPPLTLPPQT 975

Query: 322  KP--TLPPIPGVTPILPPV---PVLNPPST-PTPTTP 414
             P  TLPP   +   LPP    P   PP+T P PT P
Sbjct: 976  LPPQTLPPDTPLPVTLPPATLPPATQPPATVPPPTIP 1012

[37][TOP]
>UniRef100_Q9SC42 Proline-rich protein n=1 Tax=Pisum sativum RepID=Q9SC42_PEA
          Length = 214

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 46/119 (38%), Positives = 55/119 (46%), Gaps = 8/119 (6%)
 Frame = +1

Query: 76  FLCMLFLSSAAPILGCGTCGKP--------VPKKHKPSKKPGKPVKPPGIVPPIVKPPGI 231
           FL +L L+   P  G     KP         P  +KP  +     KPP   PP+ KPP  
Sbjct: 6   FLLLLLLALIIP-QGFANYEKPPVYRPPVETPPIYKPPVEKPPVYKPPVYKPPVEKPPVY 64

Query: 232 VPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            PP+ KPPV  PPV  PPV  PP+  PPV KP +   P   P +   PV  PP    PT
Sbjct: 65  KPPVEKPPVYKPPVKKPPVYKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPT 123

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 41/89 (46%), Positives = 46/89 (51%), Gaps = 1/89 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P K  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PP   PP+  PPV 
Sbjct: 77  PVKKPPVYKP--PVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPPVY 134

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           KP +   P   P +   PV  PP    PT
Sbjct: 135 KPPVEKPPTYKPPVEKPPVYKPPVEKPPT 163

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 40/89 (44%), Positives = 46/89 (51%), Gaps = 1/89 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PP   PP+  PPV 
Sbjct: 57  PVEKPPVYKP--PVEKPPVYKPPVKKPPVYKPPVEKPPVYKPPVEKPPTYKPPVEKPPVY 114

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           KP +   P   P +   PV  PP    PT
Sbjct: 115 KPPVEKPPTYKPPVERPPVYKPPVEKPPT 143

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 37/88 (42%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P+ KP  PV KPP   PP+ KPP   PP+ +PPV  PPV  PP   PP+  PPV 
Sbjct: 97  PVEKPPTYKP--PVEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPPTYKPPVEKPPVY 154

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   P   PP    P
Sbjct: 155 KPPVEKPPTYKPPVEKPPAYKPPVEKPP 182

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/83 (43%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ +PP   PP+ KPP   PPV  PPV  PP+  PP  
Sbjct: 107 PVEKPPVYKP--PVEKPPTYKPPVERPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTY 164

Query: 322 KPTLPPIPGVTPILPPVPVLNPP 390
           KP +   P   P +   PV  PP
Sbjct: 165 KPPVEKPPAYKPPVEKPPVYKPP 187

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 37/88 (42%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPP   PPV  PPV  PP+  PP  
Sbjct: 87  PVEKPPVYKP--PVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPPTY 144

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   P   PP    P
Sbjct: 145 KPPVEKPPVYKPPVEKPPTYKPPVEKPP 172

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 27/58 (46%), Positives = 31/58 (53%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P  +KP  +     KPP   PP+ KPP   PP  KPPV  PP   PPV  PP+  PPV
Sbjct: 131 PPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVEKPPAYKPPVEKPPVYKPPV 188

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 28/56 (50%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P +  P+ KP  PV KPP   PP+ KPP   PP+ KPP   PPV  PPV  PP+ V
Sbjct: 137 PVEKPPTYKP--PVEKPPVYKPPVEKPPTYKPPVEKPPAYKPPVEKPPVYKPPVGV 190

[38][TOP]
>UniRef100_B9RUF0 Extensin, proline-rich protein, putative n=1 Tax=Ricinus communis
           RepID=B9RUF0_RICCO
          Length = 234

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 45/93 (48%), Positives = 50/93 (53%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPP-GIVPPIVKPPGIVPPIVKPP---VILPPVTVPPVTVPP-IT 306
           P  +KP   P  PV KPP    PP+VKPP   PP+ KPP   VI PP    PV  PP + 
Sbjct: 57  PPVYKPPATPTTPVVKPPTSPAPPVVKPPTPSPPVYKPPTTPVIKPPNAPSPVVKPPTVP 116

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            PPVVKP     P   P  P  PV+ PPSTP P
Sbjct: 117 APPVVKPPTYSPPVAKPPTPAPPVVKPPSTPAP 149

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 42/103 (40%), Positives = 51/103 (49%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT 276
           S A P++   T   P P  +KP   P   +KPP    P+VKPP     +  PPV+ PP  
Sbjct: 76  SPAPPVVKPPT---PSPPVYKPPTTP--VIKPPNAPSPVVKPP----TVPAPPVVKPPTY 126

Query: 277 VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            PPV  PP   PPVVKP   P P +    PP P+  P  TP P
Sbjct: 127 SPPVAKPPTPAPPVVKPPSTPAPPM--FKPPTPLPPPSGTPLP 167

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 41/99 (41%), Positives = 49/99 (49%), Gaps = 14/99 (14%)
 Frame = +1

Query: 160 PSKKPGKPV-KPPGIVPPIVKPPGI-VPPIVKPPVI-LPPVTVPPVTVPPITVPP---VV 321
           P+  P  PV KP    PP+ KPP     P+VKPP    PPV  PP   PP+  PP   V+
Sbjct: 41  PTPVPAPPVVKPTPTTPPVYKPPATPTTPVVKPPTSPAPPVVKPPTPSPPVYKPPTTPVI 100

Query: 322 KPTLPPIPGVTP-ILPPVPVLNPPS-------TPTPTTP 414
           KP   P P V P  +P  PV+ PP+        PTP  P
Sbjct: 101 KPPNAPSPVVKPPTVPAPPVVKPPTYSPPVAKPPTPAPP 139

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 30/72 (41%), Positives = 34/72 (47%), Gaps = 7/72 (9%)
 Frame = +1

Query: 211 IVKPPGIVPPIVKPPVILPPVTVPPVT-------VPPITVPPVVKPTLPPIPGVTPILPP 369
           I   P   PP+VKP    PPV  PP T        P    PPVVKP  P  P   P  P 
Sbjct: 39  IAPTPVPAPPVVKPTPTTPPVYKPPATPTTPVVKPPTSPAPPVVKPPTPSPPVYKP--PT 96

Query: 370 VPVLNPPSTPTP 405
            PV+ PP+ P+P
Sbjct: 97  TPVIKPPNAPSP 108

[39][TOP]
>UniRef100_B9PLD5 Putative uncharacterized protein n=1 Tax=Toxoplasma gondii GT1
           RepID=B9PLD5_TOXGO
          Length = 1112

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 43/111 (38%), Positives = 49/111 (44%), Gaps = 5/111 (4%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPV--PKKHKPSKKPGKP-VKPPGIVPPIVKPPGIVPPIVKPPVILP 267
           SSA+ + G      P   P    P+  P  P V PP   PP   PP + PP   PP   P
Sbjct: 248 SSASSLQGVSPVQLPPSPPAPSPPAPSPSPPSVSPPAPSPPAPSPPSVSPPAPSPPAPSP 307

Query: 268 PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPP--STPTPTTP 414
           P   PP   PP   PP V P  P  P V P  PP P + PP  S P P+ P
Sbjct: 308 PAPSPPSVAPPAPSPPSVSPPAPSPPSVAPPAPPAPSVAPPSLSPPAPSPP 358

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/95 (40%), Positives = 42/95 (44%), Gaps = 6/95 (6%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPV----KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
           P P    PS  P  P      PP + PP   PP   PP   PP + PP   PP   PP  
Sbjct: 271 PAPSPSPPSVSPPAPSPPAPSPPSVSPPAPSPPAPSPPAPSPPSVAPPAPSPPSVSPPAP 330

Query: 307 VPPVVKPTLPPIPGVTP--ILPPVPVLNPPSTPTP 405
            PP V P  PP P V P  + PP P  +PPS   P
Sbjct: 331 SPPSVAPPAPPAPSVAPPSLSPPAP--SPPSVSPP 363

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 32/82 (39%), Positives = 35/82 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+  P  P  PP   PP V PP   PP V PP   PP   PP    P   PP + 
Sbjct: 293 PSVSPPAPSPPAP-SPPAPSPPSVAPPAPSPPSVSPPAPSPPSVAPPAPPAPSVAPPSLS 351

Query: 325 PTLPPIPGVTPILPPVPVLNPP 390
           P  P  P V+   PP P   PP
Sbjct: 352 PPAPSPPSVS---PPAPSAAPP 370

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 29/78 (37%), Positives = 33/78 (42%), Gaps = 2/78 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+  P  P  PP + PP   PP + PP   PP + PP    P   PP   PP   
Sbjct: 298 PAPSPPAPSPPAP-SPPSVAPPAPSPPSVSPPAPSPPSVAPPAPPAPSVAPPSLSPPAPS 356

Query: 325 P--TLPPIPGVTPILPPV 372
           P    PP P   P  PPV
Sbjct: 357 PPSVSPPAPSAAP--PPV 372

[40][TOP]
>UniRef100_Q40358 Repetitive proline-rich cell wall protein n=1 Tax=Medicago sativa
           RepID=PRP_MEDSA
          Length = 236

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 41/92 (44%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+VKPPV  PPV  PPV  PP+  PPV K
Sbjct: 42  PPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYK 101

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+     + PPV   PV  PP    P
Sbjct: 102 PPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPP 133

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 38/87 (43%), Positives = 46/87 (52%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP + PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPVVK
Sbjct: 57  PPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVK 116

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 117 PPVYKPPVYKPPVEKPPVYKPPVYKPP 143

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/92 (43%), Positives = 48/92 (52%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP + PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 87  PPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEK 146

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 147 PPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPP 178

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/90 (44%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP + PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 147 PPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYK 206

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTP 399
           P +  PP+       PPV   PV  PP  P
Sbjct: 207 PPVEKPPVYKPPVYKPPVEKPPVYGPPHHP 236

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 41/92 (44%), Positives = 48/92 (52%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP       VKPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 102 PPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 161

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+     + PPV   PV  PP    P
Sbjct: 162 PPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPP 193

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 38/87 (43%), Positives = 44/87 (50%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+VKPPV  PPV  PPV  PP+  PPV K
Sbjct: 82  PPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYK 141

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 142 PPVEKPPVYKPPVEKPPVYKPPVYKPP 168

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 43/113 (38%), Positives = 52/113 (46%), Gaps = 3/113 (2%)
 Frame = +1

Query: 76  FLCMLFLSSAAPILGCGTCGKPV---PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV 246
           FL +L  +      G     KP    P  +KP  +     KPP   PP+ KPP   PP+ 
Sbjct: 6   FLVLLLFALFVIPQGLANYDKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVE 65

Query: 247 KPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KPPV  PPV  PPV  PP+  PPV KP +   P   P +   PV  PP    P
Sbjct: 66  KPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPP 118

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 45/96 (46%), Positives = 51/96 (53%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+VKPPV  PPV  PPV  PP+  PPV 
Sbjct: 143 PVEKPPVYKP--PVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVY 200

Query: 322 KPTL--PPIPGVTPILPPV---PVLNPPSTPTPTTP 414
           KP +  PP+       PPV   PV  PP    P  P
Sbjct: 201 KPPVYKPPVEKPPVYKPPVYKPPVEKPPVYGPPHHP 236

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 37/87 (42%), Positives = 45/87 (51%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV+ PPV  PPV  PP+  PPV K
Sbjct: 137 PPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEK 196

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 197 PPVYKPPVYKPPVEKPPVYKPPVYKPP 223

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 41/92 (44%), Positives = 46/92 (50%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   KP       VKPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 62  PPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYK 121

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 122 PPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPP 153

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 37/87 (42%), Positives = 45/87 (51%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP + PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 97  PPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEK 156

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV+ PP    P
Sbjct: 157 PPVYKPPVYKPPVYKPPVVKPPVYKPP 183

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 37/87 (42%), Positives = 44/87 (50%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 122 PPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYK 181

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 182 PPVYKPPVYKPPVEKPPVYKPPVYKPP 208

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 40/88 (45%), Positives = 48/88 (54%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV+ PPV  PPV  PP+  PPV 
Sbjct: 38  PVEKPPVYKP--PVEKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPPVE 95

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV+ PP    P
Sbjct: 96  KPPVYKPPVYKPPVYKPPVVKPPVYKPP 123

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 40/88 (45%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P    P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 73  PVVKPPVYKP--PVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVE 130

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 131 KPPVYKPPVYKPPVEKPPVYKPPVEKPP 158

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 43/93 (46%), Positives = 49/93 (52%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 128 PVEKPPVYKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVY 185

Query: 322 KPTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           KP +  PP+       PPV   PV  PP    P
Sbjct: 186 KPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPP 218

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 40/88 (45%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P    P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 113 PVVKPPVYKP--PVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVY 170

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 171 KPPVVKPPVYKPPVYKPPVYKPPVEKPP 198

[41][TOP]
>UniRef100_Q43564 Repetitive proline-rich cell wall protein 1 n=1 Tax=Medicago
           truncatula RepID=PRP1_MEDTR
          Length = 206

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 38/87 (43%), Positives = 46/87 (52%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP + PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 52  PPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYK 111

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P V P +   PV  PP    P
Sbjct: 112 PPVYKPPVVKPPVYKPPVYKPPVEKPP 138

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 38/87 (43%), Positives = 45/87 (51%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP + PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPVVK
Sbjct: 62  PPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVK 121

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 122 PPVYKPPVYKPPVEKPPVYKPPVVKPP 148

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 42/92 (45%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+VKPPV  PPV  PPV  PP+  PPVVK
Sbjct: 87  PPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVK 146

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+     + PPV   PV  PP    P
Sbjct: 147 PPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPP 178

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 38/85 (44%), Positives = 45/85 (52%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+VKPP   PP+ KPPV+ PPV  PPV  PP+  PPV K
Sbjct: 122 PPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEK 181

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTP 399
           P +   P   P +   PV  PP  P
Sbjct: 182 PPVYKPPVYKPPVEKPPVYGPPHHP 206

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 38/87 (43%), Positives = 45/87 (51%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP       VKPP   PP+ KPP   PP+ KPPV+ PPV  PPV  PP+  PPV K
Sbjct: 107 PPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYK 166

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 167 PPVYKPPVYKPPVEKPPVYKPPVYKPP 193

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 38/87 (43%), Positives = 45/87 (51%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+VKPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 97  PPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYK 156

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 157 PPVVKPPVYKPPVYKPPVYKPPVEKPP 183

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 37/87 (42%), Positives = 46/87 (52%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV+ PPV  PPV  PP+  PPV K
Sbjct: 42  PPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYK 101

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV+ PP    P
Sbjct: 102 PPVEKPPVYKPPVYKPPVVKPPVYKPP 128

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 42/95 (44%), Positives = 48/95 (50%), Gaps = 5/95 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+VKPPV  PPV  PPV  PP+  PPV K
Sbjct: 112 PPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYK 171

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTPTTP 414
           P +  PP+       PPV   PV  PP    P  P
Sbjct: 172 PPVYKPPVEKPPVYKPPVYKPPVEKPPVYGPPHHP 206

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 44/113 (38%), Positives = 53/113 (46%), Gaps = 3/113 (2%)
 Frame = +1

Query: 76  FLCMLFLSSAAPILGCGTCGKPV---PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV 246
           FL +L  +  A   G     KP    P  +KP  +     KPP   PP+ KPP   PP+ 
Sbjct: 6   FLVLLLFALFAIPQGLANYEKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 65

Query: 247 KPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KPPV  PPV  PPV  PP+  PPV KP +   P   P +   PV  PP    P
Sbjct: 66  KPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 118

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 41/92 (44%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP       VKPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 67  PPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYK 126

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 127 PPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPP 158

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 37/87 (42%), Positives = 45/87 (51%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+ KPPV+ PPV  PPV  PP+  PPV K
Sbjct: 82  PPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYK 141

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV+ PP    P
Sbjct: 142 PPVVKPPVYKPPVYKPPVVKPPVYKPP 168

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/88 (46%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P    P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 78  PVVKPPVYKP--PVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVE 135

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P V P +   PV  PP    P
Sbjct: 136 KPPVYKPPVVKPPVYKPPVYKPPVVKPP 163

[42][TOP]
>UniRef100_UPI0000E49E3C PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000E49E3C
          Length = 1082

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 36/89 (40%), Positives = 43/89 (48%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  H P+ +P    +PP   PP  +PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 554 PMTHPPTAQP-PTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTR 612

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P    +P   PPST  PTT
Sbjct: 613 PPTTQPPTTQPPTTQLPTTQPPSTQPPTT 641

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/89 (40%), Positives = 41/89 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P    +PP   PP  KPP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 339 PTSQPPSTQP-PTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQ 397

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 398 PPTTQPPTTQPRTTQTPTTQPPTTQPPTT 426

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/89 (40%), Positives = 43/89 (48%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  H P+ +P    +PP   PP  +PP + PP  +PP   PP T PP T PP T PP  +
Sbjct: 489 PTTHPPTPQP-PTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQ 547

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PPST  PTT
Sbjct: 548 PPTTQPPMTHPPTAQPPTTQPPSTKPPTT 576

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 35/90 (38%), Positives = 42/90 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PPI +PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 689 PTTQPPTTQP-PTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQ 747

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P     P   P     P   PP+   PTTP
Sbjct: 748 PPSTKPPTTQPPTTQPPTTQPPTAQPPTTP 777

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 35/89 (39%), Positives = 43/89 (48%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PP  +PP   PP T PP T PP T PP+ K
Sbjct: 209 PSTQPPTTQPPS-TQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITK 267

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P    +P   P     P   PP+T  PTT
Sbjct: 268 PPTSHLPTTQPPSTLPPTTQPPTTQPPTT 296

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 35/89 (39%), Positives = 43/89 (48%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P   ++PP   PP  +PP   PP  +PP   PP T PP T PP+T PP  +
Sbjct: 504 PATQPPSTEP-PTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQ 562

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 563 PPTTQPPSTKPPTTQPPTTQPPTTQPPTT 591

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 36/89 (40%), Positives = 42/89 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP    +PP   PP  +PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 564 PTTQPPSTKP-PTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQ 622

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P    +P   P     P   PP+T  PTT
Sbjct: 623 PPTTQLPTTQPPSTQPPTTQPPTTRQPTT 651

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 35/89 (39%), Positives = 41/89 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    KPP   PP  +PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 349 PTTQPPTTQP-PTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQ 407

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 408 PRTTQTPTTQPPTTQPPTTQPPTTQPPTT 436

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 35/89 (39%), Positives = 42/89 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PP  +PP   PP+T PP T PP T PP  +
Sbjct: 669 PTTQPPTTQP-PTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQ 727

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PPST  PTT
Sbjct: 728 PPTTQPPTTQPPTTQPPTTQPPSTKPPTT 756

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 36/89 (40%), Positives = 42/89 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P    +PP   PP  +PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 199 PTTQPPSTQPPS-TQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQ 257

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P    +P   PPST  PTT
Sbjct: 258 PPTTRPPITKPPTSHLPTTQPPSTLPPTT 286

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 35/89 (39%), Positives = 42/89 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PP  +PP   PP T PP T PPIT PP  +
Sbjct: 659 PTTQPPTTQP-PTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQ 717

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 718 PPTTQPPTTQPPTTQPPTTQPPTTQPPTT 746

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 34/89 (38%), Positives = 42/89 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PP  +PP   PP T PP T PP T PP+ +
Sbjct: 654 PTTQPPTTQP-PTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQ 712

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 713 PPSTQPPTTQPPTTQPPTTQPPTTQPPTT 741

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 35/89 (39%), Positives = 42/89 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PPI +PP   PP T PP T PP T PP  +
Sbjct: 679 PTTQPPTTQP-PTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQ 737

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 738 PPTTQPPTTQPPSTKPPTTQPPTTQPPTT 766

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 36/89 (40%), Positives = 40/89 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P    +PP   PP  +PP I PP   PP   PP   PP T PP T PP  +
Sbjct: 454 PTTQPPSTQP-PTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTE 512

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PPST  PTT
Sbjct: 513 PPTMQPPTTQPPTTQPPTTQPPSTQPPTT 541

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 34/91 (37%), Positives = 41/91 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P   +P        +PP + PP  +PP   PP  +PP   PP T PP T PP T PP+
Sbjct: 496 PQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPM 555

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
             P     P   P     P   PP+T  PTT
Sbjct: 556 THPPTAQPPTTQPPSTKPPTTQPPTTQPPTT 586

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 36/94 (38%), Positives = 42/94 (44%), Gaps = 4/94 (4%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           +P    PS +P     P    P   PP  +PP   PP  +PP   PP T PP T PP T 
Sbjct: 628 LPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQ 687

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           PP  +P     P   P     P+  PPST  PTT
Sbjct: 688 PPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTT 721

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 36/98 (36%), Positives = 41/98 (41%), Gaps = 9/98 (9%)
 Frame = +1

Query: 145 PKKHKPSKKPGKP---------VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP 297
           P    PS KP             +PP   PP  +PP   PP  +PP   PP T PP T P
Sbjct: 309 PTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQP 368

Query: 298 PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P T PP  +P     P   P     P   PP+T  PTT
Sbjct: 369 PTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTT 406

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 34/89 (38%), Positives = 42/89 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP ++PP   PP   PP   PP T PP T PP T PP ++
Sbjct: 459 PSTQPPTTQPPS-TQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQ 517

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 518 PPTTQPPTTQPPTTQPPSTQPPTTQPPTT 546

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 34/89 (38%), Positives = 41/89 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP+  PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 534 PSTQPPTTQP-PTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQ 592

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 593 PPTTQPPSTQPPTTQPPYTRPPTTQPPTT 621

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 34/89 (38%), Positives = 41/89 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PP  +PP+  PP   PP T PP T PP  +
Sbjct: 519 PTTQPPTTQP-PTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQ 577

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PPST  PTT
Sbjct: 578 PPTTQPPTTQPPTTQPPTTQPPSTQPPTT 606

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 35/89 (39%), Positives = 41/89 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PP  KPP   PP T PP T PP T PP  +
Sbjct: 539 PTTQPPTTQP-PTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQ 597

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 598 PPSTQPPTTQPPYTRPPTTQPPTTQPPTT 626

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 34/89 (38%), Positives = 42/89 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PP  +PP+  PP T PP T PP T PP  +
Sbjct: 674 PTTQPPTTQP-PTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQ 732

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 733 PPTTQPPTTQPPTTQPPSTKPPTTQPPTT 761

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 39/99 (39%), Positives = 45/99 (45%), Gaps = 10/99 (10%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ KP    +PP   PP  +PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 119 PTTQPPTTKP-PTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQ 177

Query: 325 P-------TLPP---IPGVTPILPPVPVLNPPSTPTPTT 411
           P       T PP   +P   P     P   PPST  PTT
Sbjct: 178 PPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTT 216

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 40/99 (40%), Positives = 48/99 (48%), Gaps = 10/99 (10%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP---- 312
           P    PS +P    +PP   PP  +PP   PP  +PP   PP T PP T PPIT P    
Sbjct: 214 PTTQPPSTQP-PTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSH 272

Query: 313 -PVVKP--TLPPIPGVTPILPPV---PVLNPPSTPTPTT 411
            P  +P  TLPP        PP    P+ +PP+T  PTT
Sbjct: 273 LPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTT 311

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 33/89 (37%), Positives = 40/89 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P        +PP   PP  +PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 638 PPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQ 697

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P +   P   PP+T  PTT
Sbjct: 698 PPTTQPPTTQPPITQPPSTQPPTTQPPTT 726

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 34/87 (39%), Positives = 40/87 (45%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PP  +PP   PP T PP T PP T PP  K
Sbjct: 694 PTTQPPTTQP-PTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTK 752

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P     P   P     P   PP+TP P
Sbjct: 753 PPTTQPPTTQPPTTQPPTAQPPTTPVP 779

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 33/89 (37%), Positives = 41/89 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PP  +PP   PP T PP+T PP   PP  +
Sbjct: 509 PSTEPPTMQP-PTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQ 567

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 568 PPSTKPPTTQPPTTQPPTTQPPTTQPPTT 596

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 33/89 (37%), Positives = 39/89 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P        +PP   PP  +PP   PP  +PP   PP T  P T PP T PP  +
Sbjct: 403 PPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQ 462

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P + PPST  PTT
Sbjct: 463 PPTTQPPSTQPPTTQPPTIQPPSTSPPTT 491

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 34/89 (38%), Positives = 40/89 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P     PP   PP  +PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 544 PTTQPPTTQPPM-THPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQ 602

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 603 PPTTQPPYTRPPTTQPPTTQPPTTQLPTT 631

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 34/89 (38%), Positives = 39/89 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P        +PP   PP  +PP   PP  KPP   PP T PP T PP T PP  +
Sbjct: 328 PATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQ 387

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   P +T TPTT
Sbjct: 388 PPTTQPPTTQPPTTQPPTTQPRTTQTPTT 416

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 35/89 (39%), Positives = 40/89 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P    +PP I PP   PP   PP  +PP   PP T PP T PP   PP  +
Sbjct: 464 PTTQPPSTQP-PTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQ 522

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 523 PPTTQPPTTQPPSTQPPTTQPPTTQPPTT 551

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 34/89 (38%), Positives = 41/89 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P     PP   PP  +PP   PP  +PP + PP T PP T PP T PP  +
Sbjct: 479 PTIQPPSTSP-PTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQ 537

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P+ +PP+   PTT
Sbjct: 538 PPTTQPPTTQPPTTQPPMTHPPTAQPPTT 566

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 33/89 (37%), Positives = 42/89 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  + P   PP  +PP   PP T PP T PP T PP ++
Sbjct: 424 PTTQPPTTQP-PTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQ 482

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P  P  P   PP+T  P+T
Sbjct: 483 PPSTSPPTTHPPTPQPPTTQPPATQPPST 511

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 35/89 (39%), Positives = 39/89 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    KPP   PP   PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 114 PTTQPPTTQP-PTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQ 172

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P    PST  PTT
Sbjct: 173 PPTTQPPTTQPHTTQPPTTQLPSTQPPTT 201

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/104 (36%), Positives = 42/104 (40%), Gaps = 15/104 (14%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   KP         PP   PP  +PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 123 PPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQ 182

Query: 325 P--TLPPIPGVTPILPPV-------------PVLNPPSTPTPTT 411
           P  T PP   +    PP              P   PPST  PTT
Sbjct: 183 PHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTT 226

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 34/94 (36%), Positives = 44/94 (46%), Gaps = 5/94 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPV-----TVPPITV 309
           P    PS +P    +PP   PP  +PP   PP  +PP   PP+T PP      T PP T+
Sbjct: 224 PTTQPPSTQP-PTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTL 282

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           PP  +P     P   P +   P   PP+T  P+T
Sbjct: 283 PPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPST 316

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 35/89 (39%), Positives = 41/89 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PPI KPP    P T PP T+PP T PP  +
Sbjct: 234 PTTQPPTTQP-PTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQ 292

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PPST   TT
Sbjct: 293 PPTTQPPMTHPPTTQPPTTQPPSTKPSTT 321

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 36/90 (40%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  H P+       +PP  +PP  +PP   PP  +PP+  PP T PP T PP T P   +
Sbjct: 269 PTSHLPT------TQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQ 322

Query: 325 P-TLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P T  P     P   P P   PPST  PTT
Sbjct: 323 PLTTQPATTQPPTTQP-PTSQPPSTQPPTT 351

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 35/94 (37%), Positives = 40/94 (42%), Gaps = 5/94 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP-----PITV 309
           P   KP        +PP   PP  +PP   PP  +PP   PP T PP T P     P T 
Sbjct: 358 PPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQ 417

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           PP  +P     P   P     P   PP+T TPTT
Sbjct: 418 PPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTT 451

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 32/89 (35%), Positives = 39/89 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P   ++PP   PP   PP   PP  +PP   PP T PP   PP T PP  +
Sbjct: 469 PSTQPPTTQP-PTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQ 527

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  P T
Sbjct: 528 PPTTQPPSTQPPTTQPPTTQPPTTQPPMT 556

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 33/89 (37%), Positives = 40/89 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PP  +PP   PP T PP T PP T  P  +
Sbjct: 574 PTTQPPTTQP-PTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQ 632

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 633 PPSTQPPTTQPPTTRQPTTQPPTTQPPTT 661

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 32/89 (35%), Positives = 38/89 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P        +PP   PP  +PP    P  +PP   PP T PP T PP T PP  +
Sbjct: 618 PPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQ 677

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 678 PPTTQPPTTQPPTTQPPTTQPPTTQPPTT 706

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 35/94 (37%), Positives = 43/94 (45%), Gaps = 5/94 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P        +PP   PP  +PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 183 PHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQ 242

Query: 325 P--TLPPIPGVTPILPPV---PVLNPPSTPTPTT 411
           P  T PP        PP    P+  PP++  PTT
Sbjct: 243 PPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTT 276

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 33/89 (37%), Positives = 40/89 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PP  +PP   PP T  P T PP T PP  +
Sbjct: 584 PTTQPPTTQP-PTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQ 642

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 643 PPTTRQPTTQPPTTQPPTTQPPTTQPPTT 671

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 30/75 (40%), Positives = 36/75 (48%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           +PP   PP  +PP   PP  +PP   PP   PP T PP T PP  +P     P   P   
Sbjct: 452 QPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPST 511

Query: 367 PVPVLNPPSTPTPTT 411
             P + PP+T  PTT
Sbjct: 512 EPPTMQPPTTQPPTT 526

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 32/81 (39%), Positives = 38/81 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P  +P    +PP   PP  +PP   PP  +PP   PP T PP T PP T PP  +
Sbjct: 704 PTTQPPITQPPS-TQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQ 762

Query: 325 PTLPPIPGVTPILPPVPVLNP 387
           P     P   P   PVP L+P
Sbjct: 763 PPTTQPPTAQPPTTPVPCLHP 783

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 31/75 (41%), Positives = 36/75 (48%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           +PP   PP  +PP   PP  +PP   PP T PP T PP T PP  +P     P   P   
Sbjct: 112 QPPTTQPPTTQPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQP--- 168

Query: 367 PVPVLNPPSTPTPTT 411
             P   PP+T  PTT
Sbjct: 169 --PTTQPPTTQPPTT 181

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 33/94 (35%), Positives = 41/94 (43%), Gaps = 5/94 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP-----PVTVPPVTVPPITV 309
           P    P+ +P    +PP   PP  +PP   PP  +PP   P     P T PP T PP T 
Sbjct: 369 PTTQPPTTRP-PTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQ 427

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           PP  +P     P   P     P   PP+T  P+T
Sbjct: 428 PPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPST 461

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/90 (41%), Positives = 42/90 (46%), Gaps = 1/90 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P    +PP   PP  +PP   P   + P   PP T PP T PP T PP  +
Sbjct: 379 PTTQPPSTQP-PTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQ 437

Query: 325 -PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
            PT  P    TP   P P   PPST  PTT
Sbjct: 438 PPTAWPPTTQTPTTQP-PTTQPPSTQPPTT 466

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 33/93 (35%), Positives = 39/93 (41%), Gaps = 4/93 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P    P+ +P     P    P   PP  +PP   PP  +PP   PP T PP T PP T P
Sbjct: 174 PTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQP 233

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P  +P     P   P     P   PP+T  P T
Sbjct: 234 PTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPIT 266

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/93 (37%), Positives = 39/93 (41%), Gaps = 4/93 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKP---PGIVPPIVKPPGIV-PPIVKPPVILPPVTVPPVTVPPITVP 312
           P  H P+ +P     P   P    P+   P    PP  +PP   PP T PP T PP T P
Sbjct: 299 PMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQP 358

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P  KP     P   P     P   PPST  PTT
Sbjct: 359 PTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTT 391

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/90 (38%), Positives = 42/90 (46%), Gaps = 1/90 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   PP  +PP    P T PP T PP T PP  +
Sbjct: 589 PTTQPPTTQPPS-TQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTR 647

Query: 325 -PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
            PT  P P   P     P   PP+T  PTT
Sbjct: 648 QPTTQP-PTTQPPTTQPPTTQPPTTQPPTT 676

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 32/89 (35%), Positives = 39/89 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP    P  +PP   PP  +PP    P T PP T PP T PP  +
Sbjct: 609 PYTRPPTTQP-PTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQ 667

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 668 PPTTQPPTTQPPTTQPPTTQPPTTQPPTT 696

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 32/89 (35%), Positives = 39/89 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    + P   PP  +PP   PP  + P   PP T PP T PP T PP  +
Sbjct: 614 PTTQPPTTQP-PTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQ 672

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 673 PPTTQPPTTQPPTTQPPTTQPPTTQPPTT 701

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 34/89 (38%), Positives = 39/89 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P    +PP   PP  +PP   PP  +P    PP T  P T PP T PP  +
Sbjct: 149 PTTQPPSTQP-PTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQ 207

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PPST  PTT
Sbjct: 208 PPSTQPPTTQPPSTQPPTTQPPSTQPPTT 236

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 33/89 (37%), Positives = 39/89 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P    +PP   PP  +PP   PP  + P   PP T PP T PP T  P  +
Sbjct: 594 PTTQPPSTQP-PTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQ 652

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 653 PPTTQPPTTQPPTTQPPTTQPPTTQPPTT 681

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 32/89 (35%), Positives = 39/89 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP   PP    P  +PP   PP T PP T PP T PP  +
Sbjct: 419 PTTQPPTTQP-PTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQ 477

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P  +P     P   PP+T  P T
Sbjct: 478 PPTIQPPSTSPPTTHPPTPQPPTTQPPAT 506

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 32/89 (35%), Positives = 39/89 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP    P  +PP   PP T PP T  P T PP  +
Sbjct: 599 PSTQPPTTQPPY-TRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQ 657

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 658 PPTTQPPTTQPPTTQPPTTQPPTTQPPTT 686

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 32/89 (35%), Positives = 38/89 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P  +P    +PP   PP  + P   PP  +PP   PP T  P T PP T PP  +
Sbjct: 604 PTTQPPYTRP-PTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQ 662

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 663 PPTTQPPTTQPPTTQPPTTQPPTTQPPTT 691

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 32/89 (35%), Positives = 39/89 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   PP  +PP   P   +PP    P T PP T PP T PP  +
Sbjct: 154 PSTQPPTTQP-PTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQ 212

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  PTT
Sbjct: 213 PPTTQPPSTQPPTTQPPSTQPPTTQPPTT 241

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 27/68 (39%), Positives = 31/68 (45%)
 Frame = +1

Query: 208 PIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNP 387
           P  +PP   PP  +PP   PP T PP   PP T PP  +P     P   P     P   P
Sbjct: 109 PTTQPPTTQPPTTQPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQP 168

Query: 388 PSTPTPTT 411
           P+T  PTT
Sbjct: 169 PTTQPPTT 176

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/95 (37%), Positives = 42/95 (44%), Gaps = 6/95 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKP-----PGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P    P+ +P    +PP   PP  +P     P   PP  +PP   PP T PP T PP   
Sbjct: 384 PSTQPPTTQP-PTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAW 442

Query: 310 PPVVK-PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           PP  + PT  P P   P     P   PPST  PTT
Sbjct: 443 PPTTQTPTTQP-PTTQPPSTQPPTTQPPSTQPPTT 476

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 32/89 (35%), Positives = 38/89 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +P    PP  + P   PP  +PP   PP T PP T PP T PP  +
Sbjct: 169 PTTQPPTTQP-PTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQ 227

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP T  PTT
Sbjct: 228 PPSTQPPTTQPPTTQPPTTQPPFTYPPTT 256

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 31/89 (34%), Positives = 38/89 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+ +P    +PP   P   +PP    P  +PP   PP T PP T PP T PP  +
Sbjct: 164 PTTQPPTTQP-PTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQ 222

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P     P   P     P   PP+T  P T
Sbjct: 223 PPTTQPPSTQPPTTQPPTTQPPTTQPPFT 251

[43][TOP]
>UniRef100_Q4VT14 Arabinogalactan protein (Fragment) n=1 Tax=Pinus roxburghii
           RepID=Q4VT14_PINRO
          Length = 165

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/91 (40%), Positives = 45/91 (49%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P  VPP+  PPV +PPV  P
Sbjct: 74  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSVPPVATPPVAVPPVATP 131

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 132 PVAAPPVAVPPASPPAIPP-----PVQAPAP 157

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 38/113 (33%), Positives = 48/113 (42%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 46  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 105

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+VPPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 106 VAPAKAPVSVPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 158

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 46/126 (36%), Positives = 53/126 (42%), Gaps = 16/126 (12%)
 Frame = +1

Query: 85  MLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPV---KPPGIVP--PIVKPPGIVPPI-- 243
           +L  + AAP     T     P    P+  P  PV   KPP   P  P V P    PP+  
Sbjct: 20  VLATAPAAPAAKPPTTAPAAPTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAP 79

Query: 244 -VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---PVLNPPST 396
            V P    PPVT P    PP T PP V P   P+   P  TP   +PPV   PV  PP  
Sbjct: 80  AVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSVPPVATPPVAVPPVATPPVAAPPVA 139

Query: 397 PTPTTP 414
             P +P
Sbjct: 140 VPPASP 145

[44][TOP]
>UniRef100_Q461R7 Arabinogalactan protein (Fragment) n=1 Tax=Pinus gerardiana
           RepID=Q461R7_PINGE
          Length = 167

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/91 (40%), Positives = 45/91 (49%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P  VK P   PP+  PPV +PPV  P
Sbjct: 76  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATP 133

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 134 PVAAPPVAVPPASPPAIPP-----PVQAPAP 159

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 32/93 (34%), Positives = 40/93 (43%), Gaps = 3/93 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP---PVTVPPVTVPPITV 309
           P     KP+      V P    PP+  P    PP  KPP + P   PV+ PPV  PP+ V
Sbjct: 68  PAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAV 127

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           PPV  P +   P   P   P  +  P   P P+
Sbjct: 128 PPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 160

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 34/94 (36%), Positives = 41/94 (43%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPG-KPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP---PITVP 312
           P K  P   P   P KP   V P V P    PP+  P    PP T PP   P   P++ P
Sbjct: 59  PTKPTPPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAP 118

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PV  P +   P  TP +   PV  PP++P    P
Sbjct: 119 PVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 152

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 42/115 (36%), Positives = 48/115 (41%), Gaps = 10/115 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPV 273
           + AP     T   P      P+  P KP  P  P + P    PP  V P V P    PPV
Sbjct: 35  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPP--VAPAVAPTKPAPPV 92

Query: 274 TVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
           T P    PP T PP V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 93  TAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 147

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 34/95 (35%), Positives = 42/95 (44%), Gaps = 5/95 (5%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPVTVP---PVTVPP 300
           KP P    P+  P KP  P  P + P    PP   P    PP   PP   P   PV+ PP
Sbjct: 61  KPTPPV-APAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPP 119

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           +  PPV  P +   P   P +  VP  +PP+ P P
Sbjct: 120 VATPPVAVPPVATPPVAAPPV-AVPPASPPAIPPP 153

[45][TOP]
>UniRef100_Q461R6 Arabinogalactan protein (Fragment) n=1 Tax=Pinus krempfii
           RepID=Q461R6_PINKR
          Length = 167

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/91 (40%), Positives = 45/91 (49%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P  VK P   PP+  PPV +PPV  P
Sbjct: 76  APPVAPAVAPTKPAPPVTXPTKAPPPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATP 133

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 134 PVAAPPVAVPPASPPAIPP-----PVQAPAP 159

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 48  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTXPTKAPPPTTKPPA 107

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 108 VAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 160

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 40/101 (39%), Positives = 45/101 (44%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 47  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTXPTKAPPPTTKPP 106

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 107 AVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 147

[46][TOP]
>UniRef100_Q40336 Proline-rich cell wall protein n=1 Tax=Medicago sativa
           RepID=Q40336_MEDSA
          Length = 381

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 57/173 (32%), Positives = 72/173 (41%), Gaps = 60/173 (34%)
 Frame = +1

Query: 67  AYLFLCMLFLSSAAPILGCGTCGKPVPKK--------------------------HKPSK 168
           A +F+ +L LS+   +L C  C  P PK                           HKP +
Sbjct: 7   ANVFILLLNLSTLLIVLACPYCPYPSPKPPTHHPPIVKPPVHKRRKYSPTPKPPVHKPPR 66

Query: 169 KPGKPV---------KPPGIV-------PPIVKPPGI-----------VPPIVKPPVILP 267
            P KP          KPP +        PP+V PP +            PPIVKPP++ P
Sbjct: 67  YPPKPSPCPPPSSTPKPPHVPKPPHHPKPPVVHPPHVPKPPVHPPYVPKPPIVKPPIVHP 126

Query: 268 P-VTVPPVTVPP--ITVPPVVKPTLPPIPGVTPILPPV----PVLNPPSTPTP 405
           P V  PPV  PP  +  PPVV+P   P P V P+ PP     PV+ PP  P P
Sbjct: 127 PYVPKPPVVKPPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPVVRPPYVPKP 179

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/114 (40%), Positives = 54/114 (47%), Gaps = 22/114 (19%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIV-PPIVKPPGIVPPIV-KPPVILPPVTVP---------- 282
           P P    P   P  PV PP +  PPIVKPP + PP V KPPV+ PP  VP          
Sbjct: 93  PKPPVVHPPHVPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPPYV 152

Query: 283 ------PVTVPPITVPPVVKPTLPPIPGVTPILPPV----PVLNPPSTPTPTTP 414
                 PVT P +  PPVV+P   P P V P+ PP     P++ PP    P  P
Sbjct: 153 PKPPVVPVTPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPIVKPPIVFPPHVP 206

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/117 (39%), Positives = 59/117 (50%), Gaps = 28/117 (23%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIV-PPIVKPPGIV--------------PPIVKPPVILPP- 270
           PV +     K P  PV PP +  PP+V+PP +               PPIVKPP++ PP 
Sbjct: 145 PVVRPPYVPKPPVVPVTPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPIVKPPIVFPPH 204

Query: 271 VTVPPVTV--------PPITVPPVVKPTLPPIPGVTPILPPV----PVLNPPSTPTP 405
           V +PPV          PPI  PP+V P   P+P V P+ PP     P++ PP TPTP
Sbjct: 205 VPLPPVVPSPPPYVPSPPIVKPPIVFPPHVPLPPVVPVTPPYVQPPPIVTPP-TPTP 260

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 45/106 (42%), Positives = 55/106 (51%), Gaps = 14/106 (13%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIV-PPIVKPPGIVPPIVK-PPVI--------LPPVTVPPV 288
           PV +     K P  PV PP +  PPIVKPP + PP V  PPV+         PP+  PP+
Sbjct: 169 PVVRPPYVPKPPVVPVTPPYVPKPPIVKPPIVFPPHVPLPPVVPSPPPYVPSPPIVKPPI 228

Query: 289 TVPP-ITVPPVVKPTLP---PIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP + +PPVV  T P   P P VTP  P  P++ PP    PT P
Sbjct: 229 VFPPHVPLPPVVPVTPPYVQPPPIVTPPTPTPPIVTPPVVSPPTPP 274

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 39/88 (44%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGI----VPPIVKPPVILPPVTVPPVTVPPITVPPVVKP 327
           PS  P  P  PP + PPIV PP +    V P+  P V  PP+  PP   PPI  PPVV P
Sbjct: 212 PSPPPYVP-SPPIVKPPIVFPPHVPLPPVVPVTPPYVQPPPIVTPPTPTPPIVTPPVVSP 270

Query: 328 TLPPIPGVTPILPPVPVLNPPSTPTPTT 411
             P  P  TP  PP  V  PP+ P   T
Sbjct: 271 PTP--PSETPCPPPPLVPYPPTPPAQQT 296

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 41/106 (38%), Positives = 48/106 (45%), Gaps = 17/106 (16%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIV-KPPGIVPP--IVKPPVILPP------------- 270
           P P  H P       VKPP + PP V KPP + PP  + KPPV+ PP             
Sbjct: 104 PKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPPYVPKPPVVPVTPP 163

Query: 271 -VTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            V  PPV  PP    P V P  PP     PI+ P P++ PP  P P
Sbjct: 164 YVPKPPVVRPPYVPKPPVVPVTPPYVPKPPIVKP-PIVFPPHVPLP 208

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 42/101 (41%), Positives = 50/101 (49%), Gaps = 14/101 (13%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVP--PIVKPPGIV-PPIV--------KPPVILPPVTVPPVT 291
           P  H P       VKPP  VP  P+V+PP +  PP+V        KPPV+ PP  VP   
Sbjct: 122 PIVHPPYVPKPPVVKPPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPVVRPPY-VPKPP 180

Query: 292 VPPITVPPVVKPTLPPIPGVTP---ILPPVPVLNPPSTPTP 405
           V P+T P V KP +   P V P    LPPV    PP  P+P
Sbjct: 181 VVPVTPPYVPKPPIVKPPIVFPPHVPLPPVVPSPPPYVPSP 221

[47][TOP]
>UniRef100_Q2YHP5 Proline-rich protein (Fragment) n=1 Tax=Phaseolus vulgaris
           RepID=Q2YHP5_PHAVU
          Length = 264

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 49/112 (43%), Positives = 55/112 (49%), Gaps = 1/112 (0%)
 Frame = +1

Query: 73  LFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVK 249
           L L  L LSS     G     KP P +  P  KP  PV KPP   PP+ KPP   PP+ K
Sbjct: 11  LLLAALLLSSQ----GLANYDKP-PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEK 63

Query: 250 PPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PPV  PPV  PPV  PP+  PPV KP +   P   P +   PV  PP    P
Sbjct: 64  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 115

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 50  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 107

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 108 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 135

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 60  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 117

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 118 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 145

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 70  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 127

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 128 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 155

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 80  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 137

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 138 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 165

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 90  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 147

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 148 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 175

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 100 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 157

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 158 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 185

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 110 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 167

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 168 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 195

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 120 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 177

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 178 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 205

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 130 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 187

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 188 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 215

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 140 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 197

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 198 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 225

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 150 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 207

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 208 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 235

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 160 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 217

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 218 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 245

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 42/93 (45%), Positives = 48/93 (51%), Gaps = 3/93 (3%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 170 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 227

Query: 322 KPTLPPIPGVTPILPPVPVLNPP--STPTPTTP 414
           KP +   P   P +   PV  PP    P P  P
Sbjct: 228 KPPVEKPPVYKPPVEKPPVYQPPYGKPPHPKYP 260

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 32/70 (45%), Positives = 37/70 (52%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PP  K
Sbjct: 194 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYQPPYGK 253

Query: 325 PTLPPIPGVT 354
           P  P  P  T
Sbjct: 254 PPHPKYPPST 263

[48][TOP]
>UniRef100_B6TLL4 36.4 kDa proline-rich protein n=1 Tax=Zea mays RepID=B6TLL4_MAIZE
          Length = 263

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/100 (47%), Positives = 53/100 (53%), Gaps = 11/100 (11%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVK---PPGI--VPPIVKPPGIVPPIVKPPVILPPV----TVPPVT 291
           P P+  KP K P  P     PP     PP+V PP   PP+V PPV  PP+    T PPV 
Sbjct: 64  PKPENPKPPKGPAYPAAGHPPPKSPSYPPVVGPPVTRPPVVGPPVTYPPITGSPTTPPVI 123

Query: 292 VPPITVPPVVKP--TLPPIPGVTPILPPVPVLNPPSTPTP 405
            PP+T PPVV P  T PPI G  P   P+PV  PP T  P
Sbjct: 124 GPPVTRPPVVGPPVTYPPITG--PPSTPLPVTGPPVTYPP 161

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 45/99 (45%), Positives = 49/99 (49%), Gaps = 12/99 (12%)
 Frame = +1

Query: 154 HKPSKKPGKP--VKPPGIVPPIVKPPGIVPPIV----KPPVILPPVTVPPVTVPPITVPP 315
           H P K P  P  V PP   PP+V PP   PPI      PPVI PPVT PPV  PP+T PP
Sbjct: 82  HPPPKSPSYPPVVGPPVTRPPVVGPPVTYPPITGSPTTPPVIGPPVTRPPVVGPPVTYPP 141

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPP------STPTPTTP 414
           +  P   P+P   P     PV  PP      STP P  P
Sbjct: 142 ITGPPSTPLPVTGP-----PVTYPPGGGGGSSTPCPPPP 175

[49][TOP]
>UniRef100_A7J8U3 AGP6 (Fragment) n=1 Tax=Pinus squamata RepID=A7J8U3_9CONI
          Length = 227

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/91 (40%), Positives = 45/91 (49%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P  VK P   PP+  PPV +PPV  P
Sbjct: 74  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATP 131

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 132 PVAAPPVAVPPASPPAIPP-----PVQAPAP 157

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 32/93 (34%), Positives = 40/93 (43%), Gaps = 3/93 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP---PVTVPPVTVPPITV 309
           P     KP+      V P    PP+  P    PP  KPP + P   PV+ PPV  PP+ V
Sbjct: 66  PAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAV 125

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           PPV  P +   P   P   P  +  P   P P+
Sbjct: 126 PPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 158

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 34/94 (36%), Positives = 41/94 (43%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPG-KPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP---PITVP 312
           P K  P   P   P KP   V P V P    PP+  P    PP T PP   P   P++ P
Sbjct: 57  PTKPTPPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAP 116

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PV  P +   P  TP +   PV  PP++P    P
Sbjct: 117 PVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 150

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 42/115 (36%), Positives = 48/115 (41%), Gaps = 10/115 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPV 273
           + AP     T   P      P+  P KP  P  P + P    PP  V P V P    PPV
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPP--VAPAVAPTKPAPPV 90

Query: 274 TVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
           T P    PP T PP V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 91  TAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 145

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 34/95 (35%), Positives = 42/95 (44%), Gaps = 5/95 (5%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPVTVP---PVTVPP 300
           KP P    P+  P KP  P  P + P    PP   P    PP   PP   P   PV+ PP
Sbjct: 59  KPTPPV-APAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPP 117

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           +  PPV  P +   P   P +  VP  +PP+ P P
Sbjct: 118 VATPPVAVPPVATPPVAAPPV-AVPPASPPAIPPP 151

[50][TOP]
>UniRef100_A7J8U2 AGP6 (Fragment) n=1 Tax=Pinus gerardiana RepID=A7J8U2_PINGE
          Length = 227

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/91 (40%), Positives = 45/91 (49%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P  VK P   PP+  PPV +PPV  P
Sbjct: 74  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATP 131

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 132 PVAAPPVAVPPASPPAIPP-----PVQAPAP 157

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 32/93 (34%), Positives = 40/93 (43%), Gaps = 3/93 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP---PVTVPPVTVPPITV 309
           P     KP+      V P    PP+  P    PP  KPP + P   PV+ PPV  PP+ V
Sbjct: 66  PAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAV 125

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           PPV  P +   P   P   P  +  P   P P+
Sbjct: 126 PPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 158

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 34/94 (36%), Positives = 41/94 (43%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPG-KPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP---PITVP 312
           P K  P   P   P KP   V P V P    PP+  P    PP T PP   P   P++ P
Sbjct: 57  PTKPTPPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAP 116

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PV  P +   P  TP +   PV  PP++P    P
Sbjct: 117 PVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 150

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 42/115 (36%), Positives = 48/115 (41%), Gaps = 10/115 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPV 273
           + AP     T   P      P+  P KP  P  P + P    PP  V P V P    PPV
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPP--VAPAVAPTKPAPPV 90

Query: 274 TVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
           T P    PP T PP V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 91  TAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 145

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 34/95 (35%), Positives = 42/95 (44%), Gaps = 5/95 (5%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPVTVP---PVTVPP 300
           KP P    P+  P KP  P  P + P    PP   P    PP   PP   P   PV+ PP
Sbjct: 59  KPTPPV-APAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPP 117

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           +  PPV  P +   P   P +  VP  +PP+ P P
Sbjct: 118 VATPPVAVPPVATPPVAAPPV-AVPPASPPAIPPP 151

[51][TOP]
>UniRef100_A7J8Q9 AGP6 (Fragment) n=1 Tax=Pinus ayacahuite var. veitchii
           RepID=A7J8Q9_9CONI
          Length = 214

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 37/91 (40%), Positives = 45/91 (49%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KPVP    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 61  APPVAPAVAPTKPVPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 118

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 119 PVAAPPVAVPPASPPAIPP-----PVQAPAP 144

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 38/113 (33%), Positives = 48/113 (42%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGI-----VPPIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P +     VPP+  P    PP  KPP 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPVPPVTAPTKAPPPTTKPPA 92

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 93  VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 145

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 40/101 (39%), Positives = 46/101 (45%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P   +PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPVPPVTAPTKAPPPTTKPP 91

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 92  AVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 132

[52][TOP]
>UniRef100_UPI000180BFCF PREDICTED: hypothetical protein n=1 Tax=Ciona intestinalis
           RepID=UPI000180BFCF
          Length = 295

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 38/91 (41%), Positives = 41/91 (45%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           VP    P         PP  VPP   PP  VPP   PP  +PP TVPP T PP TVPP  
Sbjct: 78  VPPSTAPPSTAPPSTAPPSTVPPSTAPPSTVPPSTAPPSTVPPSTVPPSTAPPSTVPPST 137

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P     P   P     P   PPST  P++P
Sbjct: 138 VPPSTVPPSTAPPSTAPPSTAPPSTAPPSSP 168

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 42/98 (42%), Positives = 45/98 (45%), Gaps = 9/98 (9%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P    PS  P   V P    P   PP   PP  VPP   PP  +PP T PP TVPP TVP
Sbjct: 65  PSTAPPSTAPPSTVPPSTAPPSTAPPSTAPPSTVPPSTAPPSTVPPSTAPPSTVPPSTVP 124

Query: 313 PVVKP--TLPPI---PGVTPILPPVPVLNPPSTPTPTT 411
           P   P  T+PP    P   P     P   PPST  P+T
Sbjct: 125 PSTAPPSTVPPSTVPPSTVPPSTAPPSTAPPSTAPPST 162

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 40/91 (43%), Positives = 44/91 (48%), Gaps = 2/91 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P     PP  VPP   PP   PP   PP  +PP T PP TVPP T PP   
Sbjct: 60  PSTAPPSTAPPSTA-PPSTVPPSTAPPSTAPPSTAPPSTVPPSTAPPSTVPPSTAPPSTV 118

Query: 325 P--TLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P  T+PP       +PP  V  PPST  P+T
Sbjct: 119 PPSTVPPSTAPPSTVPPSTV--PPSTVPPST 147

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 38/92 (41%), Positives = 42/92 (45%), Gaps = 2/92 (2%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           VP    P+        PP   PP   PP   PP   PP   PP T PP T PP TVPP  
Sbjct: 43  VPPSTAPTSTVPPSTAPPSTAPPSTAPPSTAPPSTVPPSTAPPSTAPPSTAPPSTVPPST 102

Query: 322 KP--TLPPIPGVTPILPPVPVLNPPSTPTPTT 411
            P  T+PP       +PP  V  PPST  P+T
Sbjct: 103 APPSTVPPSTAPPSTVPPSTV--PPSTAPPST 132

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           VP    P         PP   PP   PP   PP   PP   PP TVPP T PP TVPP  
Sbjct: 53  VPPSTAPPSTAPPSTAPPSTAPPSTVPPSTAPPSTAPPSTAPPSTVPPSTAPPSTVPPST 112

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
            P     P   P     P   PPST  P+T
Sbjct: 113 APPSTVPPSTVPPSTAPPSTVPPSTVPPST 142

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 28/73 (38%), Positives = 30/73 (41%)
 Frame = +1

Query: 193 PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPV 372
           PG +     PP   P    PP   PP T PP T PP T PP   P     P   P     
Sbjct: 35  PGPLNATTVPPSTAPTSTVPPSTAPPSTAPPSTAPPSTAPPSTVPPSTAPPSTAPPSTAP 94

Query: 373 PVLNPPSTPTPTT 411
           P   PPST  P+T
Sbjct: 95  PSTVPPSTAPPST 107

[53][TOP]
>UniRef100_UPI00006A03ED MGC69562 protein. n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00006A03ED
          Length = 408

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 43/96 (44%), Positives = 48/96 (50%), Gaps = 7/96 (7%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKP---VKPPGIVPP----IVKPPGIVPPIVKPPVILPPVTVPPVTVP 297
           P P  H P   P  P   V PPG+ PP     V PPG+ PP + PP I PP  VPP   P
Sbjct: 285 PPPGVHPPVPPPSLPPPGVPPPGVPPPPPNPAVPPPGVPPPGIPPPGI-PPPGVPPPPAP 343

Query: 298 PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            +  PP     LPP PGV P  PP P + PP  P P
Sbjct: 344 GVPPPPAPGVPLPPTPGVPP--PPAPGVPPPPAPAP 377

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/106 (37%), Positives = 49/106 (46%), Gaps = 12/106 (11%)
 Frame = +1

Query: 133 GKPVPKKHKPSKKPGKPVKPPGIVPPI----VKPPGIVPPIVKPPVI--------LPPVT 276
           G P P    P   P   V PPG+ PP+    + PPG+ PP V PP          +PP  
Sbjct: 267 GTPAPPVPPPQLPPAPVVPPPGVHPPVPPPSLPPPGVPPPGVPPPPPNPAVPPPGVPPPG 326

Query: 277 VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           +PP  +PP  VPP   P +PP P     LPP P + PP  P    P
Sbjct: 327 IPPPGIPPPGVPPPPAPGVPPPPAPGVPLPPTPGVPPPPAPGVPPP 372

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 44/95 (46%), Positives = 50/95 (52%), Gaps = 1/95 (1%)
 Frame = +1

Query: 133 GKPVPKKHKPSKKPGKPVKPPGIVP-PIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           G P+P    P   P  PV PP + P P+V PPG+ PP V PP  LPP  VPP  VP    
Sbjct: 258 GLPMPPM--PPGTPAPPVPPPQLPPAPVVPPPGVHPP-VPPP-SLPPPGVPPPGVP---- 309

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P +PP PGV P   P P + PP  P P  P
Sbjct: 310 PPPPNPAVPP-PGVPPPGIPPPGIPPPGVPPPPAP 343

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 40/102 (39%), Positives = 46/102 (45%), Gaps = 14/102 (13%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPP------------VILPPVT-VP 282
           VP    P   P   V PPG+ PP + PPGI PP V PP            V LPP   VP
Sbjct: 303 VPPPGVPPPPPNPAVPPPGVPPPGIPPPGIPPPGVPPPPAPGVPPPPAPGVPLPPTPGVP 362

Query: 283 PVTVPPITVPPVVKP-TLPPIPGVTPILPPVPVLNPPSTPTP 405
           P   P +  PP   P  LPP P    + PP+P   P + P P
Sbjct: 363 PPPAPGVPPPPAPAPGVLPPGPMPPMMRPPLPSDGPTNIPPP 404

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 38/98 (38%), Positives = 45/98 (45%), Gaps = 5/98 (5%)
 Frame = +1

Query: 136 KPVPK-----KHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPP 300
           +PVP      + +P      P  PPG +P    PPG   P V PP + P   VPP  V P
Sbjct: 232 RPVPPAINGIQARPPMPENMPPPPPGGLPMPPMPPGTPAPPVPPPQLPPAPVVPPPGVHP 291

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              PP + P   P PGV P  PP P + PP  P P  P
Sbjct: 292 PVPPPSLPPPGVPPPGVPP-PPPNPAVPPPGVPPPGIP 328

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 38/92 (41%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
 Frame = +1

Query: 133 GKPVPKKHKPSKKPGKPVKPP-GIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           G P P    P   P  P  PP G+ PP + PPGI PP V PP   P   VPP   P + +
Sbjct: 302 GVPPPGVPPP---PPNPAVPPPGVPPPGIPPPGIPPPGVPPP---PAPGVPPPPAPGVPL 355

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PP      PP PGV P   P P + PP    P
Sbjct: 356 PPTPGVPPPPAPGVPPPPAPAPGVLPPGPMPP 387

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 40/99 (40%), Positives = 47/99 (47%), Gaps = 10/99 (10%)
 Frame = +1

Query: 148 KKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVK-----PPVILPPVTVPPVTVPPI 303
           K  KP + P  P  PPG+   VPP +      PP+ +     PP  LP   +PP T P  
Sbjct: 213 KMEKPPQAPTLPPAPPGVKRPVPPAINGIQARPPMPENMPPPPPGGLPMPPMPPGT-PAP 271

Query: 304 TVPPVVKPTLP--PIPGVTPILPPVPVLNPPSTPTPTTP 414
            VPP   P  P  P PGV P +PP P L PP  P P  P
Sbjct: 272 PVPPPQLPPAPVVPPPGVHPPVPP-PSLPPPGVPPPGVP 309

[54][TOP]
>UniRef100_Q4A2B5 Putative membrane protein n=1 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2B5_EHV86
          Length = 2332

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 37/92 (40%), Positives = 45/92 (48%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P+ PP   PP + PP + PP V PP   PP+  PP+  PP+  PP 
Sbjct: 905  PPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPS 964

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P+ PP P  +P   P P   PP  P P  P
Sbjct: 965  PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNP 996

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 36/90 (40%), Positives = 45/90 (50%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    P   P  P  PP   PP + PP   PP + PP + PP   PP + PP+  PP+  
Sbjct: 1164 PPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPP 1223

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P LPP P   P  PP P  +PP +P P+ P
Sbjct: 1224 PPLPPPPSPPPSPPPSPPPSPPPSPPPSPP 1253

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 36/90 (40%), Positives = 46/90 (51%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    P   P  P  PP + PP   PP + PP + PP + PP + PP+  PP+  PP+  
Sbjct: 1169 PPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPP 1228

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P  PP P  +PP +P P TP
Sbjct: 1229 PPSPP-PSPPPSPPPSPPPSPPPSPPPPTP 1257

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 40/92 (43%), Positives = 45/92 (48%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP   PP+ LPP   PP   PP+  PP+
Sbjct: 790  PPPPTPPPSPPPSPP--PPTPPPPAPPPPNPPPPSPPPPLPLPP---PPSPPPPLPPPPL 844

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P LPP P   P  PP P  +PP +P P TP
Sbjct: 845  PPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTP 876

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 38/93 (40%), Positives = 48/93 (51%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPI-VKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P P    P+  P  P  PP   PP+ + PP   PP + PP + PP   PP + PP+  PP
Sbjct: 895  PPPTPPPPAPPPPNP-PPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPP 953

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            +  P LPP P   P  PP P  +PP +P P TP
Sbjct: 954  LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTP 986

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 39/95 (41%), Positives = 44/95 (46%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPP---VTVPPVTVPPITV 309
            P P    PS  P  P  PP   PP   PP   PP   PP   PP   +  PP   PP+  
Sbjct: 960  PPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLPP 1019

Query: 310  PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP+  P LPP P   P  PP P  +PP +P P TP
Sbjct: 1020 PPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTP 1054

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 40/92 (43%), Positives = 45/92 (48%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP   PP+ LPP   PP   PP+  PP+
Sbjct: 1059 PPPPAPPPSPPPSPP--PPTPPPPAPPPPNPPPPSPPPPLPLPP---PPSPPPPLPPPPL 1113

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P LPP P   P  PP P  +PP +P P TP
Sbjct: 1114 PPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTP 1145

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 38/90 (42%), Positives = 40/90 (44%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1125 PPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 1184

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P LPP P   P LPP P+  PP  P P+ P
Sbjct: 1185 PPLPPPPSPPPPLPPPPLPPPPVPPPPSPP 1214

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 38/90 (42%), Positives = 47/90 (52%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P  + P   P  P+ PP   PP + PP + PP V PP   PP+  PP+  PP+  PP   
Sbjct: 1174 PPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPP 1233

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P+ PP P  +P  PP P   PPS P PT P
Sbjct: 1234 PSPPPSPPPSP--PPSP---PPSPPPPTPP 1258

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/91 (42%), Positives = 47/91 (51%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P+ PP   PP + PP + PP   PP  LPP  +PP   PP + PP   
Sbjct: 1594 PPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPP--LPPPPLPPPPSPPPSPPPSPP 1651

Query: 325  PTLPPIPGVTPI-LPPVPVLNPPSTPTPTTP 414
            P+ PP P  +P  LPP P   PPS P P+ P
Sbjct: 1652 PSPPPSPPPSPSPLPPPPTPPPPSPPLPSPP 1682

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 38/92 (41%), Positives = 46/92 (50%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P  P+ PP + PP V PP   PP+  PP  LPP  +PP   PP + PP 
Sbjct: 915  PPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPP--LPPPPLPPPPSPPPSPPPS 972

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P+ PP P   P  PP P   PP+ P P+ P
Sbjct: 973  PPPSPPPSP--PPPTPPPPAPPPPNPPPPSPP 1002

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/92 (39%), Positives = 42/92 (45%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P      P   P  P  PP + PP V PP   PP   P   LPP   PP + PP+  PP 
Sbjct: 2098 PSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPP---LPPPPTPPPSPPPLPPPPT 2154

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP+P   P  PP P   PP +P+P  P
Sbjct: 2155 PPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPP 2186

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/94 (41%), Positives = 44/94 (46%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKH--KPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            PVP      PS  P  P  PP   PP   PP  +PP   PP  LPP  VPP   PP   P
Sbjct: 1574 PVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPP 1633

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P + P   P P   P  PP P  +PP +P+P  P
Sbjct: 1634 PPLPPPPSPPPSPPPSPPPSPPPSPPPSPSPLPP 1667

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 38/93 (40%), Positives = 44/93 (47%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP-PVILPPVTVPPVTVPPITVPP 315
           P P    P   P  P  PP + PP + PP + PP   P P   PP + PP T PP   PP
Sbjct: 694 PSPPPPSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 753

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P   P  PP P  +PP +P P TP
Sbjct: 754 PAPPPAPP-PSPPPSPPPSPPPSPPPSPPPPTP 785

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 37/93 (39%), Positives = 44/93 (47%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P  P  PP   PP   PP + PP   PP + PP   PP   PP + PP+
Sbjct: 1157 PSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPL 1216

Query: 319  VKPTLPPIP-GVTPILPPVPVLNPPSTPTPTTP 414
              P LPP P    P  PP P  +PP +P P+ P
Sbjct: 1217 PPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPP 1249

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 38/91 (41%), Positives = 46/91 (50%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    P   P  P+ PP + PP V PP   PP+  PP  LPP  +PP   PP + PP   
Sbjct: 1184 PPPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPP--LPPPPLPPPPSPPPSPPPSPP 1241

Query: 325  PTLPPIPGVTPILP-PVPVLNPPSTPTPTTP 414
            P+ PP P  +P  P P P   PP TP P+ P
Sbjct: 1242 PSPPPSPPPSPPPPTPPPPAPPPPTPPPSPP 1272

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 38/92 (41%), Positives = 44/92 (47%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P+  P  P  PP   PP   PP   PP   PP  LPP   PP   PP+  PP+
Sbjct: 1146 PPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPP---PPLPPPPL 1202

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P +PP P   P LPP P+  PP  P P+ P
Sbjct: 1203 PPPPVPPPPSPPP-LPPPPLPPPPLPPPPSPP 1233

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 38/92 (41%), Positives = 39/92 (42%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP   PP   PP 
Sbjct: 1115 PPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPA--PPPSPPPSPPPPTPPPPA 1172

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P   P LPP P   PP  P P  P
Sbjct: 1173 PPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPP 1204

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 38/92 (41%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 765  PPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 824

Query: 325  P--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   LPP P   P LPP P+  PP  P P+ P
Sbjct: 825  PPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPP 856

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 39/95 (41%), Positives = 46/95 (48%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP   PP+ LPP   PP   PP+  PP+
Sbjct: 881  PPPPAPPPSPPPSPP--PPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPP---PPLPPPPL 935

Query: 319  VKPTLPPIPGVTPILPPV---PVLNPPSTPTPTTP 414
              P +PP P   P+ PP    P L PP +P P+ P
Sbjct: 936  PPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPP 970

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 38/92 (41%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1034 PPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 1093

Query: 325  P--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   LPP P   P LPP P+  PP  P P+ P
Sbjct: 1094 PPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPP 1125

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 38/94 (40%), Positives = 43/94 (45%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP--PVTVPPITVP 312
            P P    PS  P  P+ PP   PP + PP + PP + PP   PP   P  P + PP   P
Sbjct: 814  PPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPP 873

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  PP P   P  PP P   PP TP P  P
Sbjct: 874  PTPPPPAPPPPAPPPSPPPSP---PPPTPPPPAP 904

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 40/98 (40%), Positives = 42/98 (42%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV---KPPVILPPVTVPPVTVPPITV 309
            P P    PS  P  P  PP   PP   PP   PP      PP   PP T PP   PP   
Sbjct: 850  PPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNP 909

Query: 310  PPVVKP---TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   P    LPP P   P LPP P+  PP  P P+ P
Sbjct: 910  PPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPP 947

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 38/94 (40%), Positives = 43/94 (45%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP--PVTVPPITVP 312
            P P    PS  P  P+ PP   PP + PP + PP + PP   PP   P  P + PP   P
Sbjct: 992  PPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPP 1051

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  PP P   P  PP P   PP TP P  P
Sbjct: 1052 PTPPPPAPPPPAPPPSPPPSP---PPPTPPPPAP 1082

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 38/94 (40%), Positives = 43/94 (45%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP--PVTVPPITVP 312
            P P    PS  P  P+ PP   PP + PP + PP + PP   PP   P  P + PP   P
Sbjct: 1083 PPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPP 1142

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  PP P   P  PP P   PP TP P  P
Sbjct: 1143 PTPPPPAPPPPAPPPSPPPSP---PPPTPPPPAP 1173

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 37/92 (40%), Positives = 44/92 (47%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P     PP   PP   PP   PP+  PP   PP+  PP+  PP+  PP 
Sbjct: 1153 PAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPVPPPPS 1212

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P LPP P   P LPP P  +PP +P P+ P
Sbjct: 1213 -PPPLPPPPLPPPPLPPPP--SPPPSPPPSPP 1241

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 40/92 (43%), Positives = 45/92 (48%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP   PP+  PP   PP+  PP+  PPV
Sbjct: 1150 PPPPAPPPSPPPSPP--PPTPPPPAPPPPNPPPPSPPPPLPPPPSPPPPLPPPPLPPPPV 1207

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P   P LPP P L PP +P P+ P
Sbjct: 1208 PPPPSPP-PLPPPPLPP-PPLPPPPSPPPSPP 1237

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 39/92 (42%), Positives = 46/92 (50%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP   PP + PP  VPP  +PP + PP 
Sbjct: 1532 PSPSPPPPSPPPPSPSPPPSPPPP--SPPPSPPPPSPPPPLPPP-PVPPSPLPPPSPPPS 1588

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P+ PP P  +P  PP+P+  PPS P P  P
Sbjct: 1589 PPPSPPPSPPPSP-PPPLPLPPPPSPPPPLPP 1619

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 38/98 (38%), Positives = 44/98 (44%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVP-PIVKPPVILPPVTVPPVTVPPITVPP 315
           P P    P   P  P+ PP + PP + PP   P P   PP   PP T PP   PP   PP
Sbjct: 699 PSPPPSPPPPSPPPPLPPPPLPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPP 758

Query: 316 VVKPTLPPIPGVTPI-----LPPVPVLNPPSTPTPTTP 414
              P+ PP P  +P       PP P   PP+ P PT P
Sbjct: 759 APPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTPP 796

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 37/93 (39%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP-PVILPPVTVPPVTVPPITVPP 315
            P P    P   P  P+ PP + PP + PP   PP   P P   PP + PP T PP   PP
Sbjct: 824  PPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 883

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P  PP P   P  PP P   PP+ P P+ P
Sbjct: 884  PAPPPSPP-PSPPPPTPPPPAPPPPNPPPPSPP 915

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 37/93 (39%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP-PVILPPVTVPPVTVPPITVPP 315
            P P    P   P  P+ PP + PP + PP   PP   P P   PP + PP T PP   PP
Sbjct: 1002 PPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 1061

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P  PP P   P  PP P   PP+ P P+ P
Sbjct: 1062 PAPPPSPP-PSPPPPTPPPPAPPPPNPPPPSPP 1093

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 37/91 (40%), Positives = 44/91 (48%), Gaps = 1/91 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV-PPITVPP 315
            P P    P   P  P  PP   PP   PP   PP+  PP   PP  +PP  V PP + PP
Sbjct: 1572 PPPVPPSPLPPPSPPPSPPPSPPPS-PPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPP 1630

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            +  P LPP P   P  PP P  +PP +P P+
Sbjct: 1631 LPPPPLPPPPSPPPSPPPSPPPSPPPSPPPS 1661

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 44/135 (32%), Positives = 56/135 (41%), Gaps = 10/135 (7%)
 Frame = +1

Query: 40   ISMESSKIHAYLFLCMLFLSSAAPI--LGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPI 213
            +  ES+  + Y  +C L   S A +  + C     P P    P      P  PP   PP 
Sbjct: 646  VDQESAFAYDY-GICGLVGDSCARVGSVDCAPSPSPPPPSPPPPSPSPPPSPPPPSPPPS 704

Query: 214  VKPPGIVPPIVKPPVILPPVTV--------PPVTVPPITVPPVVKPTLPPIPGVTPILPP 369
              PP   PP+  PP  LPP  +        PP + PP   PP   P  PP P   P  PP
Sbjct: 705  PPPPSPPPPLPPPP--LPPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPP 762

Query: 370  VPVLNPPSTPTPTTP 414
             P  +PP +P P+ P
Sbjct: 763  SPPPSPPPSPPPSPP 777

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 35/92 (38%), Positives = 45/92 (48%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P  P  P  + PP   PP + PP V PP   PP+  PP+  PP + PP 
Sbjct: 1587 PSPPPSPPPSPPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPPPLPPPP-SPPPS 1645

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P+ PP P  +P   P P+  PP+ P P+ P
Sbjct: 1646 PPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPP 1677

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 39/98 (39%), Positives = 40/98 (40%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP   PP   PP 
Sbjct: 846  PPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPA--PPPSPPPSPPPPTPPPPA 903

Query: 319  VKPTLPPIPGVTPILP------PVPVLNPPSTPTPTTP 414
              P  PP P   P LP      P P L PP  P P  P
Sbjct: 904  PPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPVP 941

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 39/98 (39%), Positives = 40/98 (40%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP   PP   PP 
Sbjct: 1024 PPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPA--PPPSPPPSPPPPTPPPPA 1081

Query: 319  VKPTLPPIPGVTPILP------PVPVLNPPSTPTPTTP 414
              P  PP P   P LP      P P L PP  P P  P
Sbjct: 1082 PPPPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLP 1119

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 40/100 (40%), Positives = 45/100 (45%), Gaps = 8/100 (8%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP    P   P  P+ PP + PP   PP   PP   PP   PP + PP T PP   PP 
Sbjct: 939  PVPPPPSPPPLPPPPLPPPPLPPPPSPPPS--PPPSPPPS--PPPSPPPPTPPPPAPPPP 994

Query: 319  VKP--------TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P         LPP P   P LPP P+  PP  P P+ P
Sbjct: 995  NPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPP 1034

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 37/97 (38%), Positives = 40/97 (41%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP-----PVILPPVTVPPVTVPPI 303
            P P    P   P  P+ PP + PP + PP   PP   P     P   PP   PP   PP 
Sbjct: 1093 PPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 1152

Query: 304  TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              PP   P  PP P   P  PP P   PPS P P  P
Sbjct: 1153 PAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPP 1189

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 37/92 (40%), Positives = 40/92 (43%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP+  PP 
Sbjct: 1134 PSPPPSPPPPTPPPPAPPPP-APPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPPPPS 1192

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P LPP P   P +PP P  +PP  P P  P
Sbjct: 1193 PPPPLPPPPLPPPPVPPPP--SPPPLPPPPLP 1222

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/83 (43%), Positives = 39/83 (46%), Gaps = 1/83 (1%)
 Frame = +1

Query: 160  PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP-PVTVPPITVPPVVKPTLP 336
            PS  P  P   P   PP    P   PP+  PPV  PP   P P  +PP   PP   P LP
Sbjct: 2091 PSPPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPLP 2150

Query: 337  PIPGVTPILPPVPVLNPPSTPTP 405
            P P   P  PP+P   PPS PTP
Sbjct: 2151 PPPTPPPQSPPLPSPPPPSPPTP 2173

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 41/103 (39%), Positives = 48/103 (46%), Gaps = 11/103 (10%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI------LPPVTVPPVTVPP 300
            P P    P   P  P  PP  VPP   PP   PP+  PP        LPP   PP   PP
Sbjct: 2102 PSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSPPPLPPPPTPPPQSPP 2161

Query: 301  I-TVPPVVKPTLPPIPGVTPI-LPPVPVLNPPSTP---TPTTP 414
            + + PP   PT PP+P  +P  LPP P+  PPS P    P +P
Sbjct: 2162 LPSPPPPSPPTPPPLPPPSPSPLPPPPIPPPPSPPPHPPPQSP 2204

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 38/97 (39%), Positives = 39/97 (40%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP-----PVTVPPVTVPPI 303
            P P    PS  P  P  PP   PP   PP   PP   PP   P     P   PP + PP 
Sbjct: 720  PPPPLPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPAPPPSPPPSPPPSPPPSPPPS 779

Query: 304  TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              PP   P  PP P   P  PP P   PP TP P  P
Sbjct: 780  PPPPTPPPPAPPPPTPPPSPPPSP---PPPTPPPPAP 813

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 39/94 (41%), Positives = 42/94 (44%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGK--PVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P P    PS  P    P  PP  + P   PP   P    PP  L P + PP T PP   P
Sbjct: 323 PPPPSLSPSPPPPSLSPSPPPPSLSPSPPPPSFSPS--PPPPSLSP-SPPPATPPPSPPP 379

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P LPP P   P LPP P+  PPS P P  P
Sbjct: 380 PSPPPPLPPPPSPPPPLPPPPIPPPPSPPPPPPP 413

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 38/96 (39%), Positives = 39/96 (40%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP   PP   PP + PP   PP   PP   
Sbjct: 757  PPAPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPPT--PPPSPPPSPPPPTPPPPAPP 814

Query: 325  PTLPPIPGVTPILP------PVPVLNPPSTPTPTTP 414
            P  PP P   P LP      P P L PP  P P  P
Sbjct: 815  PPNPPPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLP 850

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 39/97 (40%), Positives = 39/97 (40%), Gaps = 7/97 (7%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 856  PPSPPPSPPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPP 915

Query: 325  PTLP-------PIPGVTPILPPVPVLNPPSTPTPTTP 414
            P LP       P P   P LPP PV  PPS P    P
Sbjct: 916  PPLPLPPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPP 952

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 36/92 (39%), Positives = 41/92 (44%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P     PP   PP+  PP  VPP   PP + PP   PP   PP + PP 
Sbjct: 1178 PPPPSPPPPLPPPPSPPPPLPPPPLPPPP--VPPPPSPPPLPPPPLPPPPLPPPPSPPPS 1235

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P+ PP P  +P   P P   PP  P P TP
Sbjct: 1236 PPPSPPPSPPPSPPPSPPPPTPPPPAPPPPTP 1267

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 38/91 (41%), Positives = 43/91 (47%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP-PITVPPVV 321
            P    P   P  P+ PP  VPP   PP + PP + PP + PP + PP   P P   PP  
Sbjct: 1189 PPPSPPPPLPPPPLPPPP-VPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPS 1247

Query: 322  KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P PT P
Sbjct: 1248 PPPSPPPPTPPPPAPPPPT-PPPSPPPPTPP 1277

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 40/98 (40%), Positives = 44/98 (44%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P   P   PP   PP  +PP   PP  LPP + PP   PP + PP 
Sbjct: 1539 PSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPP--SPPPSPPPS 1596

Query: 319  VKPT------LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P+      LPP P   P LPP PV  PPS P    P
Sbjct: 1597 PPPSPPPPLPLPPPPSPPPPLPPPPVPPPPSPPPLPPP 1634

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 36/92 (39%), Positives = 40/92 (43%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P     PP   PP   PP  +PP   PP  LPP   PP   PP   PP 
Sbjct: 1686 PPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPS 1745

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P+ PP P   P  PP P L+P   P  T+P
Sbjct: 1746 PPPSPPPSP--PPPSPPPPSLSPSPPPPSTSP 1775

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 36/97 (37%), Positives = 42/97 (43%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP-----PVTVPPVTVPPI 303
            P P    P+  P  P  PP   PP   PP   PP   PP   P     P  +PP  +PP 
Sbjct: 2133 PPPLPPPPTPPPSPPPLPPPPTPPPQSPPLPSPPPPSPPTPPPLPPPSPSPLPPPPIPPP 2192

Query: 304  TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              PP   P   P+P   P  PP P L PP +P P+ P
Sbjct: 2193 PSPPPHPPPQSPLPPSPPPPPPPPPLPPPPSPPPSQP 2229

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 39/97 (40%), Positives = 46/97 (47%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P+  P  P  PP   PP+  PP   PP   PP  LPP  +PP   PP + PP 
Sbjct: 804  PPPTPPPPAPPPPNP-PPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPS 862

Query: 319  VKPTLPPI-PGVTP----ILPPVPVLNPPSTPTPTTP 414
              P+ PP  P  TP      PP P  +PP +P P TP
Sbjct: 863  PPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTP 899

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 39/97 (40%), Positives = 46/97 (47%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P+  P  P  PP   PP+  PP   PP   PP  LPP  +PP   PP + PP 
Sbjct: 982  PPPTPPPPAPPPPNP-PPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPS 1040

Query: 319  VKPTLPPI-PGVTP----ILPPVPVLNPPSTPTPTTP 414
              P+ PP  P  TP      PP P  +PP +P P TP
Sbjct: 1041 PPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTP 1077

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 39/97 (40%), Positives = 46/97 (47%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P+  P  P  PP   PP+  PP   PP   PP  LPP  +PP   PP + PP 
Sbjct: 1073 PPPTPPPPAPPPPNP-PPPSPPPPLPLPPPPSPPPPLPPPPLPPPPLPPPPSPPPSPPPS 1131

Query: 319  VKPTLPPI-PGVTP----ILPPVPVLNPPSTPTPTTP 414
              P+ PP  P  TP      PP P  +PP +P P TP
Sbjct: 1132 PPPSPPPSPPPPTPPPPAPPPPAPPPSPPPSPPPPTP 1168

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P     PP   PP   PP   PP   PP   PP   PP   PP   PP+
Sbjct: 1130 PSPPPSPPPSPPPPTPPPPAPPPP--APPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPL 1187

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P   P LPP PV  PPS P    P
Sbjct: 1188 PPPPSPPPPLPPPPLPPPPVPPPPSPPPLPPP 1219

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 36/97 (37%), Positives = 43/97 (44%), Gaps = 7/97 (7%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP------PVTVPPVTVPPIT 306
            P    P   P  P+ PP + PP   PP   PP+  PP+  P      P   PP + PP  
Sbjct: 922  PPPSPPPPLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSP 981

Query: 307  VPPVVKPTLPPIPGVTPILPPVPV-LNPPSTPTPTTP 414
             PP   P  PP P   P  PP P+ L PP +P P  P
Sbjct: 982  PPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLP 1018

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/93 (37%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP-PVILPPVTVPPVTVPPITVPP 315
            P P    P   P  P  PP + PP V P  + PP   P P   PP + PP   PP+ +PP
Sbjct: 1550 PSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPPPSPPPSPPPSPPPSPPPSPPPPLPLPP 1609

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P  P  P   P  P  P L PP  P P +P
Sbjct: 1610 PPSPPPPLPPPPVPPPPSPPPLPPPPLPPPPSP 1642

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/96 (37%), Positives = 43/96 (44%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP----PVTVPPVTVPPIT 306
            P P    P+  P  P   P   PP   PP   PP   PP   P    P+  PP   PP+ 
Sbjct: 872  PPPTPPPPAPPPPAPPPSPPPSPPPPTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLP 931

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP+  P +PP P   P LPP P+  PP  P P+ P
Sbjct: 932  PPPLPPPPVPPPPSPPP-LPPPPLPPPPLPPPPSPP 966

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/91 (39%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKP-PGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
            P    P   P  P  PP   PP   P P  +PP   PP  LPP  +PP   PP  +PP  
Sbjct: 1672 PPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPP 1731

Query: 322  KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  P  P   PPS P P+ P
Sbjct: 1732 SPPSPPPPSPPP--PSPPPSPPPSPPPPSPP 1760

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 37/93 (39%), Positives = 40/93 (43%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP-PVILPPVTVPPVTVPPITVPP 315
            P P    P   P  P  PP   PP   PP   PP   P P   PP + PP T PP   PP
Sbjct: 735  PSPPPSPPPPTPPPPAPPPPAPPP--APPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPP 792

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P  PP P   P  PP P   PP+ P P+ P
Sbjct: 793  PTPPPSPP-PSPPPPTPPPPAPPPPNPPPPSPP 824

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 37/95 (38%), Positives = 41/95 (43%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPG--IVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P P    P+  P  P  PP   PP   PP     PP   PP   PP   PP + PP   P
Sbjct: 747  PPPAPPPPAPPPAPPPSPPPSPPPS-PPPSPPPSPPPPTPPPPAPPPPTPPPSPPPSPPP 805

Query: 313  PVVKPTLPPIPGVTPILPPVPV-LNPPSTPTPTTP 414
            P   P  PP P   P  PP P+ L PP +P P  P
Sbjct: 806  PTPPPPAPPPPNPPPPSPPPPLPLPPPPSPPPPLP 840

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 40/111 (36%), Positives = 44/111 (39%), Gaps = 19/111 (17%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKP--PGIVPPIVKPPVILPPVTVPPVTVPP---- 300
            P P    PS  P  P  PP   PP   P  P   PP   PP+  PP+  PP   PP    
Sbjct: 1637 PPPPSPPPSPPPSPPPSPPPSPPPSPSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNA 1696

Query: 301  ----------ITVPPVVKPTLPPIPGVTPILPPVPVLN---PPSTPTPTTP 414
                         PP+  P LPP P   P LPP P      PPS P P+ P
Sbjct: 1697 PSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPP 1747

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 34/94 (36%), Positives = 43/94 (45%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI--LPPVTVPPVTVPPITVP 312
            P P    PS  P     PP + PP + PP   PP + PP     PP   PP   PP + P
Sbjct: 1692 PPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPP 1751

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  PP P ++P  PP     P ++P+P  P
Sbjct: 1752 PSPPPPSPPPPSLSPSPPP-----PSTSPSPPPP 1780

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 32/77 (41%), Positives = 37/77 (48%)
 Frame = +1

Query: 184  VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPIL 363
            V PP   PP +      PP   PP+   P  +PP  VPP   PP   P LPP P   P  
Sbjct: 2087 VPPPPSPPPSLPSSSPSPPPPSPPLPPSPPPLPPPPVPPPPTPPPSPPPLPPPPTPPPSP 2146

Query: 364  PPVPVLNPPSTPTPTTP 414
            PP+P   PP TP P +P
Sbjct: 2147 PPLP---PPPTPPPQSP 2160

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/93 (39%), Positives = 42/93 (45%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP-PVTVPPVTVPPITVPP 315
            P+P    P      P  PP + PP + PP + PP   PP   P P   PP + PP   PP
Sbjct: 1196 PLPPPPLPPPPVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPP 1255

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P  PP P  TP  PP P   PP TP P  P
Sbjct: 1256 TPPPPAPPPP--TP--PPSP---PPPTPPPPPP 1281

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 32/77 (41%), Positives = 35/77 (45%)
 Frame = +1

Query: 184  VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPIL 363
            V  P   PP   PP   PP   PP   PP   PP   PP+  PPV    LPP P   P  
Sbjct: 1531 VPSPSPPPPSPPPPSPSPPPSPPPPSPPPSPPPPSPPPPLPPPPVPPSPLPP-PSPPPSP 1589

Query: 364  PPVPVLNPPSTPTPTTP 414
            PP P  +PP +P P  P
Sbjct: 1590 PPSPPPSPPPSPPPPLP 1606

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 36/97 (37%), Positives = 39/97 (40%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP-----PVTVPPI 303
           P P    P   P  P  PP   PP   PP   PP   PP   PP   P     P   PP 
Sbjct: 716 PPPLPPPPLPPPSPPPSPPPSPPPSPPPP-TPPPPAPPPPAPPPAPPPSPPPSPPPSPPP 774

Query: 304 TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           + PP   P  PP P      PP P  +PP +P P TP
Sbjct: 775 SPPPSPPPPTPPPPAPP---PPTPPPSPPPSPPPPTP 808

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/92 (35%), Positives = 40/92 (43%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P+P    P      P+ PP + PP   PP   PP   PP    P   PP +  P+  PP 
Sbjct: 1616 PLPPPPVPPPPSPPPLPPPPLPPPPSPPPS--PPPSPPP---SPPPSPPPSPSPLPPPPT 1670

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP+P      PP+P   PPS P P  P
Sbjct: 1671 PPPPSPPLPS-----PPLPAPPPPSPPPPNAP 1697

 Score = 53.5 bits (127), Expect(2) = 4e-07
 Identities = 28/70 (40%), Positives = 32/70 (45%)
 Frame = +1

Query: 160  PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
            PS  P  P  PP + PP   P  + PP + PP   PP   P   +PP   PP   P LPP
Sbjct: 2163 PSPPPPSPPTPPPLPPP--SPSPLPPPPIPPPPSPPPHPPPQSPLPPSPPPPPPPPPLPP 2220

Query: 340  IPGVTPILPP 369
             P   P  PP
Sbjct: 2221 PPSPPPSQPP 2230

 Score = 23.9 bits (50), Expect(2) = 4e-07
 Identities = 14/32 (43%), Positives = 15/32 (46%)
 Frame = +2

Query: 89   SSSPLPPPFSVAAPAVSPSQRNTSPAKSPASP 184
            SSSP PPP S   P  SP      P   P +P
Sbjct: 2099 SSSPSPPPPSPPLPP-SPPPLPPPPVPPPPTP 2129

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 35/103 (33%), Positives = 43/103 (41%), Gaps = 11/103 (10%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVP--------PIVKPPVILPPVTVPPVTV 294
           P P    PS  P  P +PP    P   PP + P        P   PP + P  + PP + 
Sbjct: 298 PPPSPPPPSTSPSPPPRPPPSASPSPPPPSLSPSPPPPSLSPSPPPPSLSP--SPPPPSF 355

Query: 295 PPITVPPVVKPTLPPI---PGVTPILPPVPVLNPPSTPTPTTP 414
            P   PP + P+ PP    P   P  PP P+  PPS P P  P
Sbjct: 356 SPSPPPPSLSPSPPPATPPPSPPPPSPPPPLPPPPSPPPPLPP 398

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 34/83 (40%), Positives = 37/83 (44%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP    P   P  P+ PP + PP   PP   P     P   PP + PP T PP   PP 
Sbjct: 1206 PVPPPPSPPPLPPPPLPPPPLPPPPSPPPSPPPSPPPSPPPSPPPSPPPPTPPPPAPPPP 1265

Query: 319  VKPTLPPIPGVTPILPPVPVLNP 387
              P  PP P  TP  PP P L P
Sbjct: 1266 TPPPSPPPP--TP--PPPPPLAP 1284

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 38/113 (33%), Positives = 45/113 (39%), Gaps = 21/113 (18%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI-------LPPVTVPPVTVP 297
            PVP    P   P  P+ PP   PP   PP   PP   PP         LPP   PP   P
Sbjct: 1621 PVPPPPSPPPLPPPPLPPPPSPPP--SPPPSPPP--SPPPSPPPSPSPLPPPPTPPPPSP 1676

Query: 298  PITVPPVVKP--------------TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P+  PP+  P              ++PP     P LPP P+  PP+ P P  P
Sbjct: 1677 PLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPP 1729

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 35/95 (36%), Positives = 41/95 (43%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPP---VTVPPVTVPPITV 309
            P P    P   P  P  PP   PP   PP   PP   PP   PP    + PP +  P   
Sbjct: 1719 PPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPPPSPPPPSLSPSPPPPSTSPSPP 1778

Query: 310  PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   P+ PP P  +P  PP P L+P   P  T+P
Sbjct: 1779 PPSASPS-PPPPSASP-SPPPPSLSPSPPPPSTSP 1811

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 34/96 (35%), Positives = 40/96 (41%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
            P P    P+  P  P  P    P   PP   PP    P   PP   PP  +PP  +PP  
Sbjct: 1662 PSPLPPPPTPPPPSPPLPSPPLPAPPPPSPPPPNAPSPSSMPPSQSPPPPLPPPPLPPPP 1721

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP   P  P  P   P  PP P  +PP +P P+ P
Sbjct: 1722 NPPPPLPPPPSPPSPPPPSPPPP--SPPPSPPPSPP 1755

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 37/119 (31%), Positives = 49/119 (41%), Gaps = 27/119 (22%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV-------KPPVILPPVTVPPVTVP 297
            P P    PS+ P  P+ PP + PP   PP + PP          PP   PP + PP   P
Sbjct: 1697 PSPSSMPPSQSPPPPLPPPPLPPPPNPPPPLPPPPSPPSPPPPSPPPPSPPPSPPPSPPP 1756

Query: 298  PITVPPVVKPTLPPIPGVTPI-----------------LPPVPVLNP---PSTPTPTTP 414
            P   PP + P+ PP P  +P                   PP P L+P   P + +P+ P
Sbjct: 1757 PSPPPPSLSPSPPP-PSTSPSPPPPSASPSPPPPSASPSPPPPSLSPSPPPPSTSPSPP 1814

[55][TOP]
>UniRef100_A7J8S1 AGP6 (Fragment) n=1 Tax=Pinus chiapensis RepID=A7J8S1_9CONI
          Length = 214

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 35/80 (43%), Positives = 43/80 (53%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P  VK P   PP+  PPV +PPV  PPV+ PP+ VPP
Sbjct: 72  KPAPPVTAPTKAPPPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPVSAPPVAVPP 129

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 130 ASPPAIPP-----PVQAPAP 144

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/90 (40%), Positives = 42/90 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P  VK PV  PPV  PPV VPP+  PPV
Sbjct: 66  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPV 120

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 121 SAPPVAVPPASPPAIPP-----PVQAPAPS 145

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 36/110 (32%), Positives = 44/110 (40%), Gaps = 5/110 (4%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPV 273
           + AP     T   P      P+  P KP  P  P + P    PP   P    PP   PP 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 92

Query: 274 TVP---PVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P   PV+ PP+  PPV  P     P  TP +   PV  PP++P    P
Sbjct: 93  VAPVKAPVSAPPVATPPVAVP-----PVATPPVSAPPVAVPPASPPAIPP 137

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 36/93 (38%), Positives = 40/93 (43%), Gaps = 11/93 (11%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 91

Query: 316 VVKPTLPPIPGVTPILPPV---PVLNPPSTPTP 405
            V P   P+       PPV   PV  PP +  P
Sbjct: 92  AVAPVKAPVSAPPVATPPVAVPPVATPPVSAPP 124

[56][TOP]
>UniRef100_Q4VT13 Arabinogalactan protein (Fragment) n=1 Tax=Pinus chiapensis
           RepID=Q4VT13_9CONI
          Length = 154

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 35/80 (43%), Positives = 42/80 (52%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P  VK P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 74  KPAPPVTAPTKAPPPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 131

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 132 ASPPAIPP-----PVQAPAP 146

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/90 (40%), Positives = 42/90 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P  VK PV  PPV  PPV VPP+  PPV
Sbjct: 68  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPV 122

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 123 AAPPVAVPPASPPAIPP-----PVQAPAPS 147

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 35  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 91

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 92  PPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 139

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 49/133 (36%), Positives = 59/133 (44%), Gaps = 19/133 (14%)
 Frame = +1

Query: 73  LFLCMLFLSSAA-PILGCGTCGKPV-PKKHKP-SKKPGKPV---KPPGIVP--PIVKPPG 228
           L+LC+   S+A  P++       P  P   KP +  P  PV   KPP   P  P V P  
Sbjct: 2   LWLCIASFSNAEEPLVDTVLATAPAAPTTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTK 61

Query: 229 IVPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---P 375
             PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV   P
Sbjct: 62  PTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVATPP 121

Query: 376 VLNPPSTPTPTTP 414
           V  PP    P +P
Sbjct: 122 VAAPPVAVPPASP 134

[57][TOP]
>UniRef100_Q4VT10 Arabinogalactan protein (Fragment) n=1 Tax=Pinus monticola
           RepID=Q4VT10_PINMO
          Length = 154

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 35/80 (43%), Positives = 42/80 (52%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P  VK P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 74  KPAPPVTAPTKAPPPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 131

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 132 ASPPAIPP-----PVQAPAP 146

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/90 (40%), Positives = 42/90 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P  VK PV  PPV  PPV VPP+  PPV
Sbjct: 68  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPV 122

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 123 AAPPVAVPPASPPAIPP-----PVQAPAPS 147

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 35  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 91

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 92  PPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 139

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 48/133 (36%), Positives = 59/133 (44%), Gaps = 19/133 (14%)
 Frame = +1

Query: 73  LFLCML-FLSSAAPILGCGTCGKPV-PKKHKP-SKKPGKPV---KPPGIVP--PIVKPPG 228
           L+LC+  F++   P++       P  P   KP +  P  PV   KPP   P  P V P  
Sbjct: 2   LWLCIASFINGEEPLVDTVLATAPAAPTTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTK 61

Query: 229 IVPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---P 375
             PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV   P
Sbjct: 62  PTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVATPP 121

Query: 376 VLNPPSTPTPTTP 414
           V  PP    P +P
Sbjct: 122 VAAPPVAVPPASP 134

[58][TOP]
>UniRef100_O24300 PtxA protein n=1 Tax=Pisum sativum RepID=O24300_PEA
          Length = 352

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/97 (45%), Positives = 54/97 (55%), Gaps = 9/97 (9%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIV-PPIVKPPVILPPVT----VPPVTVPPIT 306
           VPK   P+  P    KPP + PPIV PP +  PP+VKPPV+ PP      V PVT P I 
Sbjct: 85  VPKP--PAVHPPHVPKPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPVVPVTPPYIP 142

Query: 307 VPPVVKPTLPPIPGVTPILPPV----PVLNPPSTPTP 405
            PP+V P   P+P V P+ PP     P++ PP  P P
Sbjct: 143 KPPIVFPPHVPLPPVVPVTPPYVPKPPIVFPPHVPLP 179

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 42/104 (40%), Positives = 55/104 (52%), Gaps = 17/104 (16%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIV-PPIV--------KPPVILPP-VTVPPV-- 288
           P  H P   P    KPP + PP+VKPP +  PP+V        KPP++ PP V +PPV  
Sbjct: 100 PVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPVVPVTPPYIPKPPIVFPPHVPLPPVVP 159

Query: 289 -TVPPITVPPVVKPTLPPIPGVTPILPPV----PVLNPPSTPTP 405
            T P +  PP+V P   P+P V P+ PP     P++ PP  P P
Sbjct: 160 VTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPKPPIVFPPHVPLP 203

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 47/109 (43%), Positives = 58/109 (53%), Gaps = 20/109 (18%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGI-VPPIVKPPGI-VPPIV--------KPPVILPP-VTVP- 282
           PV K     K P  PV PP I  PPIV PP + +PP+V        KPP++ PP V +P 
Sbjct: 121 PVVKPPHVPKPPVVPVTPPYIPKPPIVFPPHVPLPPVVPVTPPYVPKPPIVFPPHVPLPP 180

Query: 283 --PVTVPPITVPPVVKPTLPPIPGVTPI------LPPVPVLNPPSTPTP 405
             PVT P +  PP+V P   P+P V P+      LPPV  + PP  PTP
Sbjct: 181 VVPVTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPLPPVVPVTPPFVPTP 229

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 45/99 (45%), Positives = 57/99 (57%), Gaps = 18/99 (18%)
 Frame = +1

Query: 172 PGKPVKPPGIV-PPIVKPPGI-VPPIV--------KPPVILPP-VTVPPV---TVPPITV 309
           P  PV PP +  PPIV PP + +PP+V        KPP++ PP V +PPV   T P + +
Sbjct: 156 PVVPVTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPL 215

Query: 310 PPVV---KPTLPPIPGVTPILPPVPVLNPPS-TPTPTTP 414
           PPVV    P +P  P +TP  P VPV +PPS TP P  P
Sbjct: 216 PPVVPVTPPFVPTPPIITPPTPTVPVPSPPSETPCPPPP 254

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 47/133 (35%), Positives = 60/133 (45%), Gaps = 20/133 (15%)
 Frame = +1

Query: 67  AYLFLCMLFLSSAAPILGCGTCGKPVPKK------------HKPSKK-----PGKPVKPP 195
           A + + +L LS+   +L C  C  P PK             HKP K      P    KPP
Sbjct: 7   ANVLILLLNLSTLLNVLACPYCPYPSPKPPTHKPPIVKPPVHKPPKPQPCPPPSSSPKPP 66

Query: 196 GIVPP--IVKPPGIVPPIV-KPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
            +  P    KPP + PP V KPP + PP     V  PP+  PP+V P   P P   P++ 
Sbjct: 67  HVPKPPHYPKPPAVHPPHVPKPPAVHPP----HVPKPPVVHPPIVHPPYVPKP---PVVK 119

Query: 367 PVPVLNPPSTPTP 405
           P PV+ PP  P P
Sbjct: 120 P-PVVKPPHVPKP 131

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 38/88 (43%), Positives = 44/88 (50%), Gaps = 11/88 (12%)
 Frame = +1

Query: 172 PGKPVKPPGIV-PPIVKPPGI----VPPIVKPPVILPPV---TVPPVTVPPITVPPVVKP 327
           P  PV PP +  PPIV PP +    V P+  P V LPPV   T P V  PPI  PP    
Sbjct: 180 PVVPVTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPLPPVVPVTPPFVPTPPIITPPTPTV 239

Query: 328 TLPPIPGVTPILPPVPVL---NPPSTPT 402
            +P  P  TP  PP P +    PP+ PT
Sbjct: 240 PVPSPPSETPCPPPPPTVVPYPPPAQPT 267

[59][TOP]
>UniRef100_A7J8S8 AGP6 (Fragment) n=1 Tax=Pinus monticola RepID=A7J8S8_PINMO
          Length = 214

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 35/80 (43%), Positives = 42/80 (52%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P  VK P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 72  KPAPPVTAPTKAPPPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 129

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 130 ASPPAIPP-----PVQAPAP 144

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/90 (40%), Positives = 42/90 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P  VK PV  PPV  PPV VPP+  PPV
Sbjct: 66  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPV 120

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 121 AAPPVAVPPASPPAIPP-----PVQAPAPS 145

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 89

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 90  PPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 137

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 48/132 (36%), Positives = 59/132 (44%), Gaps = 19/132 (14%)
 Frame = +1

Query: 76  FLCML-FLSSAAPILGCGTCGKP-VPKKHKP-SKKPGKPV---KPPGIVP--PIVKPPGI 231
           +LC+  F++   P++       P VP   KP +  P  PV   KPP   P  P V P   
Sbjct: 1   WLCIASFINGEEPLVDTVLATAPAVPTTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTKP 60

Query: 232 VPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---PV 378
            PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV   PV
Sbjct: 61  TPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVATPPV 120

Query: 379 LNPPSTPTPTTP 414
             PP    P +P
Sbjct: 121 AAPPVAVPPASP 132

[60][TOP]
>UniRef100_A7J8S3 AGP6 (Fragment) n=1 Tax=Pinus monticola RepID=A7J8S3_PINMO
          Length = 214

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 35/80 (43%), Positives = 42/80 (52%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P  VK P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 72  KPAPPVTAPTKAPPPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 129

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 130 ASPPAIPP-----PVQAPAP 144

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/90 (40%), Positives = 42/90 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P  VK PV  PPV  PPV VPP+  PPV
Sbjct: 66  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPV 120

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 121 AAPPVAVPPASPPAIPP-----PVQAPAPS 145

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 89

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 90  PPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 137

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 47/132 (35%), Positives = 58/132 (43%), Gaps = 19/132 (14%)
 Frame = +1

Query: 76  FLCML-FLSSAAPILGCGTCGKPV-PKKHKP-SKKPGKPV---KPPGIVP--PIVKPPGI 231
           +LC+  F++   P++       P  P   KP +  P  PV   KPP   P  P V P   
Sbjct: 1   WLCIASFINGEEPLVDTVLATAPAAPTTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTKP 60

Query: 232 VPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---PV 378
            PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV   PV
Sbjct: 61  TPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPVKAPVSAPPVATPPVAVPPVATPPV 120

Query: 379 LNPPSTPTPTTP 414
             PP    P +P
Sbjct: 121 AAPPVAVPPASP 132

[61][TOP]
>UniRef100_A7J8R7 AGP6 (Fragment) n=1 Tax=Pinus chiapensis RepID=A7J8R7_9CONI
          Length = 213

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 35/80 (43%), Positives = 42/80 (52%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P  VK P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 72  KPAPPVTAPTKAPPPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 129

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 130 ASPPAIPP-----PVQAPAP 144

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/90 (40%), Positives = 42/90 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P  VK PV  PPV  PPV VPP+  PPV
Sbjct: 66  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPV 120

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 121 AAPPVAVPPASPPAIPP-----PVQAPAPS 145

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 89

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 90  PPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 137

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/101 (39%), Positives = 45/101 (44%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 91

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 92  AVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 132

[62][TOP]
>UniRef100_A7J8R6 AGP6 (Fragment) n=1 Tax=Pinus chiapensis RepID=A7J8R6_9CONI
          Length = 214

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 35/80 (43%), Positives = 42/80 (52%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P  VK P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 72  KPAPPVTAPTKAPPPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 129

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 130 ASPPAIPP-----PVQAPAP 144

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/90 (40%), Positives = 42/90 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P  VK PV  PPV  PPV VPP+  PPV
Sbjct: 66  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--VKAPVSAPPVATPPVAVPPVATPPV 120

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 121 AAPPVAVPPASPPAIPP-----PVQAPAPS 145

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 89

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 90  PPAVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 137

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/101 (39%), Positives = 45/101 (44%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 91

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 92  AVAPVKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 132

[63][TOP]
>UniRef100_B6KAY2 Putative uncharacterized protein n=2 Tax=Toxoplasma gondii
           RepID=B6KAY2_TOXGO
          Length = 1112

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 36/92 (39%), Positives = 41/92 (44%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+  P  P   P   PP   PP + PP   PP + PP   PP   PP   PP V 
Sbjct: 271 PAPSPPAPSPPAPSPSPASAPPAPSPPSVSPPAPSPPSVSPPAPSPPSVSPPAPPPPSVS 330

Query: 325 PTLPPIPGVTPILPPVPVLNPP--STPTPTTP 414
           P  P  P V P  PP P + PP  S P P+ P
Sbjct: 331 PPAPSPPSVAPPAPPAPSVAPPSLSPPAPSPP 362

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 37/92 (40%), Positives = 42/92 (45%), Gaps = 3/92 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           P P    PS     P   PP + PP   PP + PP   PP + PP   PP   PP   PP
Sbjct: 278 PSPPAPSPSPASAPPAPSPPSVSPPAPSPPSVSPPAPSPPSVSPPAPPPPSVSPPAPSPP 337

Query: 316 VVKPTLPPIPGVTP--ILPPVPVLNPPSTPTP 405
            V P  PP P V P  + PP P  +PPS   P
Sbjct: 338 SVAPPAPPAPSVAPPSLSPPAP--SPPSVSPP 367

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 39/105 (37%), Positives = 47/105 (44%), Gaps = 1/105 (0%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKP-PGIVPPIVKPPVILPPV 273
           SSA+ + G      P      P+  P  P  PP   PP   P P   PP   PP + PP 
Sbjct: 248 SSASSLQGVSPVQLP---PSPPAPSPPAP-SPPAPSPPAPSPSPASAPPAPSPPSVSPPA 303

Query: 274 TVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             PP   PP   PP V P  PP P V+P  P  P + PP+ P P+
Sbjct: 304 PSPPSVSPPAPSPPSVSPPAPPPPSVSPPAPSPPSVAPPAPPAPS 348

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/86 (39%), Positives = 36/86 (41%), Gaps = 4/86 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPGKP----VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P    PS  P  P    V PP   PP V PP   PP V PP   PP   PP    P   P
Sbjct: 292 PAPSPPSVSPPAPSPPSVSPPAPSPPSVSPPAPPPPSVSPPAPSPPSVAPPAPPAPSVAP 351

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPP 390
           P + P  P  P V+   PP P   PP
Sbjct: 352 PSLSPPAPSPPSVS---PPAPSAAPP 374

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 34/91 (37%), Positives = 42/91 (46%), Gaps = 1/91 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP-PVTVPPITVPP 315
           P   K K S    + V P  + PP   PP   PP   PP   PP   P P + PP   PP
Sbjct: 241 PPEAKVKSSASSLQGVSPVQL-PP--SPPAPSPPAPSPPAPSPPAPSPSPASAPPAPSPP 297

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            V P  P  P V+P  P  P ++PP+ P P+
Sbjct: 298 SVSPPAPSPPSVSPPAPSPPSVSPPAPPPPS 328

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 35/97 (36%), Positives = 40/97 (41%), Gaps = 5/97 (5%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPV- 273
           +SA P     +   P P    PS  P  P  PP + PP   PP + PP   PP + PP  
Sbjct: 288 ASAPPAPSPPSVSPPAPSP--PSVSPPAP-SPPSVSPPAPPPPSVSPPAPSPPSVAPPAP 344

Query: 274 ----TVPPVTVPPITVPPVVKPTLPPIPGVTPILPPV 372
                 PP   PP   PP V    PP P   P  PPV
Sbjct: 345 PAPSVAPPSLSPPAPSPPSVS---PPAPSAAP--PPV 376

[64][TOP]
>UniRef100_Q40375 Repetitive proline-rich cell wall protein 2 n=1 Tax=Medicago
           truncatula RepID=PRP2_MEDTR
          Length = 371

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 48/112 (42%), Positives = 55/112 (49%), Gaps = 1/112 (0%)
 Frame = +1

Query: 73  LFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVK 249
           L + +LF   A P  G     KP P    P  KP  PV KPP   PP+ KPP   PP+ K
Sbjct: 6   LLVLLLFALFAIP-RGLANYDKP-PVYQPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEK 61

Query: 250 PPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PPV  PPV  PPV  PP+  PPV KP +   P   P +   PV  PP    P
Sbjct: 62  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 113

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 38  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 95

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 96  KPPVEKPPVYKPPVEKPPVYKPPVEKPP 123

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 48  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 105

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 106 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 133

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 58  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 115

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 116 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 143

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 68  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 125

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 126 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 153

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 78  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 135

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 136 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 163

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 88  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 145

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 146 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 173

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 98  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 155

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 156 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 183

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 108 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 165

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 166 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 193

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 118 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 175

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 176 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 203

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 128 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 185

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 186 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 213

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 138 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 195

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 196 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 223

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 148 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 205

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 206 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 233

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/90 (44%), Positives = 47/90 (52%), Gaps = 5/90 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 282 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYK 341

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTP 399
           P +  PP+       PPV   PV  PP  P
Sbjct: 342 PPVEKPPVYKPPVYKPPVEKPPVYGPPHHP 371

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/88 (44%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 158 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 215

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   P+  PP    P
Sbjct: 216 KPPVEKPPVYKPPVEKPPIYKPPVEKPP 243

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 168 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 225

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 226 KPPVEKPPIYKPPVEKPPVYKPPVEKPP 253

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/88 (44%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PP+ 
Sbjct: 178 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIY 235

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 236 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 263

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 41/92 (44%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PPI KPPV  PPV  PPV  PP+  PPV K
Sbjct: 202 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEK 261

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 262 PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 293

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 42/92 (45%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PPI KPP   PP+ KPPV  PPV  PPV  PPI  PPV K
Sbjct: 212 PPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEK 271

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 272 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 303

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/88 (44%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPP+  PPV  PPV  PP+  PPV 
Sbjct: 228 PVEKPPIYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVY 285

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 286 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 313

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 38/88 (43%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PP+  PP+  PPV 
Sbjct: 188 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVY 245

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   P+  PP    P
Sbjct: 246 KPPVEKPPVYKPPVEKPPIYKPPVEKPP 273

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 39/88 (44%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPP+  PPV  PPV  PP+  PPV 
Sbjct: 198 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVY 255

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 256 KPPVEKPPIYKPPVEKPPVYKPPVEKPP 283

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 238 PVEKPPVYKP--PVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 295

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 296 KPPVEKPPVYKPPVEKPPVYKPPVYKPP 323

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/92 (44%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PPI KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 242 PPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 301

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 302 PPVYKPPVEKPPVYKPPVYKPPVYKPPVEKPP 333

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 258 PVEKPPIYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 315

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 316 KPPVYKPPVYKPPVEKPPVYKPPVYKPP 343

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 44/96 (45%), Positives = 50/96 (52%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 278 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEKPPVY 335

Query: 322 KPTL--PPIPGVTPILPPV---PVLNPPSTPTPTTP 414
           KP +  PP+       PPV   PV  PP    P  P
Sbjct: 336 KPPVYKPPVEKPPVYKPPVYKPPVEKPPVYGPPHHP 371

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 40/92 (43%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 262 PPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYK 321

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 322 PPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPP 353

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 37/87 (42%), Positives = 44/87 (50%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 272 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEK 331

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 332 PPVYKPPVYKPPVEKPPVYKPPVYKPP 358

[65][TOP]
>UniRef100_Q3KQ40 LOC100101277 protein n=1 Tax=Xenopus laevis RepID=Q3KQ40_XENLA
          Length = 405

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/92 (43%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVP-PIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           +P+   P   P  PV PP + P P+V PPG+ PP+  PP  LPP  VPP  VPP+   P 
Sbjct: 259 LPRPPMPPGTPAPPVPPPQLPPAPVVPPPGVPPPV--PPPSLPPPGVPPPGVPPMPHNPA 316

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           V P   P PG+ P     P L+PP  P P  P
Sbjct: 317 VPPPGVPPPGIPP-----PGLHPPGVPPPPAP 343

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 48/115 (41%), Positives = 56/115 (48%), Gaps = 13/115 (11%)
 Frame = +1

Query: 109 PILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI--------L 264
           P +  GT   PVP    P + P  PV PP  VPP V PP + PP V PP +        +
Sbjct: 262 PPMPPGTPAPPVP----PPQLPPAPVVPPPGVPPPVPPPSLPPPGVPPPGVPPMPHNPAV 317

Query: 265 PPVTVPPVTVPPITV-PPVVKPTLPPIPGV----TPILPPVPVLNPPSTPTPTTP 414
           PP  VPP  +PP  + PP V P  PP PGV    TP +PP P    P  P P  P
Sbjct: 318 PPPGVPPPGIPPPGLHPPGVPP--PPAPGVPPPPTPGVPPPPAPGVPPPPAPGVP 370

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 40/99 (40%), Positives = 47/99 (47%), Gaps = 8/99 (8%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVP----PIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           VP    P   P   V PPG+ P    P V PPG+ PP + PP + PP  VPP   P +  
Sbjct: 289 VPPPVPPPSLPPPGVPPPGVPPMPHNPAVPPPGVPPPGIPPPGLHPP-GVPPPPAPGVPP 347

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPS----TPTPTTP 414
           PP      PP PGV P  PP P + PP+     P P  P
Sbjct: 348 PPTPGVPPPPAPGVPP--PPAPGVPPPAPGVLPPGPMPP 384

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/86 (40%), Positives = 41/86 (47%)
 Frame = +1

Query: 157 KPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLP 336
           +P      P  PPG +P    PPG   P V PP + P   VPP  VPP   PP + P   
Sbjct: 244 RPPMPENMPPPPPGGLPRPPMPPGTPAPPVPPPQLPPAPVVPPPGVPPPVPPPSLPPPGV 303

Query: 337 PIPGVTPILPPVPVLNPPSTPTPTTP 414
           P PGV P +P  P + PP  P P  P
Sbjct: 304 PPPGVPP-MPHNPAVPPPGVPPPGIP 328

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 37/87 (42%), Positives = 44/87 (50%), Gaps = 4/87 (4%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI--LPPVTVPPVTVPPIT-VP 312
           VP    P       V PPG+ PP + PPG+ PP V PP    +PP   P V  PP   VP
Sbjct: 303 VPPPGVPPMPHNPAVPPPGVPPPGIPPPGLHPPGVPPPPAPGVPPPPTPGVPPPPAPGVP 362

Query: 313 PVVKPTL-PPIPGVTPILPPVPVLNPP 390
           P   P + PP PGV P  P  P++ PP
Sbjct: 363 PPPAPGVPPPAPGVLPPGPMPPMMRPP 389

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 39/95 (41%), Positives = 46/95 (48%), Gaps = 6/95 (6%)
 Frame = +1

Query: 148 KKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT-VPP 315
           K  KP   P  P+ PPGI    PP +      PP+ +     PP  +P   +PP T  PP
Sbjct: 213 KMEKPPTAPTMPLAPPGIKRPAPPAMNGIQTRPPMPENMPPPPPGGLPRPPMPPGTPAPP 272

Query: 316 VVKPTLPPIPGVTP--ILPPVPVLNPPSTPTPTTP 414
           V  P LPP P V P  + PPVP   PPS P P  P
Sbjct: 273 VPPPQLPPAPVVPPPGVPPPVP---PPSLPPPGVP 304

[66][TOP]
>UniRef100_Q6NEX6 Putative conserved membrane protein n=1 Tax=Corynebacterium
            diphtheriae RepID=Q6NEX6_CORDI
          Length = 834

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 37/89 (41%), Positives = 42/89 (47%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP     +  PG  V PP  +PP   PP  VPP+  PPV  PP  VPP  VPP  VPP 
Sbjct: 748  PVPPS---TPAPGAAV-PPAAIPPAAVPPVAVPPVATPPVAAPPTPVPPTPVPPAAVPPA 803

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              P +   P   P  P  P+  PP    P
Sbjct: 804  AAPPVAVPPAAVPPAPQPPMAQPPQAQPP 832

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 39/97 (40%), Positives = 42/97 (43%), Gaps = 4/97 (4%)
 Frame = +1

Query: 136  KPV-PKKHKPSKKPGKPVKPPGIVPPIVKPPG-IVPPIVKPPVILPPVTVPPVTVPPITV 309
            KPV P        P  P  P   VPP    PG  VPP   PP  +PPV VPPV  PP+  
Sbjct: 726  KPVAPAAPAVPAMPAVPAAPATPVPPSTPAPGAAVPPAAIPPAAVPPVAVPPVATPPVAA 785

Query: 310  PPVVKPTLPPIPGVTPILPPVPVLNPPST--PTPTTP 414
            PP   P  P  P   P     PV  PP+   P P  P
Sbjct: 786  PPTPVPPTPVPPAAVPPAAAPPVAVPPAAVPPAPQPP 822

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 29/75 (38%), Positives = 33/75 (44%)
 Frame = +1

Query: 133 GKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           G  VP    P         PP   PP+  PP  VPP   PP  +PP   PPV VPP  VP
Sbjct: 757 GAAVPPAAIPPAAVPPVAVPPVATPPVAAPPTPVPPTPVPPAAVPPAAAPPVAVPPAAVP 816

Query: 313 PVVKPTLPPIPGVTP 357
           P  +P +   P   P
Sbjct: 817 PAPQPPMAQPPQAQP 831

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 31/90 (34%), Positives = 39/90 (43%), Gaps = 3/90 (3%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVK--PPGIVPPIVKPP-VILPPVTVPPVTVPPITVPP 315
           P+  + + KP  P  P     P V   P   VPP    P   +PP  +PP  VPP+ VPP
Sbjct: 718 PETQQAAPKPVAPAAPAVPAMPAVPAAPATPVPPSTPAPGAAVPPAAIPPAAVPPVAVPP 777

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           V  P +   P   P  P  P   PP+   P
Sbjct: 778 VATPPVAAPPTPVPPTPVPPAAVPPAAAPP 807

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 27/75 (36%), Positives = 31/75 (41%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           + P  G       +P    P         PP   PP   PP  VPP   PP   PPV VP
Sbjct: 752 STPAPGAAVPPAAIPPAAVPPVAVPPVATPPVAAPPTPVPPTPVPPAAVPPAAAPPVAVP 811

Query: 283 PVTVPPITVPPVVKP 327
           P  VPP   PP+ +P
Sbjct: 812 PAAVPPAPQPPMAQP 826

[67][TOP]
>UniRef100_Q43414 Proline rich protein (Fragment) n=1 Tax=Cicer arietinum
           RepID=Q43414_CICAR
          Length = 227

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/88 (45%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PP+  PP+  PPV 
Sbjct: 96  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVY 153

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P  TP +   PV  PP    P
Sbjct: 154 KPPIEKPPVYTPPVEKPPVYKPPIEEPP 181

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 40/91 (43%), Positives = 47/91 (51%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PP+  PPV  PP+  PPV 
Sbjct: 116 PVEKPPVYKP--PVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPPVY 173

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           KP +   P   P +   PV  PP    P  P
Sbjct: 174 KPPIEEPPVYKPPVEKPPVYGPPYEKPPHYP 204

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PPI KPP   PP+ KPP+  PPV  PPV  PP+  PPV 
Sbjct: 26  PVEKPPVYKP--PVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVY 83

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 84  KPPVEKPPVYKPPVEKPPVYKPPVEKPP 111

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 56  PVEKPPIYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 113

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 114 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 141

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 39/88 (44%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PP+ 
Sbjct: 86  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIY 143

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 144 KPPVEKPPVYKPPIEKPPVYTPPVEKPP 171

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PPI KPPV  PPV  PP+  PP+  PPV 
Sbjct: 16  PIEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVY 73

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 74  KPPVEKPPVYKPPVEKPPVYKPPVEKPP 101

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/88 (44%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 66  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 123

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   P+  PP    P
Sbjct: 124 KPPVEKPPVYKPPVEKPPIYKPPVEKPP 151

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 76  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 133

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 134 KPPVEKPPIYKPPVEKPPVYKPPIEKPP 161

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 39/88 (44%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  P+ KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 36  PVEKPPVYKP--PIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 93

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 94  KPPVEKPPVYKPPVEKPPVYKPPVEKPP 121

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 46  PIEKPPVYKP--PVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 103

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 104 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 131

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/83 (49%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = +1

Query: 160 PSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLP 336
           P  KP  PV KPP   PPI KPP   PP+ KPPV  PPV  PPV  PPI  PPV KP + 
Sbjct: 1   PVYKP--PVEKPPVYKPPIEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVE 58

Query: 337 PIPGVTPILPPVPVLNPPSTPTP 405
             P   P +   PV  PP    P
Sbjct: 59  KPPIYKPPVEKPPVYKPPVEKPP 81

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 37/88 (42%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  P+ KPP   PP+ KPP   PP+ KPPV  PP+  PPV  PP+  PP+ 
Sbjct: 6   PVEKPPVYKP--PIEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIY 63

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 64  KPPVEKPPVYKPPVEKPPVYKPPVEKPP 91

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 39/88 (44%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPP+  PPV  PPV  PPI  PPV 
Sbjct: 106 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVY 163

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            P +   P   P +   PV  PP    P
Sbjct: 164 TPPVEKPPVYKPPIEEPPVYKPPVEKPP 191

[68][TOP]
>UniRef100_Q40376 Nodulin n=1 Tax=Medicago truncatula RepID=Q40376_MEDTR
          Length = 549

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 39/87 (44%), Positives = 46/87 (52%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P +H P  KP    KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 83  PVEHHPVYKPSVE-KPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHK 141

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +  +P   P +   PV  PP    P
Sbjct: 142 PPVEKLPVYKPSVEKPPVYKPPVEKPP 168

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/92 (41%), Positives = 45/92 (48%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKP-----PGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P  HKP  +     KPP   PP+ KP     P   PP+ KPPV  PPV  PPV  PP+  
Sbjct: 342 PPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEK 401

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PPV KP +  +P   P +   PV  PP    P
Sbjct: 402 PPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPP 433

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 39/87 (44%), Positives = 45/87 (51%), Gaps = 5/87 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP  +     KPP   PP+ KPP    P+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 382 PPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEK 441

Query: 325 PTL--PPIPGVTPILPPV---PVLNPP 390
           P L  P +   T   PP+   PV  PP
Sbjct: 442 PPLHKPQVEKPTEYKPPIEKFPVYKPP 468

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 37/92 (40%), Positives = 45/92 (48%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKP-----PGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P  HKP  +     KPP   PP+ KP     P   PP+ KPPV  PPV  PPV  PP+  
Sbjct: 187 PPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEK 246

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            PV KP +   P   P++   P+  PP   TP
Sbjct: 247 LPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTP 278

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/91 (40%), Positives = 45/91 (49%), Gaps = 2/91 (2%)
 Frame = +1

Query: 139 PVPKK--HKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           PV K   HKP  +     KPP   PP+ K P   PP+ KPPV  P V  PP+  PP+  P
Sbjct: 273 PVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKP 332

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PV KP +   P   P +  +PV  PP    P
Sbjct: 333 PVHKPPVEKPPVHKPPVEKLPVYKPPVEKPP 363

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 33/81 (40%), Positives = 41/81 (50%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP  +     K P   PP+ KPP   P + KPP+  PPV  PPV  PP+  PPV K
Sbjct: 287 PPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHK 346

Query: 325 PTLPPIPGVTPILPPVPVLNP 387
           P +  +P   P +   PV  P
Sbjct: 347 PPVEKLPVYKPPVEKPPVYKP 367

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 36/87 (41%), Positives = 41/87 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   KP        KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+   PV K
Sbjct: 357 PPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYK 416

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 417 PPVEKPPVYKPPVEKPPVHKPPVEKPP 443

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 41/93 (44%), Positives = 47/93 (50%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P  H P +KP  P+ KPP   PP  KPP    P+ KP V  PPV  PPV  PP+  PPV 
Sbjct: 58  PTHHPPIEKP--PIYKPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPPVEKPPVHKPPVE 115

Query: 322 KPTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           KP +  PP+       PPV   PV  PP    P
Sbjct: 116 KPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLP 148

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 36/87 (41%), Positives = 43/87 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP  +     KPP   PP+ KPP   PP+ KPPV  PPV   PV  P +  PPV K
Sbjct: 107 PPVHKPPVE-----KPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYK 161

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P++   PV  PP    P
Sbjct: 162 PPVEKPPLHKPLVEKPPVHKPPVEKPP 188

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 36/92 (39%), Positives = 44/92 (47%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPG-----IVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P  HKP  +     KPP        PP+ KPP   P + KPP+  PPV  PPV  PP+  
Sbjct: 332 PPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEK 391

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PPV KP +   P   P +  +PV  PP    P
Sbjct: 392 PPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPP 423

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 42/96 (43%), Positives = 48/96 (50%), Gaps = 6/96 (6%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPV--KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           PV K H       KP   KPP   PP+ KPP   PP+ KPPV  PPV   PV  PP+  P
Sbjct: 363 PVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKP 422

Query: 313 PVVKPTL--PPIPGVTPILPPV--PVLNPPSTPTPT 408
           PV KP +  PP+       PPV  P L+ P    PT
Sbjct: 423 PVYKPPVEKPPVH-----KPPVEKPPLHKPQVEKPT 453

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/86 (40%), Positives = 42/86 (48%), Gaps = 5/86 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPG-----IVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P  HKP  +     KPP        PP+ KPP   P + KPPV  PPV  PPV  PP+  
Sbjct: 177 PPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEK 236

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNP 387
           PPV KP +  +P   P +   PV  P
Sbjct: 237 PPVHKPPVEKLPVYKPHVEKPPVYKP 262

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/87 (40%), Positives = 42/87 (48%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP  +     KPP   PP+ KPP   PP+ K PV  PPV  PPV  P +  PP+ K
Sbjct: 267 PPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHK 326

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 327 PPVEKPPVHKPPVEKPPVHKPPVEKLP 353

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 36/87 (41%), Positives = 41/87 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   KP        KPP   PP+ KPP   PP+ KPPV  PPV   PV  PP+  PPV K
Sbjct: 307 PPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYK 366

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 367 PHVEKPPLHKPPVEKPPVHKPPVEKPP 393

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 39/92 (42%), Positives = 45/92 (48%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP  +     KPP   PP+ KPP    P+ KPPV  PPV  P V  PP+  PPV K
Sbjct: 322 PPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEK 381

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 382 PPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLP 413

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 35/84 (41%), Positives = 44/84 (52%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP+ +K    K P +  KPP   PP+ K P   PP+ KPPV  P V  PPV  PP+  PP
Sbjct: 171 KPLVEKPPVHKPPVE--KPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPP 228

Query: 316 VVKPTLPPIPGVTPILPPVPVLNP 387
           V KP +   P   P +  +PV  P
Sbjct: 229 VHKPPVEKPPVHKPPVEKLPVYKP 252

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 38/92 (41%), Positives = 45/92 (48%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPS-KKPGK---PV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P  HKP  +KP     P+ KPP   PP+ KPP   PP+   PV  P V  PPV  PP+  
Sbjct: 47  PPVHKPLVEKPPTHHPPIEKPPIYKPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPPVEK 106

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PPV KP +   P   P +   PV  PP    P
Sbjct: 107 PPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPP 138

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 36/87 (41%), Positives = 42/87 (48%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P +  P  KP    KPP   PP+ KPP   P + KPPV  PPV  PPV  PP+   PV K
Sbjct: 143 PVEKLPVYKPSVE-KPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYK 201

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 202 PPVEKPPVYKPHVEKPPVNKPPVEKPP 228

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 36/87 (41%), Positives = 42/87 (48%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP  +     KPP   PP+ KPP   PP+ K PV  PPV  PPV  P +  PPV K
Sbjct: 167 PPLHKPLVE-----KPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNK 221

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 222 PPVEKPPVHKPPVEKPPVHKPPVEKLP 248

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/87 (40%), Positives = 42/87 (48%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP  +     KPP   PP+ KPP   PP+ K PV  P V  PPV  PP+  PP+ K
Sbjct: 117 PPVHKPPVE-----KPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHK 171

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 172 PLVEKPPVHKPPVEKPPVHKPPVEKLP 198

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 39/92 (42%), Positives = 45/92 (48%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV   PV  PPV  PP+  P V K
Sbjct: 312 PPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEK 371

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P L  PP+       PPV   PV  PP    P
Sbjct: 372 PPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPP 403

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 39/96 (40%), Positives = 45/96 (46%), Gaps = 7/96 (7%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPV--KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV-----P 297
           PV K H       KP+  KPP   PP+ K P   PP+ KPPV  PPV  PPV       P
Sbjct: 248 PVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKP 307

Query: 298 PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P+  PPV KP +   P   P +   PV  PP    P
Sbjct: 308 PVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPP 343

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 42/114 (36%), Positives = 52/114 (45%), Gaps = 4/114 (3%)
 Frame = +1

Query: 76  FLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPG--KP--VKPPGIVPPIVKPPGIVPPI 243
           FL +L  +      G     KP P+   P + P   KP   KPP   P + KPP   PPI
Sbjct: 6   FLVLLLFALYIIPQGLANYEKP-PEYKPPVENPQFYKPHIEKPPVHKPLVEKPPTHHPPI 64

Query: 244 VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            KPP+  PPV  PP   PP+   PV KP++   P   P +   PV  PP    P
Sbjct: 65  EKPPIYKPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPPVEKPPVHKPPVEKPP 118

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/89 (40%), Positives = 43/89 (48%), Gaps = 5/89 (5%)
 Frame = +1

Query: 154 HKPSKKPGKPVKPPGIVPP-----IVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           +KPS +     KPP   PP     + KPP   PP+ KPPV  PPV   PV  PP+  PPV
Sbjct: 150 YKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPV 209

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            KP +   P   P +   PV  PP    P
Sbjct: 210 YKPHVEKPPVNKPPVEKPPVHKPPVEKPP 238

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/87 (39%), Positives = 42/87 (48%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP  +     KPP   PP+ K P   P + KPPV  PPV  PP+  P +  PPV K
Sbjct: 127 PPVHKPPVE-----KPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHK 181

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +  +PV  PP    P
Sbjct: 182 PPVEKPPVHKPPVEKLPVYKPPVEKPP 208

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/87 (39%), Positives = 40/87 (45%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   KP        KPP   PP+ KPP   PP+ KPPV  PPV   PV  P +  PPV K
Sbjct: 202 PPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYK 261

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   P+  PP    P
Sbjct: 262 PLVEKPPLHKPPVEKTPMHKPPVEKPP 288

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 36/91 (39%), Positives = 42/91 (46%), Gaps = 2/91 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPV--KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           PV K H       KP   KPP   PP+ KPP   PP+ K PV  P V  PPV  P +  P
Sbjct: 208 PVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKP 267

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P+ KP +   P   P +   PV  PP    P
Sbjct: 268 PLHKPPVEKTPMHKPPVEKPPVHKPPVEKPP 298

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 32/81 (39%), Positives = 40/81 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP  +     KP    PP+ KP    PP+ KPPV   P+  PPV  PP+  PPV K
Sbjct: 237 PPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEK 296

Query: 325 PTLPPIPGVTPILPPVPVLNP 387
           P +  +P   P +   PV  P
Sbjct: 297 PPVEKLPVYKPPVEKPPVYKP 317

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/92 (38%), Positives = 41/92 (44%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPP-----GIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P  HKP  +     KPP        PP+ KP    PP+ KPPV   PV   PV  PP   
Sbjct: 442 PPLHKPQVEKPTEYKPPIEKFPVYKPPVEKPQVHKPPVEKPPVHKSPVKKLPVYKPPAEK 501

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PPV KP +   P   P++   PV  PP    P
Sbjct: 502 PPVYKPPVENPPVHKPLVEKPPVYKPPVEKPP 533

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 40/82 (48%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P+ HKP  +     K P    P+ KPP   PP+ KPPV  PPV  P V  PP+  PPV K
Sbjct: 472 PQVHKPPVEKPPVHKSPVKKLPVYKPPAEKPPVYKPPVENPPVHKPLVEKPPVYKPPVEK 531

Query: 325 PTLPPIPGVTPILPPVPVLNPP 390
           P +   P   P     P+  PP
Sbjct: 532 PPVHKPPFEKP-----PIYTPP 548

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 31/68 (45%), Positives = 36/68 (52%), Gaps = 2/68 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HK   K     KPP   PP+ KPP   PP+ KP V  PPV  PPV  PP+  PP  K
Sbjct: 482 PPVHKSPVKKLPVYKPPAEKPPVYKPPVENPPVHKPLVEKPPVYKPPVEKPPVHKPPFEK 541

Query: 325 PTL--PPI 342
           P +  PP+
Sbjct: 542 PPIYTPPL 549

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 33/87 (37%), Positives = 41/87 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP  +     KPP    P+ KP    PP+ KP V  PP+  PPV   P+  PPV K
Sbjct: 227 PPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEK 286

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +  +PV  PP    P
Sbjct: 287 PPVHKPPVEKPPVEKLPVYKPPVEKPP 313

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 35/88 (39%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGI-VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV+ P +  PP+ KPP    P+ K PV  PP   PPV  PP+  PPV 
Sbjct: 458 PIEKFPVYKP--PVEKPQVHKPPVEKPPVHKSPVKKLPVYKPPAEKPPVYKPPVENPPVH 515

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 516 KPLVEKPPVYKPPVEKPPVHKPPFEKPP 543

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 38/102 (37%), Positives = 46/102 (45%), Gaps = 15/102 (14%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP--------- 297
           P  HKP  +     KPP   PP+ KPP   PP+ KPPV  PP+  P V  P         
Sbjct: 402 PPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEKPPLHKPQVEKPTEYKPPIEK 461

Query: 298 -PITVPPVVKPTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
            P+  PPV KP +  PP+        PV   PV  PP+   P
Sbjct: 462 FPVYKPPVEKPQVHKPPVEKPPVHKSPVKKLPVYKPPAEKPP 503

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 34/87 (39%), Positives = 39/87 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP  +     KPP   P + KP    PPI K PV  PPV  P V  PP+  PPV K
Sbjct: 432 PPVHKPPVE-----KPPLHKPQVEKPTEYKPPIEKFPVYKPPVEKPQVHKPPVEKPPVHK 486

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
             +  +P   P     PV  PP    P
Sbjct: 487 SPVKKLPVYKPPAEKPPVYKPPVENPP 513

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 36/88 (40%), Positives = 42/88 (47%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P    P +KP  PV KPP   PP+ KPP    P+ KP V  PPV  P V  PP+  PPV 
Sbjct: 218 PVNKPPVEKP--PVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVE 275

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           K  +   P   P +   PV  PP    P
Sbjct: 276 KTPMHKPPVEKPPVHKPPVEKPPVEKLP 303

[69][TOP]
>UniRef100_B9S3J8 Repetitive proline-rich cell wall protein 2, putative n=1
           Tax=Ricinus communis RepID=B9S3J8_RICCO
          Length = 299

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 46/115 (40%), Positives = 56/115 (48%), Gaps = 7/115 (6%)
 Frame = +1

Query: 67  AYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGK--PVKPPGIVPPIVKPPGIVPP 240
           A LF+ +L L +    L C  C  P P    P   P K  P  PP + PP    P   PP
Sbjct: 7   ANLFILLLNLGTLLTSLACPYCPYPTPPSKPPPGHPPKYPPRHPPKVKPPFHPKPPKQPP 66

Query: 241 IVKPPVILPP-VTVPPVTVPP-ITVPPVVKPTL---PPIPGVTPILPPVPVLNPP 390
            VKPP   PP V  PP+  PP I  PP+V+P     PP+    P +P  PV+NPP
Sbjct: 67  HVKPPHPKPPHVPKPPIVKPPTIPKPPIVRPPYIPKPPVVNPPPFVPKPPVVNPP 121

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 51/117 (43%), Positives = 59/117 (50%), Gaps = 26/117 (22%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKP----------VKPPGIV-PPIVKPPGI-VPPIV-------KPPVI 261
           P P K  P  KP  P          VKPP I  PPIV+PP I  PP+V       KPPV+
Sbjct: 59  PKPPKQPPHVKPPHPKPPHVPKPPIVKPPTIPKPPIVRPPYIPKPPVVNPPPFVPKPPVV 118

Query: 262 LPP--VTVPPVTVPP--ITVPPVVKPTLPPI--PGVTPILPPVPVLNPP-STPTPTT 411
            PP  V  PPV  PP  +  PP+V P  PP+  P   P +P  PV+ PP   PTP T
Sbjct: 119 NPPPFVPKPPVVNPPPFVPKPPIVYPPNPPVTPPSSPPYIPKPPVVTPPIKPPTPPT 175

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 39/97 (40%), Positives = 49/97 (50%), Gaps = 7/97 (7%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVP--PIVKPPGIVP--PIVKPP--VILPPVTVPPVTVPPI 303
           P  + P   P  PV  PP  VP  P+V PP  VP  PIV PP   + PP + P +  PP+
Sbjct: 104 PVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFVPKPPIVYPPNPPVTPPSSPPYIPKPPV 163

Query: 304 TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP+  PT P +P   P++ P     P   PTP TP
Sbjct: 164 VTPPIKPPTPPTLPPKPPVITP-----PTKPPTPETP 195

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 43/95 (45%), Positives = 49/95 (51%), Gaps = 5/95 (5%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPI--VKPPGIVPPIVKPPVILPPVTVP-PVTVPPITVP 312
           VPK    +  P  P KPP + PP   V PP   P I KPPV+ PP+  P P T+PP   P
Sbjct: 124 VPKPPVVNPPPFVP-KPPIVYPPNPPVTPPSSPPYIPKPPVVTPPIKPPTPPTLPP--KP 180

Query: 313 PVV-KPTLPPIPGV-TPILPPVPVLNPPSTPTPTT 411
           PV+  PT PP P    P  PP PV  PP  P   T
Sbjct: 181 PVITPPTKPPTPETPCPPPPPPPVPCPPPPPKQET 215

[70][TOP]
>UniRef100_Q9LM00 Putative arabinogalactan protein n=1 Tax=Pinus taeda
           RepID=Q9LM00_PINTA
          Length = 236

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 72  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 129

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 130 PVAAPPVAVPPASPPAIPP-----PVQAPAP 155

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 44  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 103

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 104 VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 156

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 46/136 (33%), Positives = 59/136 (43%), Gaps = 18/136 (13%)
 Frame = +1

Query: 61  IHAYLFLCML-FLSSAAPILGCGTCGKPV-PKKHKPSKKPGKPV---KPPGIVP--PIVK 219
           ++  ++LC+  F +   P++       P  P    P+  P  PV   KPP   P  P V 
Sbjct: 8   VYMLVWLCIASFCNGEEPVVDTVLATAPAAPTAKPPTTAPAAPVSTPKPPTTTPVAPAVA 67

Query: 220 PPGIVPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV- 372
           P    PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV 
Sbjct: 68  PTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVA 127

Query: 373 --PVLNPPSTPTPTTP 414
             PV  PP    P +P
Sbjct: 128 TPPVAAPPVAVPPASP 143

[71][TOP]
>UniRef100_Q5IE20 Arabinogalactan protein (Fragment) n=1 Tax=Pinus taeda
           RepID=Q5IE20_PINTA
          Length = 166

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 69  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 126

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 127 PVAAPPVAVPPASPPAIPP-----PVQAPAP 152

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 41  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 100

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 101 VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 153

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 46/136 (33%), Positives = 59/136 (43%), Gaps = 18/136 (13%)
 Frame = +1

Query: 61  IHAYLFLCML-FLSSAAPILGCGTCGKPV-PKKHKPSKKPGKPV---KPPGIVP--PIVK 219
           ++  ++LC+  F +   P++       P  P    P+  P  PV   KPP   P  P V 
Sbjct: 5   VYMLVWLCIASFCNGEEPVVDTVLATAPAAPTAKPPTTAPAAPVSTPKPPTTTPVAPAVA 64

Query: 220 PPGIVPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV- 372
           P    PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV 
Sbjct: 65  PTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVA 124

Query: 373 --PVLNPPSTPTPTTP 414
             PV  PP    P +P
Sbjct: 125 TPPVAAPPVAVPPASP 140

[72][TOP]
>UniRef100_Q5IE16 Arabinogalactan protein (Fragment) n=1 Tax=Pinus taeda
           RepID=Q5IE16_PINTA
          Length = 166

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 69  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 126

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 127 PVAAPPVAVPPASPPAIPP-----PVQAPAP 152

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 41  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 100

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 101 VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 153

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 46/136 (33%), Positives = 59/136 (43%), Gaps = 18/136 (13%)
 Frame = +1

Query: 61  IHAYLFLCML-FLSSAAPILGCGTCGKPV-PKKHKPSKKPGKPV---KPPGIVP--PIVK 219
           ++  ++LC+  F +   P++       P  P    P+  P  PV   KPP   P  P V 
Sbjct: 5   VYMLVWLCIASFSNGEEPVVDTVLATAPAAPTAKPPTTAPAAPVSTPKPPTTTPVAPAVA 64

Query: 220 PPGIVPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV- 372
           P    PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV 
Sbjct: 65  PTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVA 124

Query: 373 --PVLNPPSTPTPTTP 414
             PV  PP    P +P
Sbjct: 125 TPPVAAPPVAVPPASP 140

[73][TOP]
>UniRef100_Q5IE14 Arabinogalactan protein (Fragment) n=1 Tax=Pinus taeda
           RepID=Q5IE14_PINTA
          Length = 166

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 69  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 126

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 127 PVAAPPVAVPPASPPAIPP-----PVQAPAP 152

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 32/93 (34%), Positives = 40/93 (43%), Gaps = 3/93 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP---PVTVPPVTVPPITV 309
           P     KP+      V P    PP+  P    PP  KPP + P   PV+ PPV  PP+ V
Sbjct: 61  PAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAV 120

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           PPV  P +   P   P   P  +  P   P P+
Sbjct: 121 PPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 153

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 33/95 (34%), Positives = 40/95 (42%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP---PITV 309
           P P    P      P KP   V P V P    PP+  P    PP T PP   P   P++ 
Sbjct: 51  PKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSA 110

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 111 PPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 145

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 46/136 (33%), Positives = 59/136 (43%), Gaps = 18/136 (13%)
 Frame = +1

Query: 61  IHAYLFLCML-FLSSAAPILGCGTCGKPV-PKKHKPSKKPGKPV---KPPGIVP--PIVK 219
           ++  ++LC+  F +   P++       P  P    P+  P  PV   KPP   P  P V 
Sbjct: 5   VYMLVWLCIASFSNGEEPVVDTVLATAPAAPTAKPPTTTPAAPVSTPKPPTTTPVAPAVA 64

Query: 220 PPGIVPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV- 372
           P    PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV 
Sbjct: 65  PTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVA 124

Query: 373 --PVLNPPSTPTPTTP 414
             PV  PP    P +P
Sbjct: 125 TPPVAAPPVAVPPASP 140

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 36/106 (33%), Positives = 45/106 (42%), Gaps = 5/106 (4%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPVT 276
           AAP+    T   P      P+  P KP  P  P + P    PP   P    PP   PP  
Sbjct: 45  AAPV---STPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAV 101

Query: 277 VP---PVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            P   PV+ PP+  PPV  P +   P   P +  VP  +PP+ P P
Sbjct: 102 APAKAPVSAPPVATPPVAVPPVATPPVAAPPV-AVPPASPPAIPPP 146

[74][TOP]
>UniRef100_Q5IE00 Arabinogalactan protein (Fragment) n=1 Tax=Pinus taeda
           RepID=Q5IE00_PINTA
          Length = 166

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 69  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 126

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 127 PVAAPPVAVPPASPPAIPP-----PVQAPAP 152

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 41  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 100

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 101 VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 153

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 46/137 (33%), Positives = 58/137 (42%), Gaps = 20/137 (14%)
 Frame = +1

Query: 64  HAYLFLCML---FLSSAAPILGCGTCGKPV-PKKHKPSKKPGKPV---KPPGIVP--PIV 216
           + Y+ +C+    F +   P++       P  P    P+  P  PV   KPP   P  P V
Sbjct: 4   YVYMLVCLCIASFCNGEEPVVDTVLATAPAAPTAKPPTTAPAAPVSTPKPPTTTPVAPAV 63

Query: 217 KPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV 372
            P    PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV
Sbjct: 64  APTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPV 123

Query: 373 ---PVLNPPSTPTPTTP 414
              PV  PP    P +P
Sbjct: 124 ATPPVAAPPVAVPPASP 140

[75][TOP]
>UniRef100_Q5IDZ6 Arabinogalactan protein (Fragment) n=1 Tax=Pinus taeda
           RepID=Q5IDZ6_PINTA
          Length = 166

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 69  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 126

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 127 PVAAPPVAVPPASPPAIPP-----PVQAPAP 152

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 41  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 100

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 101 VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 153

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 46/136 (33%), Positives = 59/136 (43%), Gaps = 18/136 (13%)
 Frame = +1

Query: 61  IHAYLFLCML-FLSSAAPILGCGTCGKPV-PKKHKPSKKPGKPV---KPPGIVP--PIVK 219
           ++  ++LC+  F +   P++       P  P    P+  P  PV   KPP   P  P V 
Sbjct: 5   VYMLVWLCIASFSNGEEPVVETVLATAPAAPTAKPPTTAPAAPVSTPKPPTTTPVAPAVA 64

Query: 220 PPGIVPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV- 372
           P    PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV 
Sbjct: 65  PTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVA 124

Query: 373 --PVLNPPSTPTPTTP 414
             PV  PP    P +P
Sbjct: 125 TPPVAAPPVAVPPASP 140

[76][TOP]
>UniRef100_Q5IDY2 Arabinogalactan protein (Fragment) n=1 Tax=Pinus taeda
           RepID=Q5IDY2_PINTA
          Length = 166

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 69  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 126

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 127 PVAAPPVAVPPASPPAIPP-----PVQAPAP 152

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 41  TTAPAAPVSTPKPPATTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 100

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 101 VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 153

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 46/136 (33%), Positives = 59/136 (43%), Gaps = 18/136 (13%)
 Frame = +1

Query: 61  IHAYLFLCML-FLSSAAPILGCGTCGKPV-PKKHKPSKKPGKPV---KPPGIVP--PIVK 219
           ++  ++LC+  F +   P++       P  P    P+  P  PV   KPP   P  P V 
Sbjct: 5   VYMLVWLCIASFSNGEEPVVDTVLATAPAAPTAKAPTTAPAAPVSTPKPPATTPVAPAVA 64

Query: 220 PPGIVPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV- 372
           P    PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV 
Sbjct: 65  PTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVA 124

Query: 373 --PVLNPPSTPTPTTP 414
             PV  PP    P +P
Sbjct: 125 TPPVAAPPVAVPPASP 140

[77][TOP]
>UniRef100_Q5IDX6 Arabinogalactan protein (Fragment) n=1 Tax=Pinus taeda
           RepID=Q5IDX6_PINTA
          Length = 166

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 69  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 126

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 127 PVAAPPVAVPPASPPAIPP-----PVQAPAP 152

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 41  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 100

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 101 VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 153

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 46/137 (33%), Positives = 58/137 (42%), Gaps = 20/137 (14%)
 Frame = +1

Query: 64  HAYLFLCML---FLSSAAPILGCGTCGKPV-PKKHKPSKKPGKPV---KPPGIVP--PIV 216
           + Y+ +C+    F +   P++       P  P    P+  P  PV   KPP   P  P V
Sbjct: 4   YVYMLVCLCIASFCNGEEPLVDTVLATAPAAPTAKPPTTAPAAPVSTPKPPTTTPVAPAV 63

Query: 217 KPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV 372
            P    PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV
Sbjct: 64  APTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPV 123

Query: 373 ---PVLNPPSTPTPTTP 414
              PV  PP    P +P
Sbjct: 124 ATPPVAAPPVAVPPASP 140

[78][TOP]
>UniRef100_Q4VT19 Arabinogalactan protein (Fragment) n=1 Tax=Pinus echinata
           RepID=Q4VT19_PINEC
          Length = 153

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 62  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 119

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 120 PVAAPPVAVPPASPPAIPP-----PVQAPAP 145

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 34  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 93

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 94  VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 146

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 46/132 (34%), Positives = 57/132 (43%), Gaps = 18/132 (13%)
 Frame = +1

Query: 73  LFLCML-FLSSAAPILGCGTCGKPV-PKKHKPSKKPGKPV---KPPGIVP--PIVKPPGI 231
           ++LC+  F +   P++       P  P    P+  P  PV   KPP   P  P V P   
Sbjct: 2   VWLCIAXFXNGEEPVVDTVLATAPAAPTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTKP 61

Query: 232 VPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---PV 378
            PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV   PV
Sbjct: 62  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPV 121

Query: 379 LNPPSTPTPTTP 414
             PP    P +P
Sbjct: 122 AAPPVAVPPASP 133

[79][TOP]
>UniRef100_Q4VT18 Arabinogalactan protein (Fragment) n=1 Tax=Pinus ponderosa
           RepID=Q4VT18_PINPO
          Length = 153

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 62  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 119

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 120 PVAAPPVAVPPASPPAIPP-----PVQAPAP 145

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 34  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 93

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 94  VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 146

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 46/132 (34%), Positives = 57/132 (43%), Gaps = 18/132 (13%)
 Frame = +1

Query: 73  LFLCML-FLSSAAPILGCGTCGKPV-PKKHKPSKKPGKPV---KPPGIVP--PIVKPPGI 231
           ++LC+  F +   P++       P  P    P+  P  PV   KPP   P  P V P   
Sbjct: 2   VWLCIASFSNGEEPVVDTVLATAPAAPTAKAPTTAPAAPVSTPKPPTTTPVAPAVAPTKP 61

Query: 232 VPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---PV 378
            PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV   PV
Sbjct: 62  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPV 121

Query: 379 LNPPSTPTPTTP 414
             PP    P +P
Sbjct: 122 AAPPVAVPPASP 133

[80][TOP]
>UniRef100_Q4VT17 Arabinogalactan protein (Fragment) n=1 Tax=Pinus radiata
           RepID=Q4VT17_PINRA
          Length = 165

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 74  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 131

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 132 PVAAPPVAVPPASPPAIPP-----PVQAPAP 157

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 46  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 105

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 106 VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 158

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 46/126 (36%), Positives = 53/126 (42%), Gaps = 16/126 (12%)
 Frame = +1

Query: 85  MLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPV---KPPGIVP--PIVKPPGIVPPI-- 243
           +L  + AAP     T     P    P+  P  PV   KPP   P  P V P    PP+  
Sbjct: 20  VLATAPAAPTAKPPTTAPAAPTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAP 79

Query: 244 -VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---PVLNPPST 396
            V P    PPVT P    PP T PP V P   P+   P  TP   +PPV   PV  PP  
Sbjct: 80  AVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVA 139

Query: 397 PTPTTP 414
             P +P
Sbjct: 140 VPPASP 145

[81][TOP]
>UniRef100_Q4VT15 Arabinogalactan protein (Fragment) n=1 Tax=Pinus merkusii
           RepID=Q4VT15_9CONI
          Length = 160

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 69  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 126

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 127 PVAAPPVAVPPASPPAIPP-----PVQAPAP 152

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 32/93 (34%), Positives = 40/93 (43%), Gaps = 3/93 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP---PVTVPPVTVPPITV 309
           P     KP+      V P    PP+  P    PP  KPP + P   PV+ PPV  PP+ V
Sbjct: 61  PAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAV 120

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           PPV  P +   P   P   P  +  P   P P+
Sbjct: 121 PPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 153

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 43/121 (35%), Positives = 49/121 (40%), Gaps = 11/121 (9%)
 Frame = +1

Query: 85  MLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPI---VKPP 255
           +L  + AAP         P P    P      P KP   V P V P    PP+   V P 
Sbjct: 20  VLATAPAAPTAPAAPVSTPKPPTTTPVAPAVAPTKPXPPVAPAVAPTKPAPPVAPAVAPT 79

Query: 256 VILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTT 411
              PPVT P    PP T PP V P   P+   P  TP   +PPV   PV  PP    P +
Sbjct: 80  KPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPAS 139

Query: 412 P 414
           P
Sbjct: 140 P 140

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 34/94 (36%), Positives = 41/94 (43%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPG-KPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP---PITVP 312
           P K  P   P   P KP   V P V P    PP+  P    PP T PP   P   P++ P
Sbjct: 52  PTKPXPPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAP 111

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PV  P +   P  TP +   PV  PP++P    P
Sbjct: 112 PVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 145

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 34/95 (35%), Positives = 42/95 (44%), Gaps = 5/95 (5%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPVTVP---PVTVPP 300
           KP P    P+  P KP  P  P + P    PP   P    PP   PP   P   PV+ PP
Sbjct: 54  KPXPPV-APAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPP 112

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           +  PPV  P +   P   P +  VP  +PP+ P P
Sbjct: 113 VATPPVAVPPVATPPVAAPPV-AVPPASPPAIPPP 146

[82][TOP]
>UniRef100_Q4VT08 Arabinogalactan protein (Fragment) n=1 Tax=Pinus monophylla
           RepID=Q4VT08_9CONI
          Length = 166

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 75  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 132

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 133 PVAAPPVAVPPASPPAIPP-----PVQAPAP 158

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 47  TTAPAAPVSTPKPPTTTPVAPAAAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 106

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 107 VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 159

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 33/95 (34%), Positives = 40/95 (42%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP---PITV 309
           P P    P      P KP   V P V P    PP+  P    PP T PP   P   P++ 
Sbjct: 57  PKPPTTTPVAPAAAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSA 116

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 117 PPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 151

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 39/101 (38%), Positives = 43/101 (42%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVPPI-----VKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P        KP   V P V P    PPVT P    PP T PP
Sbjct: 46  PTTAPAAPVSTPKPPTTTPVAPAAAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 105

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 106 AVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 146

[83][TOP]
>UniRef100_Q4VT07 Arabinogalactan protein (Fragment) n=1 Tax=Pinus remota
           RepID=Q4VT07_9CONI
          Length = 167

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 76  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 133

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 134 PVAAPPVAVPPASPPAIPP-----PVQAPAP 159

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 48  TTAPAAPVSTPKPPTTTPVAPAAAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 107

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 108 VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 160

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 33/95 (34%), Positives = 40/95 (42%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP---PITV 309
           P P    P      P KP   V P V P    PP+  P    PP T PP   P   P++ 
Sbjct: 58  PKPPTTTPVAPAAAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSA 117

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 118 PPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 152

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 39/101 (38%), Positives = 43/101 (42%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVPPI-----VKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P        KP   V P V P    PPVT P    PP T PP
Sbjct: 47  PTTAPAAPVSTPKPPTTTPVAPAAAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 106

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 107 AVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 147

[84][TOP]
>UniRef100_Q4VT06 Arabinogalactan protein (Fragment) n=1 Tax=Pinus longaeva
           RepID=Q4VT06_PINLO
          Length = 167

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 76  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 133

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 134 PVAAPPVAVPPASPPAIPP-----PVQAPAP 159

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 39/106 (36%), Positives = 46/106 (43%), Gaps = 4/106 (3%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPP 270
           A P+       KP P    P+  P KP  P        PP  KPP + P   K PV  PP
Sbjct: 63  APPVAPAAAPTKPAPPV-APAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPP 119

Query: 271 VTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           V  PPV VPP+  PPV  P +   P   P +PP     P   P P+
Sbjct: 120 VATPPVAVPPVATPPVAAPPVAVPPASPPAIPP-----PVQAPAPS 160

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/108 (33%), Positives = 46/108 (42%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           +  P+       KP P    P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 49  TTTPVAPAAAPTKPAPPV-APAAAPTKPAPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 104

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 105 PPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 152

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 40/113 (35%), Positives = 45/113 (39%), Gaps = 8/113 (7%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P        KP   V P V P    PPVT 
Sbjct: 35  TTAPAAPVSTPKPPTTTPVAPAAAPTKPAPPVAPAAAPTKPAPPVAPAVAPTKPAPPVTA 94

Query: 280 PPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
           P    PP T PP V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 95  PTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 147

[85][TOP]
>UniRef100_Q4VT05 Arabinogalactan protein (Fragment) n=1 Tax=Pinus nelsonii
           RepID=Q4VT05_9CONI
          Length = 180

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 89  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 146

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 147 PVAAPPVAVPPASPPAIPP-----PVQAPAP 172

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 61  TTAPAAPVSTPKPPTTTPVAPAAAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 120

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 121 VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 173

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 33/95 (34%), Positives = 40/95 (42%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP---PITV 309
           P P    P      P KP   V P V P    PP+  P    PP T PP   P   P++ 
Sbjct: 71  PKPPTTTPVAPAAAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSA 130

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 131 PPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 165

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 39/101 (38%), Positives = 43/101 (42%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVPPI-----VKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P        KP   V P V P    PPVT P    PP T PP
Sbjct: 60  PTTAPAAPVSTPKPPTTTPVAPAAAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 119

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 120 AVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 160

[86][TOP]
>UniRef100_B4G234 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4G234_MAIZE
          Length = 304

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 55/139 (39%), Positives = 63/139 (45%), Gaps = 42/139 (30%)
 Frame = +1

Query: 124 GTCGKPVPKKHKPSKKPGKP----------VKPPGIVPPIVKPP-GIV--PPIVKPPVIL 264
           G+ G P P  H+P K P  P           +PP + PP+V PP G V  PP+ +PPV+ 
Sbjct: 73  GSTGYPAPG-HQPPKSPSYPPVVGPPKGPVTRPPVMRPPVVGPPKGPVTRPPVTRPPVVG 131

Query: 265 PPVTVPP--------------VTVPPITVPPVVKP------TLPPIPGVTPILPPV---P 375
           PPVT PP              VT PPIT PP   P      T PPI G     PPV   P
Sbjct: 132 PPVTYPPITGPPTTPPVVGPPVTYPPITGPPTTPPVVGPPVTYPPITGPPATTPPVTGPP 191

Query: 376 VLNPP------STPTPTTP 414
           V  PP      STP P  P
Sbjct: 192 VTYPPGGGGGSSTPCPPPP 210

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 45/116 (38%), Positives = 55/116 (47%), Gaps = 14/116 (12%)
 Frame = +1

Query: 109 PILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPV----T 276
           P++     G P     +P       V PP   PPI  PP   PP+V PPV  PP+    T
Sbjct: 105 PVMRPPVVGPPKGPVTRPPVTRPPVVGPPVTYPPITGPP-TTPPVVGPPVTYPPITGPPT 163

Query: 277 VPPVTVPPITVPPVVKP--TLPPIPGVTPILPP-------VPVLNPPS-TPTPTTP 414
            PPV  PP+T PP+  P  T PP+ G     PP        P   PPS TPTP++P
Sbjct: 164 TPPVVGPPVTYPPITGPPATTPPVTGPPVTYPPGGGGGSSTPCPPPPSPTPTPSSP 219

[87][TOP]
>UniRef100_A7J8T1 AGP6 (Fragment) n=1 Tax=Pinus monticola RepID=A7J8T1_PINMO
          Length = 214

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 61  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 118

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 119 PVAAPPVAVPPASPPAIPP-----PVQAPAP 144

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 92

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 93  VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 145

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/101 (39%), Positives = 45/101 (44%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 91

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 92  AVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 132

[88][TOP]
>UniRef100_A7J8R5 AGP6 (Fragment) n=1 Tax=Pinus ayacahuite RepID=A7J8R5_9CONI
          Length = 214

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 36/91 (39%), Positives = 44/91 (48%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 61  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 118

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 119 PVAAPPVAVPPASPPAIPP-----PVQAPAP 144

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 92

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P +   P   P   P  +  P   P P+
Sbjct: 93  VAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 145

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/101 (39%), Positives = 45/101 (44%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 91

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 92  AVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 132

[89][TOP]
>UniRef100_UPI00019259C5 PREDICTED: hypothetical protein n=1 Tax=Hydra magnipapillata
           RepID=UPI00019259C5
          Length = 496

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 40/93 (43%), Positives = 49/93 (52%), Gaps = 4/93 (4%)
 Frame = +1

Query: 148 KKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPV---ILPPVTVPPVTVPPITVPPV 318
           KK +  KK  KP +PP    P+  P  + PP+V PPV   +LPP   PP  V P  VPP 
Sbjct: 368 KKDEKDKKKKKPKQPP---VPVAAPAPVAPPMVPPPVYPPVLPPFPPPPPPVYPPPVPPP 424

Query: 319 VKPTLPPIPG-VTPILPPVPVLNPPSTPTPTTP 414
           V P  PP P  + P+ PP P+  PP  P P  P
Sbjct: 425 VPPPFPPPPAPLPPVPPPAPLPPPPPPPVPPPP 457

[90][TOP]
>UniRef100_Q8AVV0 Sf3a2-prov protein n=1 Tax=Xenopus laevis RepID=Q8AVV0_XENLA
          Length = 405

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 47/110 (42%), Positives = 55/110 (50%), Gaps = 8/110 (7%)
 Frame = +1

Query: 109 PILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPI----VKPPGIVPPIVKP----PVIL 264
           P +  GT   PVP    P + P  PV PPG+ PP+    + PPG+ PP V P    P + 
Sbjct: 262 PPMPPGTPAPPVP----PPQLPPAPVPPPGVPPPVPPPSLPPPGVPPPGVPPLPPNPSVP 317

Query: 265 PPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   PP   PP   PP V P  PP PGV P  PP P + PP TP    P
Sbjct: 318 PPGVPPPGIRPPGIPPPGVPP--PPTPGVPP--PPAPGVPPPPTPGVPPP 363

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 41/95 (43%), Positives = 48/95 (50%), Gaps = 5/95 (5%)
 Frame = +1

Query: 136 KPVPK-----KHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPP 300
           +PVP      + +P      P +PPG +P    PPG   P V PP  LPP  VPP  VPP
Sbjct: 232 RPVPPAINGMQTRPPMPENMPPRPPGGLPMPPMPPGTPAPPVPPPQ-LPPAPVPPPGVPP 290

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              PP + P   P PGV P LPP P + PP  P P
Sbjct: 291 PVPPPSLPPPGVPPPGVPP-LPPNPSVPPPGVPPP 324

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVP----PIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           VP    P   P   V PPG+ P    P V PPG+ PP ++PP I PP  VPP   P +  
Sbjct: 288 VPPPVPPPSLPPPGVPPPGVPPLPPNPSVPPPGVPPPGIRPPGI-PPPGVPPPPTPGVPP 346

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP      PP PGV P  PP P + PP  P    P
Sbjct: 347 PPAPGVPPPPTPGVPP--PPAPGVPPPPAPGVLPP 379

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 38/88 (43%), Positives = 43/88 (48%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           VP    P   P   V PPG+ PP ++PPGI PP V PP   P   VPP   P +  PP  
Sbjct: 302 VPPPGVPPLPPNPSVPPPGVPPPGIRPPGIPPPGVPPP---PTPGVPPPPAPGVPPPPTP 358

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
               PP PGV P  PP P + PP    P
Sbjct: 359 GVPPPPAPGVPP--PPAPGVLPPGPMPP 384

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 38/97 (39%), Positives = 46/97 (47%), Gaps = 8/97 (8%)
 Frame = +1

Query: 148 KKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIV-----KPPVILPPVTVPPVTVPPI 303
           K  KP + P  P  PPG+   VPP +      PP+      +PP  LP   +PP T  P 
Sbjct: 213 KTEKPPQAPTLPPAPPGVKRPVPPAINGMQTRPPMPENMPPRPPGGLPMPPMPPGTPAPP 272

Query: 304 TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP + P   P PGV P +PP P L PP  P P  P
Sbjct: 273 VPPPQLPPAPVPPPGVPPPVPP-PSLPPPGVPPPGVP 308

[91][TOP]
>UniRef100_O49870 Extensin (Fragment) n=1 Tax=Hordeum vulgare RepID=O49870_HORVU
          Length = 330

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 43/104 (41%), Positives = 45/104 (43%), Gaps = 14/104 (13%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKP-VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPP---- 300
           KPVPK   P+ KP  P  KPP   PP  KPP   PP  KPP   PP   PP   PP    
Sbjct: 200 KPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKP 259

Query: 301 -ITVPPVVKPTLPPIPGVTPILP--------PVPVLNPPSTPTP 405
               PP  KP  P  P   P  P        P P  + P TPTP
Sbjct: 260 ATPTPPAHKPPTPTPPAHKPTTPTPAYKPPTPTPPADKPPTPTP 303

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 42/106 (39%), Positives = 43/106 (40%), Gaps = 13/106 (12%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVP--------PIVKPPGIVPPIVKPPVILPPVTVPPVT 291
           KP PK   P+ KP   V PP   P        P   PP   PP   PP   PP   PP  
Sbjct: 178 KPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAY 237

Query: 292 VPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPT-----PTTP 414
            PP   PP  KP  P  P   P  P  P   PP TPT     PTTP
Sbjct: 238 KPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPP-TPTPPAHKPTTP 282

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 39/99 (39%), Positives = 42/99 (42%), Gaps = 9/99 (9%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVP-PIVKPPGIVP--------PIVKPPVILPPVTVPPV 288
           KP PK   P+ KP   V PP   P P V PP   P        P   PP   PP   PP 
Sbjct: 167 KPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPPA 226

Query: 289 TVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
             PP   PP  KP  P  P   P   P P  + P+TPTP
Sbjct: 227 QKPPTPTPPAYKPPTPTPPAHKP-PTPTPPAHKPATPTP 264

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 41/102 (40%), Positives = 46/102 (45%), Gaps = 9/102 (8%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPG------IVPPIVKP-PGIVPPIVKP-PVILPPVTVPPVT 291
           KP PK   P+ KP   V PP       + PP  KP P + PP  KP P + PP   P   
Sbjct: 134 KPAPKVSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPK 193

Query: 292 VPPITVPPVVKPTLP-PIPGVTPILPPVPVLNPPSTPTPTTP 414
           V P    PV KP+ P P P   P  PP P       PTPT P
Sbjct: 194 VSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPP 235

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 40/104 (38%), Positives = 45/104 (43%), Gaps = 14/104 (13%)
 Frame = +1

Query: 136 KPVPKKHKP------SKKPGKPV----KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPP 285
           KP P  +KP      ++KP  P     KPP   PP  KPP   PP  KP    PP   PP
Sbjct: 211 KPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPP 270

Query: 286 VTVPPITVP----PVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              PP   P    P  KP  P  P   P   P P+ + P TPTP
Sbjct: 271 TPTPPAHKPTTPTPAYKPPTPTPPADKP-PTPTPLAHKPPTPTP 313

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 39/103 (37%), Positives = 44/103 (42%), Gaps = 10/103 (9%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPG------IVPPIVKP-PGIVPPIVKP-PVILPPVTVPPVT 291
           KP PK   P+ KP   V PP       + PP  KP P + PP  KP P + PP   P   
Sbjct: 123 KPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPK 182

Query: 292 VPPITVPPVVKPTLPPIPGVTPILPPVPVLNPP--STPTPTTP 414
           V P    P  K + P    V    PP P   PP    PTPT P
Sbjct: 183 VSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPP 225

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 43/115 (37%), Positives = 53/115 (46%), Gaps = 11/115 (9%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPV-KP-PGIVPPIVKP-PGIVPPIVKP-PVILPP 270
           A P     T  KP P  +KP+ K   P  KP P + PP  KP P + PP  KP P + PP
Sbjct: 94  APPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPP 153

Query: 271 VTVP-PVTVPPI--TVPPVVKPTLPPIPGVT-PILPPVPVLNPPS---TPTPTTP 414
              P P   PP     P V  P   P P V+ P   P P ++PP+    P P+ P
Sbjct: 154 AYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPP 208

[92][TOP]
>UniRef100_Q4VT09 Arabinogalactan protein (Fragment) n=1 Tax=Pinus strobus
           RepID=Q4VT09_PINST
          Length = 154

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/80 (42%), Positives = 41/80 (51%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 74  KPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 131

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 132 ASPPAIPP-----PVQAPAP 146

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/90 (38%), Positives = 41/90 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P   K PV  PPV  PPV VPP+  PPV
Sbjct: 68  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPV 122

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 123 AAPPVAVPPASPPAIPP-----PVQAPAPS 147

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 35  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 91

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 92  PPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 139

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 48/133 (36%), Positives = 58/133 (43%), Gaps = 19/133 (14%)
 Frame = +1

Query: 73  LFLCML-FLSSAAPILGCGTCGKPV-PKKHKP-SKKPGKPV---KPPGIVP--PIVKPPG 228
           L+LC+  F +   P++       P  P   KP +  P  PV   KPP   P  P V P  
Sbjct: 2   LWLCIASFSNGEKPLVDTVLATAPAAPTTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTK 61

Query: 229 IVPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---P 375
             PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV   P
Sbjct: 62  PTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPP 121

Query: 376 VLNPPSTPTPTTP 414
           V  PP    P +P
Sbjct: 122 VAAPPVAVPPASP 134

[93][TOP]
>UniRef100_A7J8T5 AGP6 (Fragment) n=1 Tax=Pinus strobus RepID=A7J8T5_PINST
          Length = 212

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/80 (42%), Positives = 41/80 (51%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 72  KPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 129

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 130 ASPPAIPP-----PVQAPAP 144

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/90 (38%), Positives = 41/90 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P   K PV  PPV  PPV VPP+  PPV
Sbjct: 66  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPV 120

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 121 AAPPVAVPPASPPAIPP-----PVQAPAPS 145

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 89

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 90  PPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 137

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/101 (39%), Positives = 45/101 (44%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 91

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 92  AVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 132

[94][TOP]
>UniRef100_A7J8T2 AGP6 (Fragment) n=1 Tax=Pinus strobus RepID=A7J8T2_PINST
          Length = 212

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/80 (42%), Positives = 41/80 (51%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 72  KPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 129

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 130 ASPPAIPP-----PVQAPAP 144

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/90 (38%), Positives = 41/90 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P   K PV  PPV  PPV VPP+  PPV
Sbjct: 66  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPV 120

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 121 AAPPVAVPPASPPAIPP-----PVQAPAPS 145

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 89

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 90  PPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 137

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/101 (39%), Positives = 45/101 (44%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 91

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 92  AVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 132

[95][TOP]
>UniRef100_A7J8T0 AGP6 (Fragment) n=1 Tax=Pinus monticola RepID=A7J8T0_PINMO
          Length = 213

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/80 (42%), Positives = 41/80 (51%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 72  KPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 129

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 130 ASPPAIPP-----PVQAPAP 144

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/90 (38%), Positives = 41/90 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P   K PV  PPV  PPV VPP+  PPV
Sbjct: 66  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPV 120

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 121 AAPPVAVPPASPPAIPP-----PVQAPAPS 145

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 89

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 90  PPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 137

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/101 (39%), Positives = 45/101 (44%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 91

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 92  AVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 132

[96][TOP]
>UniRef100_A7J8S6 AGP6 (Fragment) n=1 Tax=Pinus monticola RepID=A7J8S6_PINMO
          Length = 214

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/80 (42%), Positives = 41/80 (51%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 72  KPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 129

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 130 ASPPAIPP-----PVQAPAP 144

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/90 (38%), Positives = 41/90 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P   K PV  PPV  PPV VPP+  PPV
Sbjct: 66  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPV 120

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 121 AAPPVAVPPASPPAIPP-----PVQAPAPS 145

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 89

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 90  PPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 137

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/101 (39%), Positives = 45/101 (44%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 91

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 92  AVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 132

[97][TOP]
>UniRef100_A7J8R1 AGP6 (Fragment) n=4 Tax=Strobus RepID=A7J8R1_9CONI
          Length = 212

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/80 (42%), Positives = 41/80 (51%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 72  KPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 129

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 130 ASPPAIPP-----PVQAPAP 144

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/90 (38%), Positives = 41/90 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P   K PV  PPV  PPV VPP+  PPV
Sbjct: 66  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPV 120

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 121 AAPPVAVPPASPPAIPP-----PVQAPAPS 145

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 89

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 90  PPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 137

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/101 (39%), Positives = 45/101 (44%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 91

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 92  AVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 132

[98][TOP]
>UniRef100_Q4VT12 Arabinogalactan protein (Fragment) n=1 Tax=Pinus flexilis
           RepID=Q4VT12_9CONI
          Length = 154

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 34/80 (42%), Positives = 41/80 (51%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 74  KPXPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 131

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 132 ASPPAIPP-----PVQAPAP 146

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 34/90 (37%), Positives = 40/90 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           PV     P+K       P    PP  KPP + P   K PV  PPV  PPV VPP+  PPV
Sbjct: 65  PVAPAVAPTKPXPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPV 122

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 123 AAPPVAVPPASPPAIPP-----PVQAPAPS 147

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 35  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPXPPVTAPTKAPPPTTK 91

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 92  PPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 139

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 48/133 (36%), Positives = 58/133 (43%), Gaps = 19/133 (14%)
 Frame = +1

Query: 73  LFLCML-FLSSAAPILGCGTCGKPV-PKKHKP-SKKPGKPV---KPPGIVP--PIVKPPG 228
           L+LC+  F +   P++       P  P   KP +  P  PV   KPP   P  P V P  
Sbjct: 2   LWLCIASFSNGEEPLVDTVLATAPAAPTTAKPPTTAPAAPVSTPKPPTTTPVAPAVAPTK 61

Query: 229 IVPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTP--ILPPV---P 375
             PP+   V P    PPVT P    PP T PP V P   P+   P  TP   +PPV   P
Sbjct: 62  PTPPVAPAVAPTKPXPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVPPVATPP 121

Query: 376 VLNPPSTPTPTTP 414
           V  PP    P +P
Sbjct: 122 VAAPPVAVPPASP 134

[99][TOP]
>UniRef100_P08012 Repetitive proline-rich cell wall protein 1 n=1 Tax=Glycine max
           RepID=PRP1_SOYBN
          Length = 256

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 41/92 (44%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PPI KPPV  PPV  PPV  PP+  PPV K
Sbjct: 81  PPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYK 140

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 141 PPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 172

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 40/92 (43%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 106 PPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYK 165

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 166 PPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 197

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 36/87 (41%), Positives = 44/87 (50%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPP+  PPV  PPV  PP+  PPV K
Sbjct: 41  PPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYK 100

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 101 PPVYKPPVYKPPIEKPPVYKPPVYKPP 127

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 37/87 (42%), Positives = 44/87 (50%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 141 PPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEK 200

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 201 PPIYKPPVYKPPIEKPPVYKPPVYKPP 227

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 38/87 (43%), Positives = 43/87 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PPI  PPV K
Sbjct: 151 PPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPPVYK 210

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 211 PPIEKPPVYKPPVYKPPVYKPPVYKPP 237

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 45/93 (48%), Positives = 49/93 (52%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PPI KPPV  PPV  PPV  PP+  PPV 
Sbjct: 47  PVEKPPVYKP--PVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVY 104

Query: 322 KPTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           KP +  PPI       PPV   PV  PP    P
Sbjct: 105 KPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPP 137

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 40/92 (43%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PPI KPP   PP+ KPPV  PPV  PPV  PP+  PP+ K
Sbjct: 56  PPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEK 115

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 116 PPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPP 147

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 34/87 (39%), Positives = 44/87 (50%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPP+  PPV  PP+  PP+  PPV K
Sbjct: 166 PPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPPVYK 225

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   P+  PP    P
Sbjct: 226 PPVYKPPVYKPPVKKPPIYKPPYPKYP 252

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 37/87 (42%), Positives = 43/87 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 101 PPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYK 160

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 161 PPVYKPPVYKPPVEKPPVYKPPVYKPP 187

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/87 (41%), Positives = 43/87 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 126 PPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYK 185

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   P+  PP    P
Sbjct: 186 PPVYKPPVYKPPVEKPPIYKPPVYKPP 212

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 38/87 (43%), Positives = 43/87 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PPI KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 91  PPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEK 150

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 151 PPVYKPPVYKPPVYKPPVYKPPVEKPP 177

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 37/87 (42%), Positives = 43/87 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 131 PPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYK 190

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 191 PPVYKPPVEKPPIYKPPVYKPPIEKPP 217

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 36/87 (41%), Positives = 43/87 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+ KPPV  PPV  PP+  PP+  PPV K
Sbjct: 66  PPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYK 125

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 126 PPVYKPPVYKPPVYKPPVYKPPVEKPP 152

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 37/87 (42%), Positives = 43/87 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 116 PPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEK 175

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 176 PPVYKPPVYKPPVYKPPVYKPPVEKPP 202

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 39/92 (42%), Positives = 46/92 (50%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+ KPPV  PP+  PPV  PP+  PPV K
Sbjct: 71  PPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYK 130

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 131 PPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 162

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 35/87 (40%), Positives = 43/87 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+ KPPV  PPV  PP+  PP+  PP+ K
Sbjct: 156 PPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPPVYKPPIEK 215

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 216 PPVYKPPVYKPPVYKPPVYKPPVKKPP 242

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/87 (41%), Positives = 43/87 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+ KPPV  PPV  PP+  PP+  PPV K
Sbjct: 31  PPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEK 90

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 91  PPVYKPPVYKPPVYKPPVYKPPIEKPP 117

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 33/73 (45%), Positives = 38/73 (52%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           KPP   PP+  PP   PP+ KPPV  PPV  PPV  PP+  PPV KP +   P   P + 
Sbjct: 30  KPPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVE 89

Query: 367 PVPVLNPPSTPTP 405
             PV  PP    P
Sbjct: 90  KPPVYKPPVYKPP 102

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 29/71 (40%), Positives = 35/71 (49%)
 Frame = +1

Query: 193 PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPV 372
           P ++    KPP   PP+  PPV  PPV  PPV  PP+  PPV KP +   P   P +   
Sbjct: 22  PQVLADYEKPPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKP 81

Query: 373 PVLNPPSTPTP 405
           PV  PP    P
Sbjct: 82  PVYKPPVEKPP 92

[100][TOP]
>UniRef100_C6TGK1 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TGK1_SOYBN
          Length = 161

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 36/87 (41%), Positives = 44/87 (50%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPP+  PPV  PPV  PP+  PPV K
Sbjct: 41  PPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYK 100

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 101 PPVYKPPVYKPPIEKPPVYKPPVYKPP 127

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 45/93 (48%), Positives = 49/93 (52%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PPI KPPV  PPV  PPV  PP+  PPV 
Sbjct: 47  PVEKPPVYKP--PVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVY 104

Query: 322 KPTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           KP +  PPI       PPV   PV  PP    P
Sbjct: 105 KPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPP 137

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/92 (43%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PPI KPP   PP+ KPPV  PPV  PPV  PP+  PP+ K
Sbjct: 56  PPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEK 115

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 116 PPVYKPPVYKPPVYKPPVYKPPVYKPPVKKPP 147

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 35/87 (40%), Positives = 43/87 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+ KPPV  PP+  PPV  PP+  PPV K
Sbjct: 71  PPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYK 130

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   P+  PP    P
Sbjct: 131 PPVYKPPVYKPPVKKPPIYKPPYPKYP 157

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/87 (41%), Positives = 43/87 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP        KPP   PP+ KPP   PP+ KPPV  PPV  PP+  PP+  PPV K
Sbjct: 31  PPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEK 90

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   P   P +   PV  PP    P
Sbjct: 91  PPVYKPPVYKPPVYKPPVYKPPIEKPP 117

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 33/73 (45%), Positives = 38/73 (52%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           KPP   PP+  PP   PP+ KPPV  PPV  PPV  PP+  PPV KP +   P   P + 
Sbjct: 30  KPPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVE 89

Query: 367 PVPVLNPPSTPTP 405
             PV  PP    P
Sbjct: 90  KPPVYKPPVYKPP 102

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 29/71 (40%), Positives = 35/71 (49%)
 Frame = +1

Query: 193 PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPV 372
           P ++    KPP   PP+  PPV  PPV  PPV  PP+  PPV KP +   P   P +   
Sbjct: 22  PQVLADYEKPPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKP 81

Query: 373 PVLNPPSTPTP 405
           PV  PP    P
Sbjct: 82  PVYKPPVEKPP 92

[101][TOP]
>UniRef100_A0N015 Vegetative cell wall protein n=1 Tax=Chlamydomonas incerta
           RepID=A0N015_CHLIN
          Length = 613

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 41/95 (43%), Positives = 45/95 (47%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P   +P   P  P  PP   PP   PP  VPP   PP  LPP  VPP   PP  VPP 
Sbjct: 72  PTPPSPEPPS-PAPPSPPPSPAPPSPAPPSPVPPSPAPP--LPPSPVPPSPAPPSPVPPS 128

Query: 319 VKPTLPPI---PGVTPILPPVPVLNPPSTPTPTTP 414
             P +PP    P   P LPP PV   P+ P P +P
Sbjct: 129 PAPPVPPSPAPPSPAPPLPPSPVPPSPAPPAPPSP 163

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 39/92 (42%), Positives = 43/92 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  PV PP   PP+  PP  VPP   PP  +PP   PPV  PP   PP 
Sbjct: 87  PPPSPAPPSPAPPSPV-PPSPAPPL--PPSPVPPSPAPPSPVPPSPAPPV--PPSPAPPS 141

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P LPP P      PP P    P +P P +P
Sbjct: 142 PAPPLPPSPVPPSPAPPAPPSPAPPSPAPPSP 173

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 39/98 (39%), Positives = 43/98 (43%), Gaps = 8/98 (8%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP  VPP   PP  +PP  VPP   PP + PP   
Sbjct: 255 PSPAPPSPVPPSPPIPPSPAPPSPAPPSPVPPSPAPPSPVPPSPVPPSPPPPPSPPPPPP 314

Query: 325 PT--------LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P         +PP P   P  PP P   PPS P+P  P
Sbjct: 315 PRPPFPANTPMPPSPPSPPPSPPPPT--PPSPPSPPPP 350

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/92 (41%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP  VPP 
Sbjct: 48  PAPPSPPPSPLPPSPA-PPSPAPPSPTPPSPEPPSPAPPSP-PPSPAPPSPAPPSPVPPS 105

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P LPP P      PP PV   P+ P P +P
Sbjct: 106 PAPPLPPSPVPPSPAPPSPVPPSPAPPVPPSP 137

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 40/107 (37%), Positives = 45/107 (42%), Gaps = 1/107 (0%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT 276
           S A P+        P P    PS  P  P +PP  VPP   PP  VPP   PP  +PP  
Sbjct: 209 SPAPPVPPSPAPPSPAPPSPPPSPAPPSP-EPPSPVPPSPAPPSPVPPSPAPPSPVPPSP 267

Query: 277 -VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            +PP   PP   PP   P  P  P   P  P  P   PP +P P  P
Sbjct: 268 PIPPSPAPPSPAPPSPVPPSPAPPSPVPPSPVPPSPPPPPSPPPPPP 314

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 45/116 (38%), Positives = 47/116 (40%), Gaps = 24/116 (20%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVK------PPVILPPVTVPPV 288
           P P    PS +P  PV P    P  VPP   PP  VPP         PP   PP  VPP 
Sbjct: 228 PPPSPAPPSPEPPSPVPPSPAPPSPVPPSPAPPSPVPPSPPIPPSPAPPSPAPPSPVPPS 287

Query: 289 TVPPITV--------------PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP  V              PP   P  PP P  TP +PP P   PPS P PT P
Sbjct: 288 PAPPSPVPPSPVPPSPPPPPSPPPPPPPRPPFPANTP-MPPSPPSPPPSPPPPTPP 342

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 41/114 (35%), Positives = 49/114 (42%)
 Frame = +1

Query: 73  LFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP 252
           L + + F++SA      G      P    PS  P  P  PP  +PP   PP   PP   P
Sbjct: 17  LIVALAFVASANAQCVPGGIFNCPPSPAPPSPAPPSP--PPSPLPPSPAPPSPAPPSPTP 74

Query: 253 PVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   PP   PP + PP   PP   P  P  P   P LPP PV   P+ P+P  P
Sbjct: 75  PSPEPPSPAPP-SPPPSPAPPSPAPPSPVPPSPAPPLPPSPVPPSPAPPSPVPP 127

 Score = 57.8 bits (138), Expect(2) = 2e-08
 Identities = 36/85 (42%), Positives = 38/85 (44%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           PS  P  P  PP  VPP   PP  VPP   PP   PP  +PP  VPP   PP      PP
Sbjct: 112 PSPVPPSPA-PPSPVPPSPAPP--VPPSPAPPSPAPP--LPPSPVPPSPAPPAPPSPAPP 166

Query: 340 IPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  PP P    P  P+P  P
Sbjct: 167 SP-APPSPPPSPAPPSPEPPSPAPP 190

 Score = 24.3 bits (51), Expect(2) = 2e-08
 Identities = 15/45 (33%), Positives = 20/45 (44%)
 Frame = +2

Query: 50  SPQRSMLTSSSACSSSPLPPPFSVAAPAVSPSQRNTSPAKSPASP 184
           SP  S L  S A  S   P P   +    SP+  +  P+ +P SP
Sbjct: 52  SPPPSPLPPSPAPPSPAPPSPTPPSPEPPSPAPPSPPPSPAPPSP 96

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 35/92 (38%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PPV
Sbjct: 158 PAPPSPAPPS-PAPPSPPPSPAPPSPEPPSPAPP--SPPSPAPPSPAPPSPAPPSPAPPV 214

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                PP P   P  PP P    P  P+P  P
Sbjct: 215 PPSPAPPSP-APPSPPPSPAPPSPEPPSPVPP 245

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  P   VPP   PP   PP   PP   PP   PP  VPP   PP   
Sbjct: 198 PSPAPPSPAPPSPAPP---VPPSPAPPSPAPPS-PPPSPAPPSPEPPSPVPPSPAPPSPV 253

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  PP+P    P +P P +P
Sbjct: 254 PPSPAPPSPVPPSPPIPPSPAPPSPAPPSP 283

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 37/93 (39%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP- 315
           P P    PS  P  P +PP   PP   PP   PP   PP   PP   PPV  PP   PP 
Sbjct: 168 PAPPSPPPSPAPPSP-EPPSPAPP--SPPSPAPPSPAPPSPAPPSPAPPV--PPSPAPPS 222

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P+ PP P      PP PV   P+ P+P  P
Sbjct: 223 PAPPSPPPSPAPPSPEPPSPVPPSPAPPSPVPP 255

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 41/95 (43%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPI---TV 309
           PVP    PS  P  PV PP   PP+  PP   PP   PP  LPP  VPP   PP      
Sbjct: 114 PVP----PSPAPPSPV-PPSPAPPV--PPSPAPPSPAPP--LPPSPVPPSPAPPAPPSPA 164

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P  PP P   P  P  P   PPS P+P  P
Sbjct: 165 PPSPAPPSPP-PSPAPPSPEPPSPAPPSPPSPAPP 198

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 38/93 (40%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           PVP    P   P  PV PP   PP   PP   PP+  PP   PP   PP  +PP  VPP 
Sbjct: 101 PVPPSPAPPLPPS-PV-PPSPAPPSPVPPSPAPPV--PPSPAPPSPAPP--LPPSPVPPS 154

Query: 319 VKPTLPPIPGVTPILPPVPVLNP-PSTPTPTTP 414
             P  PP P      PP P  +P P +P P +P
Sbjct: 155 PAPPAPPSPAPPSPAPPSPPPSPAPPSPEPPSP 187

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 35/95 (36%), Positives = 39/95 (41%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139 PVPKKHKPSK--KPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           PVP    P     P  P   P   PP   PP   PP   PP   PP   PP   PP   P
Sbjct: 150 PVPPSPAPPAPPSPAPPSPAPPSPPPSPAPPSPEPPSPAPPS--PPSPAPPSPAPPSPAP 207

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNP-PSTPTPTTP 414
           P   P +PP P      PP P  +P P +P P +P
Sbjct: 208 PSPAPPVPPSPAPPSPAPPSPPPSPAPPSPEPPSP 242

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 36/92 (39%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           PVP    P   P  P+ PP  VPP   PP   PP   PP   PP + PP   PP   PP 
Sbjct: 132 PVPPSPAPPS-PAPPL-PPSPVPPSPAPPA--PPSPAPPSPAPP-SPPPSPAPPSPEPPS 186

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P      PP P    P+ P P +P
Sbjct: 187 PAPPSPPSPAPPSPAPPSPAPPSPAPPVPPSP 218

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 35/92 (38%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           PVP    P   P     PP   PP+  PP  VPP   PP   PP   PP   PP + PP 
Sbjct: 124 PVPPSPAPPVPPSPA--PPSPAPPL--PPSPVPPSPAPPA--PPSPAPPSPAPP-SPPPS 176

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P  P   P  PP P    P+ P+P  P
Sbjct: 177 PAPPSPEPPSPAPPSPPSPAPPSPAPPSPAPP 208

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 38/93 (40%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV-PPVTVPPITVPP 315
           PVP    PS  P  PV PP  VPP   PP   PP   PP   PP     P+   P + PP
Sbjct: 283 PVP----PSPAPPSPV-PPSPVPPSPPPPPSPPP---PPPPRPPFPANTPMPPSPPSPPP 334

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P   P   PVP    P TP P +P
Sbjct: 335 SPPPPTPPSPPSPPPPSPVPPSPAPGTPVPPSP 367

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 32/91 (35%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   P    PP   PP +  P  +PP   PP 
Sbjct: 327 PSPPSPPPSPPPPTPPSPPSPPPPSPVPPSPAPGTPVPPSPAPP-SPAPSPIPPSPAPPS 385

Query: 319 VKPT-LPPIPGVTPILPPVPVLNPPSTPTPT 408
             P+  PP P  +P   P P  +P  +P+P+
Sbjct: 386 PPPSPAPPSPSPSPSPSPSPSPSPSPSPSPS 416

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 31/84 (36%), Positives = 38/84 (45%), Gaps = 1/84 (1%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPT-LP 336
           P   P  P  PP   PP   PP   PP   PP   P   VPP   PP   P  + P+  P
Sbjct: 326 PPSPPSPPPSPPPPTPP--SPPSPPPPSPVPPSPAPGTPVPPSPAPPSPAPSPIPPSPAP 383

Query: 337 PIPGVTPILPPVPVLNPPSTPTPT 408
           P P  +P  PP P  +P  +P+P+
Sbjct: 384 PSPPPSP-APPSPSPSPSPSPSPS 406

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 32/93 (34%), Positives = 34/93 (36%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGK-PVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           P P    P   P   P  P    PP   PP   PP   PP   PP   PP   PP    P
Sbjct: 137 PAPPSPAPPLPPSPVPPSPAPPAPPSPAPPSPAPPS-PPPSPAPPSPEPPSPAPPSPPSP 195

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                 PP P      PPVP    P +P P +P
Sbjct: 196 APPSPAPPSPAPPSPAPPVPPSPAPPSPAPPSP 228

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 36/103 (34%), Positives = 41/103 (39%), Gaps = 11/103 (10%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVP--------PIVKPPGIVPPIVKPPVI-LPPVTVPPVT 291
           PVP    P   P  P  PP   P        P+   P   PP   PP    PP   PP  
Sbjct: 293 PVPPSPVPPSPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPPPPTPPSPPSPPPPSP 352

Query: 292 VPPITVP--PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           VPP   P  PV     PP P  +PI P     +PP +P P +P
Sbjct: 353 VPPSPAPGTPVPPSPAPPSPAPSPIPPSPAPPSPPPSPAPPSP 395

[102][TOP]
>UniRef100_Q4VT11 Arabinogalactan protein (Fragment) n=1 Tax=Pinus lambertiana
           RepID=Q4VT11_PINLA
          Length = 150

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 35/91 (38%), Positives = 43/91 (47%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  P
Sbjct: 59  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATP 116

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           P   PP+ VPP   P +PP     P+  P P
Sbjct: 117 PXAAPPVAVPPASPPAIPP-----PVQAPAP 142

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 37/113 (32%), Positives = 46/113 (40%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 31  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 90

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ VPPV  P     P   P   P  +  P   P P+
Sbjct: 91  VAPAKAPVSAPPVATPPVAVPPVATPPXAAPPVAVPPASPPAIPPPVQAPAPS 143

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 36/93 (38%), Positives = 39/93 (41%), Gaps = 11/93 (11%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 30  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 89

Query: 316 VVKPTLPPIPGVTPILPPV---PVLNPPSTPTP 405
            V P   P+       PPV   PV  PP    P
Sbjct: 90  AVAPAKAPVSAPPVATPPVAVPPVATPPXAAPP 122

[103][TOP]
>UniRef100_P13993 Repetitive proline-rich cell wall protein 2 n=2 Tax=Glycine max
           RepID=PRP2_SOYBN
          Length = 230

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 63  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 120

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 121 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 148

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 73  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 130

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 131 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 158

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 83  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 140

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 141 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 168

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 93  PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 150

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 151 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 178

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 103 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 160

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 161 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 188

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/88 (45%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 113 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 170

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   PV  PP    P
Sbjct: 171 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 198

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/88 (44%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 123 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 180

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP +   P   P +   P+  PP    P
Sbjct: 181 KPPVEKPPVYKPPVEKPPIYKPPVEKPP 208

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 42/93 (45%), Positives = 48/93 (51%), Gaps = 3/93 (3%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 133 PVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 190

Query: 322 KPTLPPIPGVTPILPPVPVLNPP--STPTPTTP 414
           KP +   P   P +   PV  PP    P P  P
Sbjct: 191 KPPVEKPPIYKPPVEKPPVYKPPYGKPPYPKYP 223

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 41/92 (44%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PPI KPPV  PPV  PPV  PP+  PPV K
Sbjct: 27  PPVYKPPTEKPPVYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEK 86

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 87  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 118

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/92 (44%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PPI KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 37  PPVYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 96

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 97  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 128

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 40/92 (43%), Positives = 47/92 (51%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 47  PPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 106

Query: 325 PTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           P +  PP+       PPV   PV  PP    P
Sbjct: 107 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 138

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 37/89 (41%), Positives = 44/89 (49%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 137 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 196

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           P +   P   P +   P   PP    P T
Sbjct: 197 PPIYKPPVEKPPVYKPPYGKPPYPKYPPT 225

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 28/71 (39%), Positives = 34/71 (47%)
 Frame = +1

Query: 193 PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPV 372
           P ++     PP   PP  KPPV  PPV  PPV  PP+  PP+ KP +   P   P +   
Sbjct: 18  PQVLANYENPPVYKPPTEKPPVYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKP 77

Query: 373 PVLNPPSTPTP 405
           PV  PP    P
Sbjct: 78  PVYKPPVEKPP 88

[104][TOP]
>UniRef100_UPI00006A03EC MGC69562 protein. n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00006A03EC
          Length = 413

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/106 (37%), Positives = 49/106 (46%), Gaps = 12/106 (11%)
 Frame = +1

Query: 133 GKPVPKKHKPSKKPGKPVKPPGIVPPI----VKPPGIVPPIVKPPVI--------LPPVT 276
           G P P    P   P   V PPG+ PP+    + PPG+ PP V PP          +PP  
Sbjct: 267 GTPAPPVPPPQLPPAPVVPPPGVHPPVPPPSLPPPGVPPPGVPPPPPNPAVPPPGVPPPG 326

Query: 277 VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           +PP  +PP  VPP   P +PP P     LPP P + PP  P    P
Sbjct: 327 IPPPGIPPPGVPPPPAPGVPPPPAPGVPLPPTPGVPPPPAPGVPPP 372

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 44/95 (46%), Positives = 50/95 (52%), Gaps = 1/95 (1%)
 Frame = +1

Query: 133 GKPVPKKHKPSKKPGKPVKPPGIVP-PIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           G P+P    P   P  PV PP + P P+V PPG+ PP V PP  LPP  VPP  VP    
Sbjct: 258 GLPMPPM--PPGTPAPPVPPPQLPPAPVVPPPGVHPP-VPPP-SLPPPGVPPPGVP---- 309

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P +PP PGV P   P P + PP  P P  P
Sbjct: 310 PPPPNPAVPP-PGVPPPGIPPPGIPPPGVPPPPAP 343

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 44/114 (38%), Positives = 53/114 (46%), Gaps = 11/114 (9%)
 Frame = +1

Query: 106 APILGCGTCGKPVPKKHKPSK---KPGKPVKPPG--IVPPIVKPPGIVPPIVKPPVILPP 270
           AP++       PVP    P      PG P  PP   + PP V PPGI PP + PP + PP
Sbjct: 281 APVVPPPGVHPPVPPPSLPPPGVPPPGVPPPPPNPAVPPPGVPPPGIPPPGIPPPGVPPP 340

Query: 271 VT--VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPS----TPTPTTP 414
               VPP   P + +PP      PP PGV P  PP P + PP+     P P  P
Sbjct: 341 PAPGVPPPPAPGVPLPPTPGVPPPPAPGVPP--PPAPGVPPPAPGVLPPGPMPP 392

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 41/95 (43%), Positives = 49/95 (51%), Gaps = 12/95 (12%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI--LPPVTVPPVTVPPIT-VP 312
           VP    P   P   V PPG+ PP + PPGI PP V PP    +PP   P V +PP   VP
Sbjct: 303 VPPPGVPPPPPNPAVPPPGVPPPGIPPPGIPPPGVPPPPAPGVPPPPAPGVPLPPTPGVP 362

Query: 313 PVVKPTL--PPIPGVTP----ILPP---VPVLNPP 390
           P   P +  PP PGV P    +LPP    P++ PP
Sbjct: 363 PPPAPGVPPPPAPGVPPPAPGVLPPGPMPPMMRPP 397

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 38/98 (38%), Positives = 45/98 (45%), Gaps = 5/98 (5%)
 Frame = +1

Query: 136 KPVPK-----KHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPP 300
           +PVP      + +P      P  PPG +P    PPG   P V PP + P   VPP  V P
Sbjct: 232 RPVPPAINGIQARPPMPENMPPPPPGGLPMPPMPPGTPAPPVPPPQLPPAPVVPPPGVHP 291

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              PP + P   P PGV P  PP P + PP  P P  P
Sbjct: 292 PVPPPSLPPPGVPPPGVPP-PPPNPAVPPPGVPPPGIP 328

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 40/99 (40%), Positives = 47/99 (47%), Gaps = 10/99 (10%)
 Frame = +1

Query: 148 KKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVK-----PPVILPPVTVPPVTVPPI 303
           K  KP + P  P  PPG+   VPP +      PP+ +     PP  LP   +PP T P  
Sbjct: 213 KMEKPPQAPTLPPAPPGVKRPVPPAINGIQARPPMPENMPPPPPGGLPMPPMPPGT-PAP 271

Query: 304 TVPPVVKPTLP--PIPGVTPILPPVPVLNPPSTPTPTTP 414
            VPP   P  P  P PGV P +PP P L PP  P P  P
Sbjct: 272 PVPPPQLPPAPVVPPPGVHPPVPP-PSLPPPGVPPPGVP 309

[105][TOP]
>UniRef100_Q9LFU8 Proline-rich protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9LFU8_ARATH
          Length = 401

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/94 (41%), Positives = 52/94 (55%), Gaps = 16/94 (17%)
 Frame = +1

Query: 172 PGKPVKPPGIVPPIVKPPGIVPPIVKP-PVILPPVTVPPV----------TVPPITVPPV 318
           P  P+ PP I+PP    P I  P + P P+I  P ++PP+          T+P +  PP 
Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPT 321

Query: 319 VKPTLPPIPGV-----TPILPPVPVLNPPSTPTP 405
             PTLPPIP +      P+LPPVP++NPPS P P
Sbjct: 322 --PTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPP 353

[106][TOP]
>UniRef100_B6TWU3 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6TWU3_MAIZE
          Length = 304

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 57/139 (41%), Positives = 64/139 (46%), Gaps = 42/139 (30%)
 Frame = +1

Query: 124 GTCGKPVPKKHKPSKKPGKP----------VKPPGIVPPIVKPP-GIV--PPIVKPPVIL 264
           G+ G P P  H+P K P  P           +PP   PP+V PP G V  PP+ +PPV+ 
Sbjct: 73  GSTGYPAPG-HQPPKSPSYPPVVGPPKGPVTRPPVTRPPVVGPPKGPVTRPPVTRPPVVG 131

Query: 265 PPVTVPP--------------VTVPPITVPP----VVKP--TLPPIPGVTPILPPV---P 375
           PPVT PP              VT PPIT PP    VV P  T PPI G     PPV   P
Sbjct: 132 PPVTYPPITGPPTTPPVVGPPVTYPPITGPPTTPXVVGPPVTYPPITGPPATTPPVTGPP 191

Query: 376 VLNPP------STPTPTTP 414
           V  PP      STP P  P
Sbjct: 192 VTYPPGGGGGSSTPCPPPP 210

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 45/116 (38%), Positives = 54/116 (46%), Gaps = 14/116 (12%)
 Frame = +1

Query: 109 PILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPV 288
           P+      G P     +P       V PP   PPI  PP   PP+V PPV  PP+T PP 
Sbjct: 105 PVTRPPVVGPPKGPVTRPPVTRPPVVGPPVTYPPITGPP-TTPPVVGPPVTYPPITGPPT 163

Query: 289 TV----PPITVPPVVKP--TLPPIPGVTPILPP-------VPVLNPPS-TPTPTTP 414
           T     PP+T PP+  P  T PP+ G     PP        P   PPS TPTP++P
Sbjct: 164 TPXVVGPPVTYPPITGPPATTPPVTGPPVTYPPGGGGGSSTPCPPPPSPTPTPSSP 219

[107][TOP]
>UniRef100_Q6GLH3 Splicing factor 3a, subunit 2, 66kDa n=1 Tax=Xenopus (Silurana)
           tropicalis RepID=Q6GLH3_XENTR
          Length = 412

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 42/98 (42%), Positives = 52/98 (53%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVP-PIVKPPVILPPV---TVPPVTVPP 300
           P+P+   P    G P+ P  PG   P V PP + P P+V PP + PPV   ++PP  VPP
Sbjct: 246 PMPENMPPPPPGGLPMPPMPPGTPAPPVPPPQLPPAPVVPPPGVHPPVPPPSLPPPGVPP 305

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             VPP   P +PP PGV P   P P + PP  P P  P
Sbjct: 306 PGVPPPPNPAVPP-PGVPPPGIPPPGIPPPGVPPPPAP 342

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 40/105 (38%), Positives = 48/105 (45%), Gaps = 11/105 (10%)
 Frame = +1

Query: 133 GKPVPKKHKPSKKPGKPVKPPGIVPPIVKP----PGIVPPIVKPPVI-------LPPVTV 279
           G P P    P   P   V PPG+ PP+  P    PG+ PP V PP         +PP  +
Sbjct: 267 GTPAPPVPPPQLPPAPVVPPPGVHPPVPPPSLPPPGVPPPGVPPPPNPAVPPPGVPPPGI 326

Query: 280 PPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP  +PP  VPP   P +PP P     LPP P + PP  P    P
Sbjct: 327 PPPGIPPPGVPPPPAPGVPPPPAPGVPLPPTPGVPPPPAPGVPPP 371

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 44/113 (38%), Positives = 53/113 (46%), Gaps = 10/113 (8%)
 Frame = +1

Query: 106 APILGCGTCGKPVPKKHKPSK---KPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPV 273
           AP++       PVP    P      PG P  P P + PP V PPGI PP + PP + PP 
Sbjct: 281 APVVPPPGVHPPVPPPSLPPPGVPPPGVPPPPNPAVPPPGVPPPGIPPPGIPPPGVPPPP 340

Query: 274 T--VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPS----TPTPTTP 414
              VPP   P + +PP      PP PGV P  PP P + PP+     P P  P
Sbjct: 341 APGVPPPPAPGVPLPPTPGVPPPPAPGVPP--PPAPGVPPPAPGVLPPGPMPP 391

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 38/98 (38%), Positives = 45/98 (45%), Gaps = 5/98 (5%)
 Frame = +1

Query: 136 KPVPK-----KHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPP 300
           +PVP      + +P      P  PPG +P    PPG   P V PP + P   VPP  V P
Sbjct: 232 RPVPPAINGIQARPPMPENMPPPPPGGLPMPPMPPGTPAPPVPPPQLPPAPVVPPPGVHP 291

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              PP + P   P PGV P  PP P + PP  P P  P
Sbjct: 292 PVPPPSLPPPGVPPPGVPP--PPNPAVPPPGVPPPGIP 327

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 42/98 (42%), Positives = 50/98 (51%), Gaps = 12/98 (12%)
 Frame = +1

Query: 133 GKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI--LPPVTVPPVTVPPIT 306
           G P P    P   P   V PPG+ PP + PPGI PP V PP    +PP   P V +PP  
Sbjct: 302 GVPPPGVPPP---PNPAVPPPGVPPPGIPPPGIPPPGVPPPPAPGVPPPPAPGVPLPPTP 358

Query: 307 -VPPVVKPTL--PPIPGVTP----ILPP---VPVLNPP 390
            VPP   P +  PP PGV P    +LPP    P++ PP
Sbjct: 359 GVPPPPAPGVPPPPAPGVPPPAPGVLPPGPMPPMMRPP 396

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 47/111 (42%), Positives = 54/111 (48%), Gaps = 9/111 (8%)
 Frame = +1

Query: 109 PILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPP----IVKPPGIVPPIVKPPVILPP-- 270
           P +  GT   PVP    P + P  PV PP    P     V PP + PP V PP + PP  
Sbjct: 262 PPMPPGTPAPPVP----PPQLPPAPVVPP----PGVHPPVPPPSLPPPGVPPPGVPPPPN 313

Query: 271 VTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNP---PSTPTPTTP 414
             VPP  VPP  +PP   P +PP PGV P  PP P + P   P  P P TP
Sbjct: 314 PAVPPPGVPPPGIPP---PGIPP-PGVPP--PPAPGVPPPPAPGVPLPPTP 358

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 40/99 (40%), Positives = 47/99 (47%), Gaps = 10/99 (10%)
 Frame = +1

Query: 148 KKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVK-----PPVILPPVTVPPVTVPPI 303
           K  KP + P  P  PPG+   VPP +      PP+ +     PP  LP   +PP T P  
Sbjct: 213 KMEKPPQAPTLPPAPPGVKRPVPPAINGIQARPPMPENMPPPPPGGLPMPPMPPGT-PAP 271

Query: 304 TVPPVVKPTLP--PIPGVTPILPPVPVLNPPSTPTPTTP 414
            VPP   P  P  P PGV P +PP P L PP  P P  P
Sbjct: 272 PVPPPQLPPAPVVPPPGVHPPVPP-PSLPPPGVPPPGVP 309

[108][TOP]
>UniRef100_A7J8T9 AGP6 (Fragment) n=1 Tax=Pinus strobus RepID=A7J8T9_PINST
          Length = 212

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 33/80 (41%), Positives = 40/80 (50%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P    KPP + P   K P   PP+  PPV +PPV  PP   PP+ VPP
Sbjct: 72  KPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPFAAPPVAVPP 129

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 130 ASPPAIPP-----PVQAPAP 144

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 34/90 (37%), Positives = 40/90 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P     KP+     P K P   PP  KPP + P   K PV  PPV  PPV VPP+  PP 
Sbjct: 66  PAVAPTKPAPPVTAPTKAP---PPTTKPPAVAP--AKAPVSAPPVATPPVAVPPVATPPF 120

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +   P   P +PP     P   P P+
Sbjct: 121 AAPPVAVPPASPPAIPP-----PVQAPAPS 145

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/108 (33%), Positives = 44/108 (40%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTK 89

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP     PV  PP++P    P
Sbjct: 90  PPAVAPAKAPVSAPPVATPPVAVPPVATPPFAAPPVAVPPASPPAIPP 137

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 36/93 (38%), Positives = 39/93 (41%), Gaps = 11/93 (11%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTKPP 91

Query: 316 VVKPTLPPIPGVTPILPPV---PVLNPPSTPTP 405
            V P   P+       PPV   PV  PP    P
Sbjct: 92  AVAPAKAPVSAPPVATPPVAVPPVATPPFAAPP 124

[109][TOP]
>UniRef100_A7J8Q8 AGP6 (Fragment) n=1 Tax=Pinus ayacahuite var. veitchii
           RepID=A7J8Q8_9CONI
          Length = 212

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 33/80 (41%), Positives = 40/80 (50%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP P    P+K P     PP + P   K P   PP+  PPV +PPV  PPV  PP+ VPP
Sbjct: 72  KPAPPVTAPTKAPPPTTNPPAVAP--AKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPP 129

Query: 316 VVKPTLPPIPGVTPILPPVP 375
              P +PP     P+  P P
Sbjct: 130 ASPPAIPP-----PVQAPAP 144

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 38/94 (40%), Positives = 43/94 (45%), Gaps = 3/94 (3%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP---PVILPPVTVPPVTVPPIT 306
           KP P    P+  P KP  PP   P    PP   PP V P   PV  PPV  PPV VPP+ 
Sbjct: 59  KPTPPV-APAVAPTKPA-PPVTAPTKAPPPTTNPPAVAPAKAPVSAPPVATPPVAVPPVA 116

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            PPV  P +   P   P +PP     P   P P+
Sbjct: 117 TPPVAAPPVAVPPASPPAIPP-----PVQAPAPS 145

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/108 (33%), Positives = 45/108 (41%), Gaps = 3/108 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           + AP     T   P      P+  P KP  P   V P V P    PP+  P    PP T 
Sbjct: 33  TTAPAAPVSTPKPPTTTPVAPAVAPTKPTPP---VAPAVAPTKPAPPVTAPTKAPPPTTN 89

Query: 280 PPVTVP---PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   P   P++ PPV  P +   P  TP +   PV  PP++P    P
Sbjct: 90  PPAVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASPPAIPP 137

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 40/101 (39%), Positives = 45/101 (44%), Gaps = 16/101 (15%)
 Frame = +1

Query: 160 PSKKPGKPV---KPPGIVP--PIVKPPGIVPPI---VKPPVILPPVTVPPVTVPPITVPP 315
           P+  P  PV   KPP   P  P V P    PP+   V P    PPVT P    PP T PP
Sbjct: 32  PTTAPAAPVSTPKPPTTTPVAPAVAPTKPTPPVAPAVAPTKPAPPVTAPTKAPPPTTNPP 91

Query: 316 VVKPTLPPI---PGVTP--ILPPV---PVLNPPSTPTPTTP 414
            V P   P+   P  TP   +PPV   PV  PP    P +P
Sbjct: 92  AVAPAKAPVSAPPVATPPVAVPPVATPPVAAPPVAVPPASP 132

[110][TOP]
>UniRef100_Q9LFR3 Putative uncharacterized protein F2G14_40 n=1 Tax=Arabidopsis
           thaliana RepID=Q9LFR3_ARATH
          Length = 275

 Score = 69.3 bits (168), Expect(2) = 2e-11
 Identities = 44/106 (41%), Positives = 51/106 (48%), Gaps = 20/106 (18%)
 Frame = +1

Query: 157 KPSKKPGKPVKPPGIVPPI----VKPPGIVP--PIVKPPVILPPVTVPPV-TVPPITVPP 315
           KP   P  PVKPP   PPI    V+PP   P  P VKPP + PP   PP  TV P T  P
Sbjct: 79  KPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSP 138

Query: 316 VVKPTLPPI-----------PGVTPILPP--VPVLNPPSTPTPTTP 414
           V  PT PP+           P  +P+ PP   P + PP+T  P  P
Sbjct: 139 VKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQP 184

 Score = 22.7 bits (47), Expect(2) = 2e-11
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +2

Query: 77  SSACSSSPLPPPFSVAAPAVSPSQRNTSPAKSPASP 184
           S+A  S P P       P+ SP+ +  SPA  P +P
Sbjct: 27  SNALVSLPTP-----TLPSPSPATKPPSPALKPPTP 57

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 45/104 (43%), Positives = 52/104 (50%), Gaps = 12/104 (11%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKP-VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           P  K   P+ KP  P  KPP +    +KPP   PP VKPP I      PPV+ PPI +PP
Sbjct: 43  PATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPP-VKPPTIPVTPVKPPVSTPPIKLPP 101

Query: 316 VVKPTL-PPIPGVTP-------ILPPVPVLNPPST---PTPTTP 414
           V  PT  PP P V P         PP P + PP+T     PTTP
Sbjct: 102 VQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTP 145

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/98 (43%), Positives = 50/98 (51%), Gaps = 7/98 (7%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKP-VKPPGIVPPIVKPPGIVPPIVKPPVILP--PVTVPPVTVPPITVP 312
           +P    P+ KP  P VKPP + PP  KPP    P VKPP   P  P T PPV  PP+  P
Sbjct: 99  LPPVQPPTYKPPTPTVKPPSVQPPTYKPP---TPTVKPPTTSPVKPPTTPPVQSPPVQPP 155

Query: 313 PVVKPTLPPIPGVT--PILPP--VPVLNPPSTPTPTTP 414
               PT P  P  T  P+ PP   P + PP+   PTTP
Sbjct: 156 TYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTP 193

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/96 (44%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPG--KPVKPPGIVPPIVKPPGIVPPIVKPPV--ILPPVTVPPVTVPPIT 306
           P  K   P+ KP    PVKPP   PP+  PP + PP  KPP   + PP T PPV  PP T
Sbjct: 122 PTYKPPTPTVKPPTTSPVKPP-TTPPVQSPP-VQPPTYKPPTSPVKPPTTTPPVK-PPTT 178

Query: 307 VPPVVKPTLPPIPGVTPILPPV-PVLNPPSTPTPTT 411
            PPV  PT  P    TP+ PP  P + PP+ P   T
Sbjct: 179 TPPVQPPTYNP--PTTPVKPPTAPPVKPPTPPPVRT 212

[111][TOP]
>UniRef100_Q2V375 Putative uncharacterized protein At5g14920.2 n=1 Tax=Arabidopsis
           thaliana RepID=Q2V375_ARATH
          Length = 223

 Score = 69.3 bits (168), Expect(2) = 2e-11
 Identities = 44/106 (41%), Positives = 51/106 (48%), Gaps = 20/106 (18%)
 Frame = +1

Query: 157 KPSKKPGKPVKPPGIVPPI----VKPPGIVP--PIVKPPVILPPVTVPPV-TVPPITVPP 315
           KP   P  PVKPP   PPI    V+PP   P  P VKPP + PP   PP  TV P T  P
Sbjct: 79  KPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSP 138

Query: 316 VVKPTLPPI-----------PGVTPILPP--VPVLNPPSTPTPTTP 414
           V  PT PP+           P  +P+ PP   P + PP+T  P  P
Sbjct: 139 VKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQP 184

 Score = 22.7 bits (47), Expect(2) = 2e-11
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +2

Query: 77  SSACSSSPLPPPFSVAAPAVSPSQRNTSPAKSPASP 184
           S+A  S P P       P+ SP+ +  SPA  P +P
Sbjct: 27  SNALVSLPTP-----TLPSPSPATKPPSPALKPPTP 57

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 45/104 (43%), Positives = 52/104 (50%), Gaps = 12/104 (11%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKP-VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           P  K   P+ KP  P  KPP +    +KPP   PP VKPP I      PPV+ PPI +PP
Sbjct: 43  PATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPP-VKPPTIPVTPVKPPVSTPPIKLPP 101

Query: 316 VVKPTL-PPIPGVTP-------ILPPVPVLNPPST---PTPTTP 414
           V  PT  PP P V P         PP P + PP+T     PTTP
Sbjct: 102 VQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTP 145

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/98 (43%), Positives = 50/98 (51%), Gaps = 7/98 (7%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKP-VKPPGIVPPIVKPPGIVPPIVKPPVILP--PVTVPPVTVPPITVP 312
           +P    P+ KP  P VKPP + PP  KPP    P VKPP   P  P T PPV  PP+  P
Sbjct: 99  LPPVQPPTYKPPTPTVKPPSVQPPTYKPP---TPTVKPPTTSPVKPPTTPPVQSPPVQPP 155

Query: 313 PVVKPTLPPIPGVT--PILPP--VPVLNPPSTPTPTTP 414
               PT P  P  T  P+ PP   P + PP+   PTTP
Sbjct: 156 TYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTP 193

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/96 (44%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPG--KPVKPPGIVPPIVKPPGIVPPIVKPPV--ILPPVTVPPVTVPPIT 306
           P  K   P+ KP    PVKPP   PP+  PP + PP  KPP   + PP T PPV  PP T
Sbjct: 122 PTYKPPTPTVKPPTTSPVKPP-TTPPVQSPP-VQPPTYKPPTSPVKPPTTTPPVK-PPTT 178

Query: 307 VPPVVKPTLPPIPGVTPILPPV-PVLNPPSTPTPTT 411
            PPV  PT  P    TP+ PP  P + PP+ P   T
Sbjct: 179 TPPVQPPTYNP--PTTPVKPPTAPPVKPPTPPPVRT 212

[112][TOP]
>UniRef100_Q89392 A57R protein n=1 Tax=Paramecium bursaria Chlorella virus 1
           RepID=Q89392_PBCV1
          Length = 544

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 39/90 (43%), Positives = 41/90 (45%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  +
Sbjct: 91  PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPE 149

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P L PP+ P P  P
Sbjct: 150 PPAPEPPAPEPPAPEPPALEPPA-PEPPAP 178

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 38/90 (42%), Positives = 41/90 (45%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  +
Sbjct: 101 PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPE 159

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P + P  P  P   PP+ P P  P
Sbjct: 160 PPAPEPPALEPPAPEPPAPEPPA-PEPPAP 188

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 38/92 (41%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  +
Sbjct: 96  PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPE 154

Query: 325 PTL--PPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P    PP P    + PP P    P  P P  P
Sbjct: 155 PPAPEPPAPEPPALEPPAPEPPAPEPPAPEPP 186

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 40/90 (44%), Positives = 41/90 (45%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  K
Sbjct: 41  PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPK 99

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PPS P P +P
Sbjct: 100 PPSPKPPSPKPPSPKPPSPKPPS-PKPPSP 128

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 40/90 (44%), Positives = 41/90 (45%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  K
Sbjct: 46  PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPK 104

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PPS P P +P
Sbjct: 105 PPSPKPPSPKPPSPKPPSPKPPS-PKPPSP 133

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 39/90 (43%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  K
Sbjct: 76  PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPK 134

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PP+ P P  P
Sbjct: 135 PPAPEPPAPEPPAPEPPAPEPPA-PEPPAP 163

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 40/90 (44%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  K
Sbjct: 51  PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPK 109

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PPS P P  P
Sbjct: 110 PPSPKPPSPKPPSPKPPSPKPPS-PKPPAP 138

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 39/90 (43%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  K
Sbjct: 66  PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPK 124

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PP+ P P  P
Sbjct: 125 PPSPKPPSPKPPAPEPPAPEPPA-PEPPAP 153

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 39/90 (43%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  K
Sbjct: 71  PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPK 129

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PP+ P P  P
Sbjct: 130 PPSPKPPAPEPPAPEPPAPEPPA-PEPPAP 158

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 39/90 (43%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  K
Sbjct: 61  PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPK 119

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PP+ P P  P
Sbjct: 120 PPSPKPPSPKPPSPKPPAPEPPA-PEPPAP 148

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 38/92 (41%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  +
Sbjct: 86  PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPE 144

Query: 325 PTLPPIPGVTPILPPVPVLNPPS--TPTPTTP 414
           P  P  P   P  P  P   PP+   P P  P
Sbjct: 145 PPAPEPPAPEPPAPEPPAPEPPALEPPAPEPP 176

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 39/90 (43%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  K
Sbjct: 56  PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPK 114

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PP+ P P  P
Sbjct: 115 PPSPKPPSPKPPSPKPPSPKPPA-PEPPAP 143

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/87 (41%), Positives = 38/87 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  +
Sbjct: 81  PSPKPPSPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPAPE 139

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P  P  P   P  P  P   PP+   P
Sbjct: 140 PPAPEPPAPEPPAPEPPAPEPPAPEPP 166

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 38/86 (44%), Positives = 39/86 (45%), Gaps = 2/86 (2%)
 Frame = +1

Query: 163 SKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI 342
           S KP  P KPP   PP  KPP   PP  KPP   PP   PP   PP   PP  KP  P  
Sbjct: 37  SPKPPSP-KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKP 95

Query: 343 PGVTPILPPVPVLNPPST--PTPTTP 414
           P   P  P  P   PPS   P+P  P
Sbjct: 96  PSPKPPSPKPPSPKPPSPKPPSPKPP 121

[113][TOP]
>UniRef100_Q6SSE6 Plus agglutinin n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q6SSE6_CHLRE
          Length = 3409

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 38/92 (41%), Positives = 42/92 (45%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV--KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P    PS +P  PV  +PP  VPP  KPP   PP   PP   PP   PP   PP   PP 
Sbjct: 632 PSPAPPSPQPPSPVPPQPPSPVPPSPKPPSPAPPSPVPPSPAPPSPAPPSPAPPNPAPPS 691

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P LPP P      PP P    P+ P+P  P
Sbjct: 692 PAPPLPPSPEPPSPAPPSPEPPSPAPPSPAPP 723

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 40/96 (41%), Positives = 44/96 (45%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPV----KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
           P P    PS  P  P     +PP  VPP  +PP  VPP  KPP   PP  VPP   PP  
Sbjct: 620 PPPSPAPPSPAPPSPAPPSPQPPSPVPP--QPPSPVPPSPKPPSPAPPSPVPPSPAPPSP 677

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   P  P  P   P LPP P    P+ P+P  P
Sbjct: 678 APPSPAPPNPAPPSPAPPLPPSPEPPSPAPPSPEPP 713

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 38/92 (41%), Positives = 40/92 (43%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP  VPP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 952  PPPSPAPPSPAPPSPT-PPSPVPPSPAPPSPDPPSPAPPSPDPPSPAPPSPAPPSPNPPS 1010

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP PG     PP P  +PP    PT+P
Sbjct: 1011 PVPPTPPSPGPPSPEPPSPAPSPPPPTPPTSP 1042

 Score = 66.2 bits (160), Expect(2) = 2e-10
 Identities = 35/88 (39%), Positives = 40/88 (45%), Gaps = 3/88 (3%)
 Frame = +1

Query: 160  PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
            PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   P  PP
Sbjct: 1063 PSPEPPSPA-PPSPAPPSPQPPSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPSPSPPAPP 1121

Query: 340  I---PGVTPILPPVPVLNPPSTPTPTTP 414
                P   P+LPP P    P+ P+P  P
Sbjct: 1122 SPEPPSPAPLLPPSPDPPSPAPPSPMPP 1149

 Score = 22.7 bits (47), Expect(2) = 2e-10
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +2

Query: 98   PLPPPFSVAAPAVSPSQRNTSPAKSPASP 184
            P P P S   P+ +PS    +P  SP  P
Sbjct: 1017 PSPGPPSPEPPSPAPSPPPPTPPTSPPPP 1045

 Score = 65.9 bits (159), Expect(2) = 3e-10
 Identities = 35/85 (41%), Positives = 39/85 (45%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           PS +P  P KPP   PP   PP   PP   PP   PP   PP   PP  VPP     +PP
Sbjct: 597 PSPEPPSP-KPPSPAPPSPAPPSPPPPSPAPPSPAPPSPAPPSPQPPSPVPPQPPSPVPP 655

Query: 340 IPGVTPILPPVPVLNPPSTPTPTTP 414
            P      PP PV   P+ P+P  P
Sbjct: 656 SPKPPSPAPPSPVPPSPAPPSPAPP 680

 Score = 22.3 bits (46), Expect(2) = 3e-10
 Identities = 13/28 (46%), Positives = 13/28 (46%)
 Frame = +2

Query: 98  PLPPPFSVAAPAVSPSQRNTSPAKSPAS 181
           P PPP    AP  SP     SP   PAS
Sbjct: 569 PRPPP---RAPRPSPPFHPPSPDSPPAS 593

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 36/91 (39%), Positives = 42/91 (46%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP + PP   PP   PP  +PP   PP   PP   PP   PP  +
Sbjct: 867  PSPEPPSPEPPSPA-PPSLEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPQPPSPEPPSPE 925

Query: 325  -PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P   P  P  P   PPS P P +P
Sbjct: 926  PPSPPPPPSPAPPSPAPPSPEPPSPPPPPSP 956

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 36/90 (40%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1236 PSPAPPSPAPPSPA-PPSPQPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPSPA 1294

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  PP PV   P+ P+PT P
Sbjct: 1295 PPSPEPPSPAPPQPPSPVPPSPAPPSPTPP 1324

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/94 (38%), Positives = 39/94 (41%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P    PS  P  PV P    P   PP  +PP   PP   PP + PP   PP   PP   P
Sbjct: 842  PSPEPPSPAPPSPVPPSPAPPSPAPPSPEPPSPEPPSPAPPSLEPPSPAPPSPAPPSPEP 901

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  P  P   P  P  P   PPS P P +P
Sbjct: 902  PSPAPPSPAPPSPQPPSPEPPSPEPPSPPPPPSP 935

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 37/96 (38%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = +1

Query: 136 KPVPKKHKPSKK--PGKPVKPPGI-VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
           +P P+  +PS    P  P  PP   VPP  +PP   PP   PP   PP   PP   PP  
Sbjct: 570 RPPPRAPRPSPPFHPPSPDSPPASSVPPSPEPPSPKPPSPAPPSPAPPSPPPPSPAPPSP 629

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   P  P  P   P  PP PV   P  P+P  P
Sbjct: 630 APPSPAPPSPQPPSPVPPQPPSPVPPSPKPPSPAPP 665

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P      P  PP   PP   PP   PP  +PP   PP   PP  VPP   PP 
Sbjct: 804  PSPAPPSPEPPSPSPPAPPSPEPPSPAPPSPFPPSPQPPSPEPPSPAPPSPVPPSPAPPS 863

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P L PPS P P +P
Sbjct: 864  PAPPSPEPPSPEPPSPAPPSLEPPS-PAPPSP 894

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 34/95 (35%), Positives = 41/95 (43%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT---VPPVTVPPITV 309
            P P    P      P +PP  VPP   PP   PP   P   LPP+     PP+ VPP + 
Sbjct: 1291 PSPAPPSPEPPSPAPPQPPSPVPPSPAPPSPTPPAPAPAAALPPLPPSPAPPLPVPPASP 1350

Query: 310  PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P   P  PP P    + PP P    P+ P+P  P
Sbjct: 1351 APSPSPLRPPQPQTPAMPPPSPAPPSPAPPSPAPP 1385

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P  PP   PP   PP   PP   PP   PP   PP  VPP    PV  
Sbjct: 597 PSPEPPSPKPPSPA-PPSPAPPSPPPPSPAPPSPAPPSPAPPSPQPPSPVPPQPPSPVPP 655

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              PP P     +PP P    P+ P+P  P
Sbjct: 656 SPKPPSPAPPSPVPPSPAPPSPAPPSPAPP 685

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 36/92 (39%), Positives = 41/92 (44%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP    PS  P  P  PP   PP  +PP   PP ++PP   PP   PP   PP   PP 
Sbjct: 854  PVP----PSPAPPSPA-PPSPEPPSPEPPSPAPPSLEPPSPAPPSPAPPSPEPPSPAPPS 908

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P   PP +P P +P
Sbjct: 909  PAPPSPQPPSPEPPSPEPPSPPPPPSPAPPSP 940

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 34/90 (37%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP   PP + PP   PP   PP   PP   PP   PP  +
Sbjct: 857  PSPAPPSPAPPSP-EPPSPEPPSPAPPSLEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPQ 915

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  PP P    P +P P +P
Sbjct: 916  PPSPEPPSPEPPSPPPPPSPAPPSPAPPSP 945

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/94 (39%), Positives = 41/94 (43%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P P    PS +P  P  P  P   PP   PP   PP  +PP   PP   PP   PP   P
Sbjct: 1043 PPPPPEPPSPEPPSPAPPLPPSPEPPSPAPPSPAPPSPQPPSPAPPSPAPPSPAPPSPAP 1102

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  +P  P  P  +P  PP P   PPS P P  P
Sbjct: 1103 PSPEPPSPAPPSPSPPAPPSP--EPPS-PAPLLP 1133

 Score = 61.6 bits (148), Expect(2) = 3e-09
 Identities = 34/85 (40%), Positives = 40/85 (47%)
 Frame = +1

Query: 160  PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
            PS +P  P  PP   PP  +PP   PP   PP  +PP   PP   PP   PP  +P  P 
Sbjct: 822  PSPEPPSPA-PPSPFPPSPQPPSPEPPSPAPPSPVPPSPAPPSPAPPSPEPPSPEPPSPA 880

Query: 340  IPGVTPILPPVPVLNPPSTPTPTTP 414
             P + P  P  P   PPS P P +P
Sbjct: 881  PPSLEPPSPAPPSPAPPS-PEPPSP 904

 Score = 23.1 bits (48), Expect(2) = 3e-09
 Identities = 13/45 (28%), Positives = 18/45 (40%)
 Frame = +2

Query: 50  SPQRSMLTSSSACSSSPLPPPFSVAAPAVSPSQRNTSPAKSPASP 184
           SP+       S    SP PP  +  +PA         P+ +P SP
Sbjct: 752 SPEPPSPAPPSPAPPSPAPPSPAPPSPAPPAPPSPEPPSPAPPSP 796

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 36/90 (40%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP  VPP   PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 837  PSPQPPSPEPPSPA-PPSPVPPSPAPPSPAPPSPEPPSPEPPSPAPPSLEPPSPAPPSPA 895

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 896  PPSPEPPSPAPPSPAPPSPQPPS-PEPPSP 924

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 37/96 (38%), Positives = 42/96 (43%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 1073 PSPAPPSPQPPSPA-PPSPAPPSPAPPSPAPPSPEPPSPAPPSPSPP--APPSPEPPSPA 1129

Query: 325  PTLPPIPG------VTPILPPVPVLNPPSTPTPTTP 414
            P LPP P        +P+ PP+P   P   P P TP
Sbjct: 1130 PLLPPSPDPPSPAPPSPMPPPLPTSPPSPEPVPPTP 1165

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/94 (37%), Positives = 40/94 (42%), Gaps = 1/94 (1%)
 Frame = +1

Query: 136 KPVPKKHKPSK-KPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           +P P  H PS   P     PP   PP  KPP   PP   PP   PP   PP   PP   P
Sbjct: 577 RPSPPFHPPSPDSPPASSVPPSPEPPSPKPPSPAPPSPAPPSPPPPSPAPPSPAPPSPAP 636

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  +P  P  P     +PP P    P+ P+P  P
Sbjct: 637 PSPQPPSPVPPQPPSPVPPSPKPPSPAPPSPVPP 670

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 39/97 (40%), Positives = 41/97 (42%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139 PVPKKHKP-SKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPI 303
           PVP   KP S  P  PV P    P   PP   PP   PP   PP  LPP   PP   PP 
Sbjct: 652 PVPPSPKPPSPAPPSPVPPSPAPPSPAPPSPAPPNPAPPSPAPP--LPPSPEPPSPAPPS 709

Query: 304 TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP   P  P  P   P  P  P   PP+ P+P  P
Sbjct: 710 PEPPSPAPPSPAPPSPAPPSPAPPSPAPPAPPSPEPP 746

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 32/92 (34%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P+     P  P   +PP  +PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 675 PSPAPPSPAPPNPAPPSPAPPLPPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPS 734

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P      PP P    P+ P+P  P
Sbjct: 735 PAPPAPPSPEPPSPAPPSPEPPSPAPPSPAPP 766

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 33/90 (36%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  P    PP  +PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 723 PSPAPPSPAPPSPAPP---APPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPA 779

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P      PP P    P+ P+P  P
Sbjct: 780 PPAPPSPEPPSPAPPSPEPPSPAPPSPAPP 809

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 34/94 (36%), Positives = 41/94 (43%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P+   PS       +PP   PP   PP   PP  +PP   PP  VPP   PP   PP 
Sbjct: 809  PSPEPPSPSPPAPPSPEPPSPAPPSPFPPSPQPPSPEPPSPAPPSPVPPSPAPPSPAPPS 868

Query: 319  VKPTL--PPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P    PP P    + PP P    P+ P+P  P
Sbjct: 869  PEPPSPEPPSPAPPSLEPPSPAPPSPAPPSPEPP 902

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 34/92 (36%), Positives = 37/92 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  P    PP   PP   PP   PP  +PP   PP   PP   PP 
Sbjct: 931  PPPSPAPPSPAPPSPEPPSPPPPPSPAPPSPAPPSPTPPSPVPPSPAPPSPDPPSPAPPS 990

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P   PP+ P+P  P
Sbjct: 991  PDPPSPAPPSPAPPSPNPPSPVPPTPPSPGPP 1022

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 36/94 (38%), Positives = 41/94 (43%)
 Frame = +1

Query: 133  GKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            G P P+   P+  P  P  P    PP  +PP   PP   PP  LPP   PP   PP   P
Sbjct: 1020 GPPSPEPPSPAPSPPPPTPPTSPPPPPPEPPSPEPPSPAPP--LPPSPEPPSPAPPSPAP 1077

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  +P  P  P   P  P  P   PPS P P +P
Sbjct: 1078 PSPQPPSPAPPSPAPPSPAPPSPAPPS-PEPPSP 1110

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP  +PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 1186 PSPEPPSPAPPSPA-PPSPAPPSPEPPSPEPPSPEPPSPAPPSPAPPSPAPPSPAPPSPA 1244

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1245 PPSPAPPSPQPPSPAPPSPEPPS-PAPPSP 1273

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP  +
Sbjct: 1206 PSPEPPSPEPPSP-EPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPQPPSPAPPSPE 1264

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1265 PPSPAPPSPAPPSPAPPSPAPPS-PAPPSP 1293

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/88 (39%), Positives = 42/88 (47%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP  +PP   PP  +PP  +PP   PP   PP   P    
Sbjct: 1276 PSPAPPSPAPPSPA-PPSPAPPSPEPPSPAPP--QPPSPVPPSPAPPSPTPPAPAPAAAL 1332

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            P LPP P      PP+PV  PP++P P+
Sbjct: 1333 PPLPPSPA-----PPLPV--PPASPAPS 1353

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/91 (39%), Positives = 38/91 (41%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI-LPPVTVPPVTVPPITVPPVV 321
            P    PS +P  P  PP   PP   PP   PP   PP    PP   PP   PP  VPP  
Sbjct: 917  PSPEPPSPEPPSPPPPPSPAPPSPAPPSPEPPSPPPPPSPAPPSPAPPSPTPPSPVPPSP 976

Query: 322  KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P  P   P  P  P   PPS P P +P
Sbjct: 977  APPSPDPPSPAPPSPDPPSPAPPS-PAPPSP 1006

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 34/92 (36%), Positives = 38/92 (41%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 938  PSPAPPSPEPPSPPPPPSPAPPSPAPPSPTPPSPVPPSPAPPSPDPPSPAPPSPDPPSPA 997

Query: 325  P--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P    PP P     +PP P    P +P P +P
Sbjct: 998  PPSPAPPSPNPPSPVPPTPPSPGPPSPEPPSP 1029

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 34/90 (37%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP  +
Sbjct: 741  PSPEPPSPAPPSP-EPPSPAPPSPAPPSPAPPSPAPPSPAPP--APPSPEPPSPAPPSPE 797

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P  +PP+ P+P  P
Sbjct: 798  PPSPAPPSPAPPSPEPPSPSPPAPPSPEPP 827

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 38/101 (37%), Positives = 46/101 (45%), Gaps = 11/101 (10%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPV-----------ILPPVTVPPVT 291
            P    PS  P  P  PP   PP  +PP   PP   PP            +LPP   PP  
Sbjct: 1083 PSPAPPSPAPPSPA-PPSPAPPSPEPPSPAPPSPSPPAPPSPEPPSPAPLLPPSPDPPSP 1141

Query: 292  VPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP  +PP + PT PP P   P+ PP P  +PP+ P+P  P
Sbjct: 1142 APPSPMPPPL-PTSPPSP--EPV-PPTPPPSPPAPPSPAPP 1178

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 34/90 (37%), Positives = 35/90 (38%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1226 PSPAPPSPAPPSPA-PPSPAPPSPAPPSPQPPSPAPPSPEPPSPAPPSPAPPSPAPPSPA 1284

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PP  P+P  P
Sbjct: 1285 PPSPAPPSPAPPSPEPPSPAPPQPPSPVPP 1314

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/90 (40%), Positives = 40/90 (44%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP   PP  VPP   PP   PP   PP   PP   PP ++
Sbjct: 827  PSPAPPSPFPPSP-QPPSPEPPSPAPPSPVPPSPAPPSPAPPSPEPPSPEPPSPAPPSLE 885

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 886  PPSPAPPSPAPPSPEPPSPAPPS-PAPPSP 914

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP  +PP   PP   PP   PP   PP   PP   PP  +
Sbjct: 1196 PSPAPPSPAPPSP-EPPSPEPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPQ 1254

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1255 PPSPAPPSPEPPSPAPPSPAPPS-PAPPSP 1283

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 34/90 (37%), Positives = 35/90 (38%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 1221 PSPAPPSPAPPSPA-PPSPAPPSPAPPSPAPPSPQPPSPAPPSPEPPSPAPPSPAPPSPA 1279

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS   P  P
Sbjct: 1280 PPSPAPPSPAPPSPAPPSPEPPSPAPPQPP 1309

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 35/95 (36%), Positives = 44/95 (46%), Gaps = 5/95 (5%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPI---TVPP 315
            P    PS  P  P +PP   PP  +PP  VPP   PP   PP   P   +PP+     PP
Sbjct: 1286 PSPAPPSPAPPSP-EPPSPAPP--QPPSPVPPSPAPPSPTPPAPAPAAALPPLPPSPAPP 1342

Query: 316  VVKPTLPPIPGVTPILPPVP--VLNPPSTPTPTTP 414
            +  P   P P  +P+ PP P     PP +P P +P
Sbjct: 1343 LPVPPASPAPSPSPLRPPQPQTPAMPPPSPAPPSP 1377

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 34/93 (36%), Positives = 37/93 (39%), Gaps = 3/93 (3%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1251 PSPQPPSPAPPSP-EPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPEPPSPAPPQPP 1309

Query: 325  PTLPPIPGVTPILPPVP---VLNPPSTPTPTTP 414
              +PP P      PP P      PP  P+P  P
Sbjct: 1310 SPVPPSPAPPSPTPPAPAPAAALPPLPPSPAPP 1342

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/92 (38%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           PVP +  PS  P  P KPP   PP   PP   PP   PP   PP   PP   PP+   P 
Sbjct: 644 PVPPQ-PPSPVPPSP-KPPSPAPPSPVPPSPAPPSPAPPSPAPPNPAPPSPAPPLPPSPE 701

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                PP P      PP P    P+ P+P  P
Sbjct: 702 PPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPP 733

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/90 (38%), Positives = 37/90 (41%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1211 PSPEPPSPEPPSPA-PPSPAPPSPAPPSPAPPSPAPPSPAPPSPQPPSPAPPSPEPPSPA 1269

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1270 PPSPAPPSPAPPSPAPPSPAPPS-PAPPSP 1298

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 34/90 (37%), Positives = 38/90 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP  +PP  +PP   PP   PP   PP   PP   
Sbjct: 670 PSPAPPSPAPPSPA-PPNPAPPSPAPP--LPPSPEPPSPAPPSPEPPSPAPPSPAPPSPA 726

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  PP P    P+ P+P  P
Sbjct: 727 PPSPAPPSPAPPAPPSPEPPSPAPPSPEPP 756

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 32/92 (34%), Positives = 35/92 (38%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P+     P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 680 PSPAPPNPAPPSPAPPLPPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPA 739

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                PP P      PP P    P+ P+P  P
Sbjct: 740 PPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPP 771

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 32/92 (34%), Positives = 35/92 (38%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P+     P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 723 PSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPA 782

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                PP P      PP P    P+ P+P  P
Sbjct: 783 PPSPEPPSPAPPSPEPPSPAPPSPAPPSPEPP 814

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 37/94 (39%), Positives = 37/94 (39%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKP-VKPPGIVPPI-VKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P P    P   P  P   PP   PP    PP   PP   PP   PP  VPP   PP   P
Sbjct: 924  PEPPSPPPPPSPAPPSPAPPSPEPPSPPPPPSPAPPSPAPPSPTPPSPVPPSPAPPSPDP 983

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  P  P   P  P  P  NPPS   PT P
Sbjct: 984  PSPAPPSPDPPSPAPPSPAPPSPNPPSPVPPTPP 1017

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 34/93 (36%), Positives = 39/93 (41%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P P    P   P  P  +PP   PP+  PP   PP   PP   PP   PP   PP   PP
Sbjct: 1036 PTPPTSPPPPPPEPPSPEPPSPAPPL--PPSPEPPSPAPPSPAPPSPQPPSPAPPSPAPP 1093

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P  P  P   P  P  P  +PP+ P+P  P
Sbjct: 1094 SPAPPSPAPPSPEPPSPAPPSPSPPAPPSPEPP 1126

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/92 (38%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPV--KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P    PS +P +P   +PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 1173 PSPAPPSPQPLEPPSPEPPSPAPPSPAPPSPAPPSPEPPSPEPPSPEPPSPAPPSPAPPS 1232

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P   PPS P P +P
Sbjct: 1233 PAPPSPAPPSPAPPSPAPPSPQPPS-PAPPSP 1263

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1201 PSPAPPSPEPPSP-EPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPQPPSPA 1259

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1260 PPSPEPPSPAPPSPAPPSPAPPS-PAPPSP 1288

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 34/90 (37%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 703 PSPAPPSPEPPSPA-PPSPAPPSPAPPSPAPPSPAPPA--PPSPEPPSPAPPSPEPPSPA 759

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PP+ P+P  P
Sbjct: 760 PPSPAPPSPAPPSPAPPSPAPPAPPSPEPP 789

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 34/90 (37%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 713 PSPAPPSPAPPSPA-PPSPAPPSPAPPA--PPSPEPPSPAPPSPEPPSPAPPSPAPPSPA 769

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  PP P    P+ P+P  P
Sbjct: 770 PPSPAPPSPAPPAPPSPEPPSPAPPSPEPP 799

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 35/90 (38%), Positives = 37/90 (41%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1191 PSPAPPSPAPPSPA-PPSPEPPSPEPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPSPA 1249

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1250 PPSPQPPSPAPPSPEPPSPAPPS-PAPPSP 1278

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 35/90 (38%), Positives = 36/90 (40%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1216 PSPEPPSPAPPSPA-PPSPAPPSPAPPSPAPPSPAPPSPQPPSPAPPSPEPPSPAPPSPA 1274

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1275 PPSPAPPSPAPPSPAPPSPAPPS-PEPPSP 1303

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1246 PSPAPPSPQPPSPA-PPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPEPPSPA 1304

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P     +PP P    P +PTP  P
Sbjct: 1305 PPQPPSP-----VPPSPA---PPSPTPPAP 1326

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/92 (39%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP   PP   PP  VPP   PP   PP   
Sbjct: 1271 PSPAPPSPAPPSPA-PPSPAPPSPAPPSPEPPSPAPPQ--PPSPVPPSPAPPSPTPPAPA 1327

Query: 325  PT--LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   LPP+P       PVP  +P  +P+P  P
Sbjct: 1328 PAAALPPLPPSPAPPLPVPPASPAPSPSPLRP 1359

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/90 (37%), Positives = 37/90 (41%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 751  PSPEPPSPAPPSPA-PPSPAPPSPAPPSPAPPA--PPSPEPPSPAPPSPEPPSPAPPSPA 807

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P  +P  PP P    P+ P+P  P
Sbjct: 808  PPSPEPPSPSPPAPPSPEPPSPAPPSPFPP 837

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/90 (36%), Positives = 37/90 (41%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    P+  P  P +PP   PP   PP  +PP  +PP   PP   PP   PP   PP   
Sbjct: 1034 PPPTPPTSPPPPPPEPPSPEPPSPAPP--LPPSPEPPSPAPPSPAPPSPQPPSPAPPSPA 1091

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS   P  P
Sbjct: 1092 PPSPAPPSPAPPSPEPPSPAPPSPSPPAPP 1121

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 37/101 (36%), Positives = 40/101 (39%), Gaps = 11/101 (10%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPV-----------TVPPVT 291
            P    PS  P  P  PP   PP   PP   PP   PP   PP             +PP  
Sbjct: 1078 PSPQPPSPAPPSPA-PPSPAPPSPAPPSPEPPSPAPPSPSPPAPPSPEPPSPAPLLPPSP 1136

Query: 292  VPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP   PP   P  PP+P   P   PVP   PPS P P +P
Sbjct: 1137 DPPSPAPP--SPMPPPLPTSPPSPEPVPPTPPPSPPAPPSP 1175

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 41/129 (31%), Positives = 47/129 (36%), Gaps = 24/129 (18%)
 Frame = +1

Query: 100 SAAPILGC----GTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPP-------------- 225
           S  P+  C    G C  P P    PS +P +P  PP   PP  +PP              
Sbjct: 532 SPTPVARCIQVGGICDSPSPMP--PSPRPPQPPSPP---PPPPRPPPRAPRPSPPFHPPS 586

Query: 226 ------GIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNP 387
                   VPP  +PP   PP   PP   PP   PP   P  P  P   P  P  P   P
Sbjct: 587 PDSPPASSVPPSPEPPSPKPPSPAPPSPAPPSPPPPSPAPPSPAPPSPAPPSPQPPSPVP 646

Query: 388 PSTPTPTTP 414
           P  P+P  P
Sbjct: 647 PQPPSPVPP 655

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 32/90 (35%), Positives = 35/90 (38%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  P    PP  +PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 766  PSPAPPSPAPPSPAPP---APPSPEPPSPAPPSPEPPSPAPPSPAPPSPEPPSPSPPAPP 822

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               PP P      PP P    P  P+P  P
Sbjct: 823  SPEPPSPAPPSPFPPSPQPPSPEPPSPAPP 852

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 832  PSPFPPSPQPPSP-EPPSPAPPSPVPPSPAPPSPAPPSPEPPSPEPPSPAPPSLEPPSPA 890

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 891  PPSPAPPSPEPPSPAPPSPAPPS-PQPPSP 919

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 33/90 (36%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    P+    +P++PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1170 PAPPSPAPPSPQPLEPPSPEPPSPAPPSPAPPSPAPPSPEPPSPEPPSPEPPSPAPPSPA 1229

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1230 PPSPAPPSPAPPSPAPPSPAPPS-PQPPSP 1258

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 34/90 (37%), Positives = 36/90 (40%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP  +
Sbjct: 698 PSPEPPSPAPPSP-EPPSPAPPSPAPPSPAPPSPAPPSPAPP--APPSPEPPSPAPPSPE 754

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PPS   P  P
Sbjct: 755 PPSPAPPSPAPPSPAPPSPAPPSPAPPAPP 784

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 40/95 (42%), Positives = 42/95 (44%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP    PS  P  P  PP   PP   PP   PP   PP   PP  VPP   PP   PP 
Sbjct: 971  PVP----PSPAPPSP-DPPSPAPPSPDPPSPAPPSPAPPSPNPPSPVPP--TPPSPGPPS 1023

Query: 319  VKPTLP---PIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P  P   P P   P  PP P   PPS P P +P
Sbjct: 1024 PEPPSPAPSPPPPTPPTSPPPPPPEPPS-PEPPSP 1057

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 33/92 (35%), Positives = 37/92 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P+     P  P  + PP  +PP   PP   PP   PP   PP   PP   PP 
Sbjct: 1163 PTPPPSPPAPPSPAPPSPQPLEPPSPEPPSPAPPSPAPPSPAPPSPEPPSPEPPSPEPPS 1222

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P   PPS P P +P
Sbjct: 1223 PAPPSPAPPSPAPPSPAPPSPAPPS-PAPPSP 1253

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 35/92 (38%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   PP  +PP  +PP   PP  VPP   PP   
Sbjct: 607 PSPAPPSPAPPSP-PPPSPAPPSPAPPSPAPPSPQPPSPVPP--QPPSPVPPSPKPPSPA 663

Query: 325 P--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   +PP P      PP P    P+ P+P  P
Sbjct: 664 PPSPVPPSPAPPSPAPPSPAPPNPAPPSPAPP 695

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 34/90 (37%), Positives = 35/90 (38%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 761  PSPAPPSPAPPSPA-PPSPAPPA--PPSPEPPSPAPPSPEPPSPAPPSPAPPSPEPPSPS 817

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P      PP P    P  P+P  P
Sbjct: 818  PPAPPSPEPPSPAPPSPFPPSPQPPSPEPP 847

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP  +
Sbjct: 784  PSPEPPSPAPPSP-EPPSPAPPSPAPPSPEPPSPSPPA--PPSPEPPSPAPPSPFPPSPQ 840

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 841  PPSPEPPSPAPPSPVPPSPAPPS-PAPPSP 869

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 34/94 (36%), Positives = 38/94 (40%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P+    +P  P    PP  +PP   PP   PP   PP   PP   PP  VPP 
Sbjct: 799  PSPAPPSPAPPSPEPPSPSPPAPPSPEPPSPAPPSPFPPSPQPPSPEPPSPAPPSPVPPS 858

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPS--TPTPTTP 414
              P  P  P   P  P  P   PPS   P+P  P
Sbjct: 859  PAPPSPAPPSPEPPSPEPPSPAPPSLEPPSPAPP 892

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 35/94 (37%), Positives = 37/94 (39%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P    PS  P  PV P    P   PP   PP   PP   PP   PP   PP  VPP    
Sbjct: 959  PSPAPPSPTPPSPVPPSPAPPSPDPPSPAPPSPDPPSPAPPSPAPPSPNPPSPVPPTPPS 1018

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P      PP P  +P  P  P   PP  P P +P
Sbjct: 1019 PGPPSPEPPSPAPSPPPPTPPTSPPPPPPEPPSP 1052

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 34/92 (36%), Positives = 37/92 (40%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 822  PSPEPPSPAPPSPF-PPSPQPPSPEPPSPAPPSPVPPSPAPPSPAPPSPEPPSPEPPSPA 880

Query: 325  PTL--PPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P    PP P      PP P    P+ P+P  P
Sbjct: 881  PPSLEPPSPAPPSPAPPSPEPPSPAPPSPAPP 912

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 34/91 (37%), Positives = 38/91 (41%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPI-TVPPVV 321
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP    PP  
Sbjct: 877  PSPAPPSLEPPSPA-PPSPAPPSPEPPSPAPPSPAPPSPQPPSPEPPSPEPPSPPPPPSP 935

Query: 322  KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P  P   P  PP P    P +P P +P
Sbjct: 936  APPSPAPPSPEPPSPPPPPSPAPPSPAPPSP 966

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 34/91 (37%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT-VPPVTVPPITVPPVV 321
            P    PS +P  P  P    PP   PP   PP  +PP   PP +  PP   PP   PP  
Sbjct: 912  PSPQPPSPEPPSPEPPSPPPPPSPAPPSPAPPSPEPPSPPPPPSPAPPSPAPPSPTPPSP 971

Query: 322  KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P  P   P  P  P  +PPS P P +P
Sbjct: 972  VPPSPAPPSPDPPSPAPPSPDPPS-PAPPSP 1001

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 32/92 (34%), Positives = 36/92 (39%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV--KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P    PS  P  P   +PP   PP  +PP   PP   PP   PP   PP   PP    P 
Sbjct: 685 PNPAPPSPAPPLPPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPPSPAPPAPPSPE 744

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                PP P      PP P    P+ P+P  P
Sbjct: 745 PPSPAPPSPEPPSPAPPSPAPPSPAPPSPAPP 776

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 35/94 (37%), Positives = 41/94 (43%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT-VPPVTVPPITVPPVV 321
            P    PS +P  P  PP   PP  +PP   PP  +PP   PP +  PP   PP   PP  
Sbjct: 892  PSPAPPSPEPPSPA-PPSPAPPSPQPPSPEPPSPEPPSPPPPPSPAPPSPAPPSPEPPSP 950

Query: 322  KP---TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P     PP P      PP PV   P+ P+P  P
Sbjct: 951  PPPPSPAPPSPAPPSPTPPSPVPPSPAPPSPDPP 984

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 35/91 (38%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT-VPPVV 321
            P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP +  PP  
Sbjct: 882  PSLEPPSPAPPSPA-PPSPEPPSPAPPSPAPPSPQPPSPEPPSPEPPSPPPPPSPAPPSP 940

Query: 322  KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P  P   P  PP P    P+ P+PT P
Sbjct: 941  APPSPEPPSPPP--PPSPAPPSPAPPSPTPP 969

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 36/90 (40%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP  VPP   PP   PP   PP   P  + PP   
Sbjct: 984  PSPAPPSPDPPSPA-PPSPAPPSPNPPSPVPP--TPPSPGPPSPEPPSPAP--SPPPPTP 1038

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PT PP P   P  P  P   PP  P+P  P
Sbjct: 1039 PTSPPPPPPEPPSPEPPSPAPPLPPSPEPP 1068

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 34/92 (36%), Positives = 41/92 (44%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P+   P+  P  P  PP   PP  +P  + PP  +PP   PP   PP   PP   PP 
Sbjct: 1156 PSPEPVPPTPPPSPPA-PPSPAPPSPQP--LEPPSPEPPSPAPPSPAPPSPAPPSPEPPS 1212

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P  P  P   P  P  P   PPS P P +P
Sbjct: 1213 PEPPSPEPPSPAPPSPAPPSPAPPS-PAPPSP 1243

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP  +
Sbjct: 789  PSPAPPSPEPPSPA-PPSPAPPSPEPPSPSPPA--PPSPEPPSPAPPSPFPPSPQPPSPE 845

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 846  PPSPAPPSPVPPSPAPPSPAPPS-PEPPSP 874

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 35/91 (38%), Positives = 42/91 (46%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVT-VPPITVPPVV 321
            P    PS  P  P +PP   PP   PP   PP  +PP   PP   PP +  PP   PP  
Sbjct: 887  PSPAPPSPAPPSP-EPPSPAPPSPAPPSPQPPSPEPPSPEPPSPPPPPSPAPPSPAPPSP 945

Query: 322  KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            +P  PP P  +P  PP P    P+ P+P  P
Sbjct: 946  EPPSPP-PPPSP-APPSPAPPSPTPPSPVPP 974

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 33/90 (36%), Positives = 36/90 (40%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP  +
Sbjct: 756  PSPAPPSPAPPSPA-PPSPAPPSPAPPA--PPSPEPPSPAPPSPEPPSPAPPSPAPPSPE 812

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P      PP P    P  P+P  P
Sbjct: 813  PPSPSPPAPPSPEPPSPAPPSPFPPSPQPP 842

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 35/90 (38%), Positives = 37/90 (41%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 794  PSPEPPSPAPPSPA-PPSPEPPSPSPPA--PPSPEPPSPAPPSPFPPSPQPPSPEPPSPA 850

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 851  PPSPVPPSPAPPSPAPPSPEPPS-PEPPSP 879

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 35/90 (38%), Positives = 40/90 (44%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP  VPP    PG  PP  +PP   P  + PP T P    PP  +
Sbjct: 994  PSPAPPSPAPPSP-NPPSPVPPTPPSPG--PPSPEPPS--PAPSPPPPTPPTSPPPPPPE 1048

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P LPP P    P+ P+P  P
Sbjct: 1049 PPSPEPPSPAPPLPPSPEPPSPAPPSPAPP 1078

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 33/90 (36%), Positives = 34/90 (37%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 718 PSPAPPSPAPPSPA-PPSPAPPA--PPSPEPPSPAPPSPEPPSPAPPSPAPPSPAPPSPA 774

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P      PP P    P  P+P  P
Sbjct: 775 PPSPAPPAPPSPEPPSPAPPSPEPPSPAPP 804

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 34/92 (36%), Positives = 37/92 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P+     P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 766  PSPAPPSPAPPSPAPPAPPSPEPPSPAPPSPEPPSPAPPSPAPPSPEPPSPSPP--APPS 823

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P  P  P   P  P  P   PPS P P +P
Sbjct: 824  PEPPSPAPPSPFPPSPQPPSPEPPS-PAPPSP 854

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 35/93 (37%), Positives = 38/93 (40%), Gaps = 3/93 (3%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPV--KPPGIVPPIVKPPGIVPPIVKPPVILPPVT-VPPVTVPPITVPP 315
            P    PS  P  PV   PP   PP  +PP    P   PP   PP +  PP   PP   PP
Sbjct: 999  PSPAPPSPNPPSPVPPTPPSPGPPSPEPPS---PAPSPPPPTPPTSPPPPPPEPPSPEPP 1055

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P LPP P      PP P    P  P+P  P
Sbjct: 1056 SPAPPLPPSPEPPSPAPPSPAPPSPQPPSPAPP 1088

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 32/93 (34%), Positives = 38/93 (40%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPG-KPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P P    P   P  +P  P  ++PP   PP   PP   PP  LP     P  VPP   P 
Sbjct: 1110 PAPPSPSPPAPPSPEPPSPAPLLPPSPDPPSPAPPSPMPPP-LPTSPPSPEPVPPTPPPS 1168

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P  P  P   P+ PP P    P+ P+P  P
Sbjct: 1169 PPAPPSPAPPSPQPLEPPSPEPPSPAPPSPAPP 1201

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 35/93 (37%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGI-VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P+P    PS +P  P  PP    PP   PP   P  ++PP   PP   PP   PP   PP
Sbjct: 1150 PLPTS-PPSPEPVPPTPPPSPPAPPSPAPPS--PQPLEPPSPEPPSPAPPSPAPPSPAPP 1206

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              +P  P  P   P  P  P   PPS P P +P
Sbjct: 1207 SPEPPSPEPPSPEPPSPAPPSPAPPS-PAPPSP 1238

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 32/109 (29%), Positives = 41/109 (37%), Gaps = 17/109 (15%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPG--------IVPPIVKPPGIVPPIVKPPVI---------LP 267
            P P+   P+     P  PP         ++PP   PP   PP   PP +         +P
Sbjct: 1103 PSPEPPSPAPPSPSPPAPPSPEPPSPAPLLPPSPDPPSPAPPSPMPPPLPTSPPSPEPVP 1162

Query: 268  PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P    PP   PP  +P  PP P      PP P    P+ P+P  P
Sbjct: 1163 PTPPPSPPAPPSPAPPSPQPLEPPSPEPPSPAPPSPAPPSPAPPSPEPP 1211

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 31/89 (34%), Positives = 34/89 (38%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P+     P  PP   PP+  PP    P   P  + PP    P   PP   PP 
Sbjct: 1319 PSPTPPAPAPAAALPPLPPSPAPPLPVPP--ASPAPSPSPLRPPQPQTPAMPPPSPAPPS 1376

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              P  P  PGV    PP P   PP  P P
Sbjct: 1377 PAPPSPAPPGVP---PPPPTPTPPLAPLP 1402

[114][TOP]
>UniRef100_Q4VT16 Arabinogalactan protein (Fragment) n=1 Tax=Pinus contorta
           RepID=Q4VT16_PINCO
          Length = 153

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 35/91 (38%), Positives = 43/91 (47%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P+       KP P    P+K P    KPP + P   K P   PP+  PPV + PV  P
Sbjct: 62  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAP--AKAPVSAPPVATPPVAVXPVATP 119

Query: 283 PVTVPPITVPPVVKPTLPPIPGVTPILPPVP 375
           PV  PP+ VPP   P +PP     P+  P P
Sbjct: 120 PVAAPPVAVPPASPPAIPP-----PVQAPAP 145

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/113 (31%), Positives = 46/113 (40%), Gaps = 10/113 (8%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP--PGIVP-----PIVKPPGIVPPIVKPPV 258
           + AP     T   P      P+  P KP  P  P + P     P+  P    PP  KPP 
Sbjct: 34  TTAPAAPVSTPKPPTTTPVAPAVAPTKPAPPVAPAVAPTKPAPPVTAPTKAPPPTTKPPA 93

Query: 259 ILP---PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           + P   PV+ PPV  PP+ V PV  P +   P   P   P  +  P   P P+
Sbjct: 94  VAPAKAPVSAPPVATPPVAVXPVATPPVAAPPVAVPPASPPAIPPPVQAPAPS 146

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 42/124 (33%), Positives = 52/124 (41%), Gaps = 13/124 (10%)
 Frame = +1

Query: 73  LFLCML-FLSSAAPILGCGTCGKPV-PKKHKPSKKPGKPV---KPPGIVP--PIVKPPGI 231
           ++LC+  F +   P++       P  P    P+  P  PV   KPP   P  P V P   
Sbjct: 2   VWLCIASFSNGEEPVVDTVLATAPAAPTAXAPTTAPAAPVSTPKPPTTTPVAPAVAPTKP 61

Query: 232 VPPI---VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTPILPPVPVLNPPS 393
            PP+   V P    PPVT P    PP T PP V P   P+   P  TP +   PV  PP 
Sbjct: 62  APPVAPAVAPTKPAPPVTAPTKAPPPTTKPPAVAPAKAPVSAPPVATPPVAVXPVATPPV 121

Query: 394 TPTP 405
              P
Sbjct: 122 AAPP 125

[115][TOP]
>UniRef100_Q39614 Cuscuta reflexa proline-rich protein n=1 Tax=Cuscuta reflexa
           RepID=Q39614_CUSRE
          Length = 329

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 47/100 (47%), Positives = 55/100 (55%), Gaps = 8/100 (8%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKP-VKPPGIV-PPIVKPPGI--VPPIVKPPVILPPVTV-PPVTVPPI 303
           P P   KP   P KP V PP +  PP+V PP +  +PPIV PPV+ PP  V PPV +PP 
Sbjct: 70  PKPPTVKPPHLPPKPPVYPPHVPNPPVVTPPTVPRLPPIVTPPVVKPPPIVEPPVVIPPP 129

Query: 304 TV---PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            +   PPV  P +P  P VTP  P VP L P  TP    P
Sbjct: 130 HIPPQPPVYPPYIPNPPVVTP--PTVPKLPPIVTPPVVKP 167

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 45/104 (43%), Positives = 56/104 (53%), Gaps = 16/104 (15%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIV-PPIVKPPGI--VPPIVKPPVIL-PPVTVPPVTVPPITV 309
           +P  H P   P  PV PP I  PP+V PP +  +PPIV PPV+  PP+  PPV +PP  V
Sbjct: 126 IPPPHIP---PQPPVYPPYIPNPPVVTPPTVPKLPPIVTPPVVKPPPIVEPPVVIPPPVV 182

Query: 310 ---------PPVVKPTLPPIPGVTP---ILPPVPVLNPPSTPTP 405
                    PPV  P +P  P VTP   ++P   VL PP  P+P
Sbjct: 183 KPPPHIQPQPPVYPPYIPNPPVVTPPPIVIPTRQVLPPPYVPSP 226

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 46/112 (41%), Positives = 55/112 (49%), Gaps = 20/112 (17%)
 Frame = +1

Query: 139 PVPKKHKPSKK----PGKPVKPPGIVPPIVKPPGIV-PPIVKPPVILPP----------- 270
           PV   H P+      P  P  PP + PP+VKPP IV PP+V PP  +PP           
Sbjct: 85  PVYPPHVPNPPVVTPPTVPRLPPIVTPPVVKPPPIVEPPVVIPPPHIPPQPPVYPPYIPN 144

Query: 271 --VTVPPVT--VPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             V  PP    +PPI  PPVVKP  PPI     ++PP PV+ PP    P  P
Sbjct: 145 PPVVTPPTVPKLPPIVTPPVVKP--PPIVEPPVVIPP-PVVKPPPHIQPQPP 193

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 41/91 (45%), Positives = 47/91 (51%), Gaps = 9/91 (9%)
 Frame = +1

Query: 160 PSKKPGKP-VKPPGIV-PPIVKPPGI--VPPIVKPPVILPPVTVPPVT--VPPITVPPVV 321
           P   P  P VKPP    PP VKPP +   PP+  P V  PPV  PP    +PPI  PPVV
Sbjct: 55  PPHFPKPPTVKPPHFPKPPTVKPPHLPPKPPVYPPHVPNPPVVTPPTVPRLPPIVTPPVV 114

Query: 322 KP---TLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP     PP+    P +PP P + PP  P P
Sbjct: 115 KPPPIVEPPVVIPPPHIPPQPPVYPPYIPNP 145

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 42/108 (38%), Positives = 53/108 (49%), Gaps = 6/108 (5%)
 Frame = +1

Query: 109 PILGCGTCGKPVPKKHKPSKKPGKPVKPPGIV-PPIVKPPGIVPPIVKPPVILPPVTVPP 285
           P++   T  K  P    P  KP   V+PP ++ PP+VKPP  + P  +PPV  P +  PP
Sbjct: 146 PVVTPPTVPKLPPIVTPPVVKPPPIVEPPVVIPPPVVKPPPHIQP--QPPVYPPYIPNPP 203

Query: 286 VTVPPITVPPVVKPT---LPP--IPGVTPILPPVPVLNPPSTPTPTTP 414
           V  P    PP+V PT   LPP  +P   P   P P   PP    PT P
Sbjct: 204 VVTP----PPIVIPTRQVLPPPYVPSPPPDEKPCP---PPPEKQPTCP 244

[116][TOP]
>UniRef100_B9GHP4 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GHP4_POPTR
          Length = 223

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 38/85 (44%), Positives = 44/85 (51%), Gaps = 2/85 (2%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGI-VPPIVKPPGIVPPIVKPPVILPPVT-VPPVTVPPITVPPVVKPTL 333
           P   P  PVKPP    PP+ KPP   PP+  P  + PP T  PPV  PP   PPV  PT 
Sbjct: 59  PPVNPPTPVKPPTTPAPPVYKPPSPAPPVNPPTPVKPPTTPAPPVYKPPSPAPPVNPPT- 117

Query: 334 PPIPGVTPILPPVPVLNPPSTPTPT 408
            P+P V P   P P +  P +P PT
Sbjct: 118 -PVPPVKPPTAPAPPVYKPPSPAPT 141

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 42/93 (45%), Positives = 46/93 (49%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVK-PPVILPPVTVPPVTVPPITVPPV 318
           P   KP   P  PV KPP   PP+  P  + PP    PPV  PP   PPV  PP  VPPV
Sbjct: 64  PTPVKPPTTPAPPVYKPPSPAPPVNPPTPVKPPTTPAPPVYKPPSPAPPVN-PPTPVPPV 122

Query: 319 VKPTLPPIPGVTPILP---PVPVLNPPST-PTP 405
             PT P  P   P  P   PVP + PP+T P P
Sbjct: 123 KPPTAPAPPVYKPPSPAPTPVPPVKPPTTGPMP 155

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 39/97 (40%), Positives = 44/97 (45%), Gaps = 7/97 (7%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPI-----VKPPVI-LPPVTVPPVTVPPI 303
           P    P   P  P+ KPP   PP VK P   PP+     VKPP    PPV  PP   PP+
Sbjct: 29  PTPAPPVVTPSTPLYKPPTPAPP-VKTPPPAPPVNPPTPVKPPTTPAPPVYKPPSPAPPV 87

Query: 304 TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  VKP   P P V     P P +NPP+   P  P
Sbjct: 88  NPPTPVKPPTTPAPPVYKPPSPAPPVNPPTPVPPVKP 124

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 42/100 (42%), Positives = 46/100 (46%), Gaps = 15/100 (15%)
 Frame = +1

Query: 160 PSKKPGKP-VKPPGIVPPIV-------KPPGIVPPIVKPPVILPPVTVPPVTVPPIT-VP 312
           P+  P  P VK P   PP+V       KPP   PP VK P   PPV  P    PP T  P
Sbjct: 17  PASTPAPPEVKSPTPAPPVVTPSTPLYKPPTPAPP-VKTPPPAPPVNPPTPVKPPTTPAP 75

Query: 313 PVVKP--TLPPIPGVTPILPPV----PVLNPPSTPTPTTP 414
           PV KP    PP+   TP+ PP     PV  PPS   P  P
Sbjct: 76  PVYKPPSPAPPVNPPTPVKPPTTPAPPVYKPPSPAPPVNP 115

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 40/96 (41%), Positives = 44/96 (45%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKP--PGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P P  +KP   P  PV PP  V P   P  P   PP   PPV  PP  VPPV  P    P
Sbjct: 73  PAPPVYKPPS-PAPPVNPPTPVKPPTTPAPPVYKPPSPAPPV-NPPTPVPPVKPPTAPAP 130

Query: 313 PVVKPTLPPIPGVTPILPPV--PVLNPPSTPTPTTP 414
           PV KP  P    V P+ PP   P+  P  T +  TP
Sbjct: 131 PVYKPPSPAPTPVPPVKPPTTGPMPPPVRTRSDCTP 166

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/89 (37%), Positives = 37/89 (41%)
 Frame = +1

Query: 148 KKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKP 327
           +K     K   P   P   PP VK P   PP+V P     P+  PP   PP+  PP   P
Sbjct: 6   RKQAVFSKSVVPASTPA--PPEVKSPTPAPPVVTPST---PLYKPPTPAPPVKTPPPAPP 60

Query: 328 TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP P   P  P  PV  PPS   P  P
Sbjct: 61  VNPPTPVKPPTTPAPPVYKPPSPAPPVNP 89

[117][TOP]
>UniRef100_B6T7M1 36.4 kDa proline-rich protein n=1 Tax=Zea mays RepID=B6T7M1_MAIZE
          Length = 213

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 51/136 (37%), Positives = 70/136 (51%), Gaps = 15/136 (11%)
 Frame = +1

Query: 46  MESSKIHAYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPP 225
           M+S+K+ A L L ML LSS+   L      K  P+ +  S + G P      +PPI  P 
Sbjct: 1   MDSTKLSALLALAMLALSSSPLALAWE---KAEPECN--SCESGSPPSTGVPLPPISIPS 55

Query: 226 GIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPI-LPPVPVLN------ 384
             +PPI  P V LPPV++P V +PP+T        LPP+ G+ P+ LPP+P++       
Sbjct: 56  VPLPPISIPSVPLPPVSIPSVPIPPVT-------ELPPVVGLPPVTLPPIPIIGGSPPKK 108

Query: 385 --------PPSTPTPT 408
                   PPS PTPT
Sbjct: 109 GHRKACPPPPSPPTPT 124

[118][TOP]
>UniRef100_Q948Y7 VMP3 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q948Y7_VOLCA
          Length = 687

 Score = 64.3 bits (155), Expect(2) = 3e-11
 Identities = 35/85 (41%), Positives = 37/85 (43%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   P  PP
Sbjct: 575 PSPNPPSP-DPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPP 633

Query: 340 IPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  PP P   PP+ P P+ P
Sbjct: 634 PPNPPPPSPPPPSPRPPTPPPPSPP 658

 Score = 27.3 bits (59), Expect(2) = 3e-11
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = +2

Query: 98  PLPPPFSVAAPAVSPSQRNTSPAKSPASP 184
           P PPP S  +P  SPS  + + A  P SP
Sbjct: 544 PSPPPPSPPSPPTSPSPPDPAWANLPTSP 572

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  + PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 575 PSPNPPSPDPPSP-DPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPP 633

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  P  P   PPS P P  P
Sbjct: 634 PPNPPPPSPPPPSPRPPTPPPPSPPPPRPP 663

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/92 (36%), Positives = 35/92 (38%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P      +P    PP   PP   PP   PP   PP   PP   PP 
Sbjct: 547 PPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPN 606

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P  P
Sbjct: 607 PPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPP 638

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 36/84 (42%), Positives = 36/84 (42%)
 Frame = +1

Query: 163 SKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI 342
           S  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   P  PP 
Sbjct: 571 SPDPPSP-NPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPP 629

Query: 343 PGVTPILPPVPVLNPPSTPTPTTP 414
           P   P  PP P   PPS P P TP
Sbjct: 630 PSPPPPNPPPPSPPPPS-PRPPTP 652

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 34/92 (36%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP    P       +P    PP   PP   PP   PP   PP 
Sbjct: 537 PRPPPPDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPDPPSPDPPSAPPPS 596

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 597 PPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPP 628

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 34/96 (35%), Positives = 37/96 (38%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P     PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 587 PDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPS 646

Query: 319 VKPTLPPIPGV----TPILPPVPVLNPPSTPTPTTP 414
            +P  PP P       P  PP    +PP T +P  P
Sbjct: 647 PRPPTPPPPSPPPPRPPPRPPPTRRSPPPTSSPPPP 682

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 35/88 (39%), Positives = 35/88 (39%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 585 PSPDPPSAPPPSP-PPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPP 643

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           P  P  P   P  PP P   PP  P PT
Sbjct: 644 PPSPRPPTPPPPSPPPP--RPPPRPPPT 669

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 34/84 (40%), Positives = 36/84 (42%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           PS  P  P  PP   PP   PP  VPP   PP   PP +  P   PP    P   P  PP
Sbjct: 476 PSAPPSPP--PPSPPPPRPPPPSPVPP-TPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPP 532

Query: 340 IPGVTPILPPVPVLNPPSTPTPTT 411
            P      PP P   PPS P+P T
Sbjct: 533 RPSSPRPPPPDPSPPPPSPPSPPT 556

[119][TOP]
>UniRef100_Q8LBI7 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8LBI7_ARATH
          Length = 275

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/98 (43%), Positives = 50/98 (51%), Gaps = 7/98 (7%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKP-VKPPGIVPPIVKPPGIVPPIVKPPVILP--PVTVPPVTVPPITVP 312
           +P    P+ KP  P VKPP + PP  KPP    P VKPP   P  P T PPV  PP+  P
Sbjct: 99  LPPVQPPTYKPPTPTVKPPSVQPPTYKPP---TPTVKPPTTSPVKPPTTPPVQSPPVQPP 155

Query: 313 PVVKPTLPPIPGVT--PILPP--VPVLNPPSTPTPTTP 414
               PT P  P  T  P+ PP   P + PP+   PTTP
Sbjct: 156 TYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTP 193

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 51/143 (35%), Positives = 67/143 (46%), Gaps = 18/143 (12%)
 Frame = +1

Query: 40  ISMESSKIHAYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKP-VKPP--GIVPP 210
           +S+ S  I  ++F  ++F +S        +   P      P+ KP  P +KPP     PP
Sbjct: 3   LSLLSVFIFFHVFTNVVFAASNEESKALVSLPTPTLPSPSPATKPPSPALKPPTPSYKPP 62

Query: 211 IVKPPGIVPPIVKPPVILPPVTV----PPVTVPPITVPPVVKPTL-PPIPGVTP------ 357
            +    I PP  KPPV  P  +V    PPV+ PPI +PPV  PT  PP P V P      
Sbjct: 63  TLPTTPIKPPTTKPPVKPPTTSVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPP 122

Query: 358 -ILPPVPVLNPPST---PTPTTP 414
              PP P + PP+T     PTTP
Sbjct: 123 TYKPPTPTVKPPTTSPVKPPTTP 145

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 46/132 (34%), Positives = 55/132 (41%), Gaps = 39/132 (29%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPI---------VKPPGIVPPI--------------- 243
           KP    +KP   P  P+KPP   PP+         VKPP   PPI               
Sbjct: 53  KPPTPSYKPPTLPTTPIKPPTTKPPVKPPTTSVTPVKPPVSTPPIKLPPVQPPTYKPPTP 112

Query: 244 -VKPPVILPPVTVPPV-TVPPITVPPVVKPTLPPI-----------PGVTPILPP--VPV 378
            VKPP + PP   PP  TV P T  PV  PT PP+           P  +P+ PP   P 
Sbjct: 113 TVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPP 172

Query: 379 LNPPSTPTPTTP 414
           + PP+T  P  P
Sbjct: 173 VKPPTTTPPVQP 184

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/96 (44%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPG--KPVKPPGIVPPIVKPPGIVPPIVKPPV--ILPPVTVPPVTVPPIT 306
           P  K   P+ KP    PVKPP   PP+  PP + PP  KPP   + PP T PPV  PP T
Sbjct: 122 PTYKPPTPTVKPPTTSPVKPP-TTPPVQSPP-VQPPTYKPPTSPVKPPTTTPPVK-PPTT 178

Query: 307 VPPVVKPTLPPIPGVTPILPPV-PVLNPPSTPTPTT 411
            PPV  PT  P    TP+ PP  P + PP+ P   T
Sbjct: 179 TPPVQPPTYNP--PTTPVKPPTAPPVKPPTPPPVRT 212

[120][TOP]
>UniRef100_C0Z2Q6 AT5G14920 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2Q6_ARATH
          Length = 233

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 45/104 (43%), Positives = 52/104 (50%), Gaps = 12/104 (11%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKP-VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           P  K   P+ KP  P  KPP +    +KPP   PP VKPP I      PPV+ PPI +PP
Sbjct: 43  PATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPP-VKPPTIPVTPVKPPVSTPPIKLPP 101

Query: 316 VVKPTL-PPIPGVTP-------ILPPVPVLNPPST---PTPTTP 414
           V  PT  PP P V P         PP P + PP+T     PTTP
Sbjct: 102 VQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTP 145

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 44/107 (41%), Positives = 51/107 (47%), Gaps = 14/107 (13%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPI---------VKPPGIVPPIVKPPVILPPVTVPPV 288
           KP    +KP   P  P+KPP   PP+         VKPP   PPI  PPV  P    P  
Sbjct: 53  KPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTP 112

Query: 289 TV-PPITVPPVVKPTLPPI--PGVTPILPPV--PVLNPPSTPTPTTP 414
           TV PP   PP  KP  P +  P  +P+ PP   PV +PP  P PT P
Sbjct: 113 TVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQP-PTAP 158

 Score = 67.0 bits (162), Expect(2) = 1e-10
 Identities = 42/93 (45%), Positives = 48/93 (51%), Gaps = 8/93 (8%)
 Frame = +1

Query: 157 KPSKKPGKPVKPPGIVPPI----VKPPGIVP--PIVKPPVILPPVTVPPV-TVPPITVPP 315
           KP   P  PVKPP   PPI    V+PP   P  P VKPP + PP   PP  TV P T  P
Sbjct: 79  KPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSP 138

Query: 316 VVKPTLPPIPGVTPILPP-VPVLNPPSTPTPTT 411
           V  PT PP+    P+ PP  P + PP+ P   T
Sbjct: 139 VKPPTTPPVQS-PPVQPPTAPPVKPPTPPPVRT 170

 Score = 22.7 bits (47), Expect(2) = 1e-10
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +2

Query: 77  SSACSSSPLPPPFSVAAPAVSPSQRNTSPAKSPASP 184
           S+A  S P P       P+ SP+ +  SPA  P +P
Sbjct: 27  SNALVSLPTP-----TLPSPSPATKPPSPALKPPTP 57

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 35/73 (47%), Positives = 40/73 (54%), Gaps = 6/73 (8%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKP-VKPPGIVPPIVKPPGIVPPIVKPPVILP--PVTVPPVTVPPI--- 303
           +P    P+ KP  P VKPP + PP  KPP    P VKPP   P  P T PPV  PP+   
Sbjct: 99  LPPVQPPTYKPPTPTVKPPSVQPPTYKPP---TPTVKPPTTSPVKPPTTPPVQSPPVQPP 155

Query: 304 TVPPVVKPTLPPI 342
           T PPV  PT PP+
Sbjct: 156 TAPPVKPPTPPPV 168

[121][TOP]
>UniRef100_B4NRE3 GK24079 n=1 Tax=Drosophila willistoni RepID=B4NRE3_DROWI
          Length = 228

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 39/112 (34%), Positives = 62/112 (55%), Gaps = 13/112 (11%)
 Frame = +1

Query: 109 PILGCGTCGKPVPKK--------HKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVIL 264
           P+L     G+P+P          H P   P  P+ PP +  P++ PP + PP+++PP++ 
Sbjct: 40  PLLHTPLLGQPLPHSPLPGPPLLHPPLLGP-PPLHPPLLGQPLLHPPLLGPPLLRPPLLG 98

Query: 265 PPVTVPPVTVPPITVPPVVKPTL--PPIPGVTPILPPV---PVLNPPSTPTP 405
           PP+  PP+  PP+  PP++ P L  PP+PG   + PP+   P+L+PP    P
Sbjct: 99  PPLLYPPLPGPPLLHPPLLGPPLLYPPLPGPPLLHPPLLGQPLLHPPLLGPP 150

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +1

Query: 190 PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPP 369
           PP + PP++ PP + PP+  PP++ PP+  PP+  PP+  PP++ P L   P + P L  
Sbjct: 89  PPLLRPPLLGPPLLYPPLPGPPLLHPPLLGPPLLYPPLPGPPLLHPPLLGQPLLHPPLLG 148

Query: 370 VPVLNPPST-PTPTTP 414
            P+L+PP   P P  P
Sbjct: 149 PPLLHPPLLGPPPLHP 164

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 38/117 (32%), Positives = 59/117 (50%), Gaps = 18/117 (15%)
 Frame = +1

Query: 109 PILGCGTCGKPV---PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
           P+LG      P+   P  H P   P   ++PP + PP++ PP   PP++ PP++ PP+  
Sbjct: 65  PLLGPPPLHPPLLGQPLLHPPLLGPPL-LRPPLLGPPLLYPPLPGPPLLHPPLLGPPLLY 123

Query: 280 PPVTVPPITVPPVVKPTL------------PPIPGVTPILPPV---PVLNPPSTPTP 405
           PP+  PP+  PP++   L            PP+ G  P+ PP+   P+L+PP    P
Sbjct: 124 PPLPGPPLLHPPLLGQPLLHPPLLGPPLLHPPLLGPPPLHPPLLGQPLLHPPLLGPP 180

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 8/89 (8%)
 Frame = +1

Query: 172 PGKPVK------PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTL 333
           PG P+       PP + PP+  PP + PP++  P++ PP+  PP+  PP+  PP   P  
Sbjct: 107 PGPPLLHPPLLGPPLLYPPLPGPPLLHPPLLGQPLLHPPLLGPPLLHPPLLGPP---PLH 163

Query: 334 PPIPGVTPILPPVPVLNPP--STPTPTTP 414
           PP+ G  P+L P P+L PP   +P P  P
Sbjct: 164 PPLLG-QPLLHP-PLLGPPLLRSPLPGPP 190

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 31/80 (38%), Positives = 48/80 (60%), Gaps = 7/80 (8%)
 Frame = +1

Query: 172 PGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTL--PPI 342
           PG P+  PP +  P++ PP + PP++ PP++ PP   PP+   P+  PP++ P L   P+
Sbjct: 127 PGPPLLHPPLLGQPLLHPPLLGPPLLHPPLLGPPPLHPPLLGQPLLHPPLLGPPLLRSPL 186

Query: 343 PGV----TPILPPVPVLNPP 390
           PG     TP+L   P+L+PP
Sbjct: 187 PGPPLLHTPLLGQ-PLLHPP 205

[122][TOP]
>UniRef100_Q9ZQI0 Putative uncharacterized protein At2g27380 n=1 Tax=Arabidopsis
           thaliana RepID=Q9ZQI0_ARATH
          Length = 761

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 42/101 (41%), Positives = 54/101 (53%), Gaps = 8/101 (7%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPP--IVKPPGIVPPIVKP--PVILPPVTVPPVTVPPI 303
           KP P +  P+     P+KPP + PP  I  PP   PP+ KP  P+  PPV  PPV  PP 
Sbjct: 320 KPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPT 379

Query: 304 TV--PPVVKPTL--PPIPGVTPILPPVPVLNPPSTPTPTTP 414
            +  PPV  P +  PP P  +P + P P+  PP TPT + P
Sbjct: 380 PIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPP-TPTYSPP 419

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 43/106 (40%), Positives = 53/106 (50%), Gaps = 13/106 (12%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIV--PPIVKPPVILPPVTV--PPVTVPPI 303
           KP P    P+     P+KPP    P+ KPP     PP+  PPV LPP     PPV  PP+
Sbjct: 639 KPPPVHKPPTPTYSPPIKPP----PVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPV 694

Query: 304 TVPPV------VKPT---LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            VPP       VKP    +PP P  +P + P PV  PP+  TP+ P
Sbjct: 695 QVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPP 740

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 39/93 (41%), Positives = 47/93 (50%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV--PPITVPP 315
           P K  P  KP  P+  PP   PP+ KPP    PI  PPV  PP+  PP     PPI  PP
Sbjct: 351 PVKPPPVHKPPTPIYSPPVKPPPVHKPP---TPIYSPPVKPPPIQKPPTPTYSPPIKPPP 407

Query: 316 VVKPTLP---PIPGVTPILPPVPVLNPPSTPTP 405
           + KP  P   P   + P+ PP P+ +PP  P P
Sbjct: 408 LQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPP 440

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 41/100 (41%), Positives = 50/100 (50%), Gaps = 7/100 (7%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPI--VKPPGIVPPIVKP--PVILPPVTVPPVTVPPI 303
           KP P    P+     P+KPP + PP     PP   PP+ KP  P   PPV  PP+  PP 
Sbjct: 454 KPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPT 513

Query: 304 -TVPPVVK--PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            T  P +K  P  PP P  +P + P PV  PP TPT + P
Sbjct: 514 PTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPP-TPTYSPP 552

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 40/92 (43%), Positives = 45/92 (48%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV--PPITVPPV 318
           P K  P +KP  P   P I  P VKPP    PI  PPV  PPV  PP  +  PP+  PPV
Sbjct: 402 PIKPPPLQKPPTPTYSPPIKLPPVKPP---TPIYSPPVKPPPVHKPPTPIYSPPVKPPPV 458

Query: 319 VKPTLP---PIPGVTPILPPVPVLNPPSTPTP 405
            KP  P   P     P+ PP P  +PP  P P
Sbjct: 459 HKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPP 490

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 42/100 (42%), Positives = 52/100 (52%), Gaps = 7/100 (7%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPP--IVKPPGIVPPIVKPP--VILPPVTVPPVTVPPI 303
           KP P +  P+     P+K P + PP  I  PP   PP+ KPP  +  PPV  PPV  PP 
Sbjct: 404 KPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPT 463

Query: 304 -TVPPVVKP--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            T  P +KP    PP P  +P + P PV  PP TPT + P
Sbjct: 464 PTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPP-TPTYSPP 502

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 5/95 (5%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV--PPITV 309
           KP P +  P+     PVKPP    P+ KPP    P   PPV  PPV  PP     PPI  
Sbjct: 269 KPPPVQTPPTPIYSPPVKPP----PVHKPP---TPTYSPPVKSPPVQKPPTPTYSPPIKP 321

Query: 310 PPVVKPTLP---PIPGVTPILPPVPVLNPPSTPTP 405
           PPV KP  P   P     P+ PP P+ +PP  P P
Sbjct: 322 PPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPP 356

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 42/102 (41%), Positives = 51/102 (50%), Gaps = 9/102 (8%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVKP--PVILPPVTVPPVTVPP 300
           KP P    P+     PVKPP +     PI  PP   PP+ KP  P+  PPV  PPV  PP
Sbjct: 218 KPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPP 277

Query: 301 ITV--PPVVKPTL--PPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +  PPV  P +  PP P  +P +   PV  PP TPT + P
Sbjct: 278 TPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPP-TPTYSPP 318

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/103 (42%), Positives = 53/103 (51%), Gaps = 13/103 (12%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPG------IVPPIVKP--PVILPPVTVPPVTVP 297
           P K  P +KP  P   PP   PP+ KPP       I PP VKP  P+  PPV  PPV  P
Sbjct: 301 PVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKP 360

Query: 298 PITV--PPVVKPTL--PPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  +  PPV  P +  PP P  +P + P P+  PP TPT + P
Sbjct: 361 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPP-TPTYSPP 402

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 40/101 (39%), Positives = 51/101 (50%), Gaps = 8/101 (7%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPI--VKPPGIVPPIVKP--PVILPPVTVPPVTVPPI 303
           KP P +  P+     P+KPP + PP     PP   PP+ KP  P   PP+  PP+  PP 
Sbjct: 504 KPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPT 563

Query: 304 -TVPPVVKPT---LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            T  P +KP     PP P  +P + P PV  PP TPT + P
Sbjct: 564 PTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP-TPTYSPP 603

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/116 (37%), Positives = 53/116 (45%), Gaps = 23/116 (19%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVKP--PVILPPVTVPPVTVPP 300
           KP P    P+     P+KPP +     P   PP   PP+ KP  P   PPV  PPV +PP
Sbjct: 622 KPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPP 681

Query: 301 I-TVPPVVKP---TLPPIPGVTPILPPVPVLNPPS--------------TPTPTTP 414
             T  P VKP    +PP P  +P + P PV  PP+               PTPTTP
Sbjct: 682 TPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTP 737

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 44/114 (38%), Positives = 53/114 (46%), Gaps = 24/114 (21%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIV--PPIVKPPVILPPVTV--PPVTVPPITVP 312
           P K  P  KP  P   P I PP+ KPP  +  PPI  PPV  PP  +  PP+  PP+  P
Sbjct: 166 PIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKP 225

Query: 313 PV------VKPT---LPPIPGVTPIL-------PPVPVLNPPSTP----TPTTP 414
           P       VKP     PP P  +P +       PP P+ +PP  P    TP TP
Sbjct: 226 PTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTP 279

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/96 (40%), Positives = 44/96 (45%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV--PPITVPPV 318
           P K  P  KP  P+  P + PP V+ P    PI  PPV  PPV  PP     PP+  PPV
Sbjct: 250 PIKPPPVHKPPTPIYSPPVKPPPVQTPPT--PIYSPPVKPPPVHKPPTPTYSPPVKSPPV 307

Query: 319 VKPTLP----PIPGVTPILPPVPVLNPPSTPTPTTP 414
            KP  P    PI       PP P  +PP  P P  P
Sbjct: 308 QKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKP 343

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/104 (37%), Positives = 47/104 (45%), Gaps = 14/104 (13%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGI-------VPPIVKPPGIVP--PIVKPPVILPPVTVPPV 288
           KP P    P+     PVKPP +         P +KPP + P  P   PPV  PPV  PP 
Sbjct: 437 KPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPT 496

Query: 289 TV--PPITVPPVVKPTLP---PIPGVTPILPPVPVLNPPSTPTP 405
               PP+  PP+ KP  P   P     P+ PP P  +PP  P P
Sbjct: 497 PTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPP 540

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 41/102 (40%), Positives = 50/102 (49%), Gaps = 9/102 (8%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVKP--PVILPPVTVPPVTVPP 300
           KP P    P+     P+KPP +     PI  PP   PP+  P  P+  PPV  PPV  PP
Sbjct: 235 KPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPP 294

Query: 301 ITV--PPVVKPTL--PPIPGVTPILPPVPVLNPPSTPTPTTP 414
                PPV  P +  PP P  +P + P PV  PP TPT + P
Sbjct: 295 TPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPP-TPTYSPP 335

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 40/102 (39%), Positives = 51/102 (50%), Gaps = 9/102 (8%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVKP--PVILPPVTVPPVTVPP 300
           KP P    P+     P+KPP +     P   PP   PP+ KP  P+  PP+  PPV  PP
Sbjct: 201 KPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPP 260

Query: 301 ITV--PPVVKPTL--PPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +  PPV  P +  PP P  +P + P PV  PP TPT + P
Sbjct: 261 TPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPP-TPTYSPP 301

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 44/103 (42%), Positives = 51/103 (49%), Gaps = 11/103 (10%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVKPPV------ILPPVTVPPVT 291
           P+ K   PS  P  PVKPP +     P   PP   PP+ KPP       I PPV  PP  
Sbjct: 137 PIQKPPTPSYSP--PVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTP 194

Query: 292 V--PPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           +  PPI  PPV K   PP P  +P + P PV  PP TPT + P
Sbjct: 195 IYSPPIKPPPVHK---PPTPIYSPPIKPPPVHKPP-TPTYSPP 233

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 39/109 (35%), Positives = 53/109 (48%), Gaps = 19/109 (17%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPG------IVPPIVKP--PVILPPVTVPPVT 291
           KP P +  P+     P+KPP    P+ KPP       I PP+ KP  P+  PP+  PPV 
Sbjct: 151 KPPPVQMPPTPTYSPPIKPP----PVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVH 206

Query: 292 VPPITV--PPVVKPTL--PPIPGVTPIL-------PPVPVLNPPSTPTP 405
            PP  +  PP+  P +  PP P  +P +       PP P+ +PP  P P
Sbjct: 207 KPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPP 255

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 41/102 (40%), Positives = 49/102 (48%), Gaps = 9/102 (8%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVKP--PVILPPVTVPPVTVPP 300
           KP P    P+     P+KPP I     P   PP   PP+ KP  P   PP+  PPV  PP
Sbjct: 537 KPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 596

Query: 301 I-TVPPVVKPT---LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             T  P +KP     PP P  +P + P PV  PP TPT + P
Sbjct: 597 TPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP-TPTYSPP 637

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 40/102 (39%), Positives = 49/102 (48%), Gaps = 9/102 (8%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVKP--PVILPPVTVPPVTVPP 300
           KP P    P+     P+KPP +     P   PP   PP+ KP  P   PP+  PPV  PP
Sbjct: 571 KPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 630

Query: 301 I-TVPPVVKPT---LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             T  P +KP     PP P  +P + P PV  PP TPT + P
Sbjct: 631 TPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPP-TPTYSPP 671

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 36/82 (43%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +1

Query: 172 PGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPG 348
           P  P+  PP   PPI KPP   PPI  PP+  PP    P   PPI  PP+ K   PP P 
Sbjct: 58  PPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPT---PTYSPPIYPPPIQK---PPTPT 111

Query: 349 VTPILPPVPVLNPPSTPTPTTP 414
            +P + P P+  PP TPT + P
Sbjct: 112 YSPPIYPPPIQKPP-TPTYSPP 132

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 39/105 (37%), Positives = 49/105 (46%), Gaps = 15/105 (14%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVKPPV--ILPPVTVPPVTVPP 300
           KP P    P+     PVKPP +     PI  PP   PPI KPP     PP+  PP+  PP
Sbjct: 353 KPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPP 412

Query: 301 ITV--PPV-VKPTLPPIPGVTPIL-------PPVPVLNPPSTPTP 405
                PP+ + P  PP P  +P +       PP P+ +PP  P P
Sbjct: 413 TPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPP 457

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 39/93 (41%), Positives = 43/93 (46%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIV--PPIVKPPVILPPVTVPPVTVPPITVPP 315
           P K  P  KP  P   PP   PP+ KPP     PPI  PPV  PP    P   PPI  PP
Sbjct: 284 PVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPT---PTYSPPIKPPP 340

Query: 316 VVKPT---LPPIPGVTPILPPVPVLNPPSTPTP 405
           V  PT    PP+       PP P+ +PP  P P
Sbjct: 341 VKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPP 373

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 41/102 (40%), Positives = 49/102 (48%), Gaps = 12/102 (11%)
 Frame = +1

Query: 145 PKKHKPSKKP----GKPVKPPGI---VPPIVKPPGIVPPIVKPPV--ILPPVTVPPVTVP 297
           P K  P K P      PVKPP +     PI  PP   PP+ KPP     PP+  PPV  P
Sbjct: 419 PIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPP 478

Query: 298 PITVPPVVKP---TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             T  P V+P     PP P  +P + P P+  PP TPT + P
Sbjct: 479 TPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPP-TPTYSPP 519

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 41/98 (41%), Positives = 44/98 (44%), Gaps = 9/98 (9%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIV--PPIVKPPGIVP--PIVKPPVILPPVTVPPVTV--PP 300
           P P    P K P  PVKPP     PP+  PP   P  P   PPV  PP+  PP     PP
Sbjct: 462 PTPTYSPPIKPP--PVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPP 519

Query: 301 ITVPPVVKPT---LPPIPGVTPILPPVPVLNPPSTPTP 405
           I  PPV  PT    PPI       PP P  +PP  P P
Sbjct: 520 IKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 557

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 42/105 (40%), Positives = 51/105 (48%), Gaps = 12/105 (11%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIV--PPIVKPPV------ILPPVTVPPVT 291
           +P P +  P+     PVKPP    PI KPP     PPI  PPV        PP+  PPV 
Sbjct: 487 QPPPVQKPPTPTYSPPVKPP----PIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVH 542

Query: 292 VPPITV--PPVVKPTL--PPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP     PP+  P +  PP P  +P + P PV  PP TPT + P
Sbjct: 543 KPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPP-TPTYSPP 586

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 39/106 (36%), Positives = 46/106 (43%), Gaps = 16/106 (15%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGI---VPPIVKPPGIVPPIVKP--PVILPPVTVPPV---- 288
           KP P    P+     P+KPP +     P   PP   PP+ KP  P   PP+  PPV    
Sbjct: 588 KPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 647

Query: 289 ---TVPPITVPPVVKPTL----PPIPGVTPILPPVPVLNPPSTPTP 405
                PPI  PPV KP      PP+      LPP P  +PP  P P
Sbjct: 648 TPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPP 693

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 39/102 (38%), Positives = 48/102 (47%), Gaps = 20/102 (19%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVK--------PPGIVPPIVKPPV--ILPPVTVPPVTVPPI-T 306
           P +KP  P   P I PP ++        PP   PPI KPP     PPV  PPV +PP  T
Sbjct: 103 PIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPT 162

Query: 307 VPPVVKPT---LPPIPGVTPIL------PPVPVLNPPSTPTP 405
             P +KP     PP P  +P +      PP P+ +PP  P P
Sbjct: 163 YSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPP 204

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 41/115 (35%), Positives = 52/115 (45%), Gaps = 2/115 (1%)
 Frame = +1

Query: 76  FLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPP--GIVPPIVKPPGIVPPIVK 249
           FL ++   S A +    T  +   K    S   G    PP  G  P    PP   PPI  
Sbjct: 11  FLVLILSLSGASVAADATVKQNFNKYETDS---GHAHPPPIYGAPPSYTTPP---PPIYS 64

Query: 250 PPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP+  PP+  PP   PPI  PP+ K   PP P  +P + P P+  PP TPT + P
Sbjct: 65  PPIYPPPIQKPPTYSPPIYPPPIQK---PPTPTYSPPIYPPPIQKPP-TPTYSPP 115

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 39/99 (39%), Positives = 49/99 (49%), Gaps = 14/99 (14%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVK--------PPGIVPPIVKP--PVILPPVTVPPVTVPPI-T 306
           P +KP  P   P I PP ++        PP   PPI KP  P   PP+  PP+  PP  +
Sbjct: 86  PIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPS 145

Query: 307 VPPVVKP---TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P VKP    +PP P  +P + P PV  PP TPT + P
Sbjct: 146 YSPPVKPPPVQMPPTPTYSPPIKPPPVHKPP-TPTYSPP 183

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 37/101 (36%), Positives = 47/101 (46%), Gaps = 7/101 (6%)
 Frame = +1

Query: 133 GKPVPKKHKPSKKPGKPVKPPGIV-PPIVKPPGIVPPIVKP--PVILPPVTVPPVTVPPI 303
           G P      P      P+ PP I  PP   PP   PPI KP  P   PP+  PP+  PP 
Sbjct: 50  GAPPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPT 109

Query: 304 TV--PPVVKPTL--PPIPGVTPILPPVPVLNPPSTPTPTTP 414
               PP+  P +  PP P  +P + P P+  PP TP+ + P
Sbjct: 110 PTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPP-TPSYSPP 149

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 36/89 (40%), Positives = 44/89 (49%), Gaps = 4/89 (4%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGI-VPPIVKPPGIVPPIVKPPVILPPVTV--PPVTVPPIT 306
           KP P +  P+     PVKPP + VPP    P   PP+  PPV +PP     PP+  PP+ 
Sbjct: 673 KPPPVQLPPTPTYSPPVKPPPVQVPPT---PTYSPPVKPPPVQVPPTPTYSPPIKPPPVQ 729

Query: 307 VPPVVKPTLPPIPGV-TPILPPVPVLNPP 390
           VPP      PP  G  TP  PP   L+ P
Sbjct: 730 VPPTPTTPSPPQGGYGTP--PPYAYLSHP 756

[123][TOP]
>UniRef100_Q39789 Proline-rich cell wall protein n=1 Tax=Gossypium hirsutum
           RepID=Q39789_GOSHI
          Length = 214

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 36/92 (39%), Positives = 40/92 (43%), Gaps = 4/92 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P     PP   PP   PP   PP   PP   PP T PP T PP T PP 
Sbjct: 77  PPPVSTPPPSSPPPATPPPASPPPATPPPASPPPATPPPASPPPATPPPATPPPATPPPA 136

Query: 319 VKPTLP--PIPGVTPILPPV--PVLNPPSTPT 402
             P  P    P   P + PV  P+ +PP+ PT
Sbjct: 137 TPPPAPLASPPATVPAISPVQTPLTSPPAPPT 168

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 44/131 (33%), Positives = 50/131 (38%), Gaps = 17/131 (12%)
 Frame = +1

Query: 73  LFLCMLFLSSAAPILG-------CGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPP-- 225
           LFL  L   + A +LG         T   P P    P      P  P    PP+  PP  
Sbjct: 8   LFLSALLCIAVAGVLGQAPSNPPTSTPATPTPPASTPPPTTQAPPTPTATPPPVSTPPPT 67

Query: 226 -------GIVPPI-VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVL 381
                     PP+   PP   PP T PP + PP T PP   P   P P   P   P P  
Sbjct: 68  SSPPPVTASPPPVSTPPPSSPPPATPPPASPPPATPPPASPPPATPPPASPPPATPPPAT 127

Query: 382 NPPSTPTPTTP 414
            PP+TP P TP
Sbjct: 128 PPPATPPPATP 138

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/91 (37%), Positives = 38/91 (41%), Gaps = 3/91 (3%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPP--ITVPPV 318
           P    P   P     PP   PP   PP   PP   PP   PP T PP T PP  +  PP 
Sbjct: 89  PPATPPPASPPPATPPPASPPPATPPPASPPPATPPPATPPPATPPPATPPPAPLASPPA 148

Query: 319 VKPTLPPIPGVTPIL-PPVPVLNPPSTPTPT 408
             P + P+   TP+  PP P   P   P PT
Sbjct: 149 TVPAISPVQ--TPLTSPPAP---PTEAPAPT 174

[124][TOP]
>UniRef100_Q39763 Proline-rich cell wall protein n=1 Tax=Gossypium barbadense
           RepID=Q39763_GOSBA
          Length = 214

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 36/92 (39%), Positives = 40/92 (43%), Gaps = 4/92 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P     PP   PP   PP   PP   PP   PP T PP T PP T PP 
Sbjct: 77  PPPVSTPPPSSPPPATPPPASPPPATPPPASPPPATPPPASPPPATPPPATPPPATPPPA 136

Query: 319 VKPTLP--PIPGVTPILPPV--PVLNPPSTPT 402
             P  P    P   P + PV  P+ +PP+ PT
Sbjct: 137 TPPPAPLASPPATVPAISPVQTPLTSPPAPPT 168

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 44/131 (33%), Positives = 50/131 (38%), Gaps = 17/131 (12%)
 Frame = +1

Query: 73  LFLCMLFLSSAAPILG-------CGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPP-- 225
           LFL  L   + A +LG         T   P P    P      P  P    PP+  PP  
Sbjct: 8   LFLSALLCIAVAGVLGQAPSNPPTSTPAPPTPPASTPPPTTQAPPTPTATPPPVSTPPPT 67

Query: 226 -------GIVPPI-VKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVL 381
                     PP+   PP   PP T PP + PP T PP   P   P P   P   P P  
Sbjct: 68  SSPPPVTASPPPVSTPPPSSPPPATPPPASPPPATPPPASPPPATPPPASPPPATPPPAT 127

Query: 382 NPPSTPTPTTP 414
            PP+TP P TP
Sbjct: 128 PPPATPPPATP 138

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/91 (37%), Positives = 38/91 (41%), Gaps = 3/91 (3%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPP--ITVPPV 318
           P    P   P     PP   PP   PP   PP   PP   PP T PP T PP  +  PP 
Sbjct: 89  PPATPPPASPPPATPPPASPPPATPPPASPPPATPPPATPPPATPPPATPPPAPLASPPA 148

Query: 319 VKPTLPPIPGVTPIL-PPVPVLNPPSTPTPT 408
             P + P+   TP+  PP P   P   P PT
Sbjct: 149 TVPAISPVQ--TPLTSPPAP---PTEAPAPT 174

[125][TOP]
>UniRef100_Q0CTV4 Predicted protein n=1 Tax=Aspergillus terreus NIH2624
           RepID=Q0CTV4_ASPTN
          Length = 355

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 41/104 (39%), Positives = 48/104 (46%), Gaps = 13/104 (12%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           VP  + P+  P     PP   PP   PP  VPP   PPV +PPV +PPV  P + +PP  
Sbjct: 177 VPPINPPAANPPPANPPPASAPPAQAPPANVPPANPPPVNVPPVNIPPVNPPTVNIPPPS 236

Query: 322 KPTLP---------PIPGVTPILPPV--PVLNPP--STPTPTTP 414
            P  P         P  G  P  PPV  PV  PP  +TP P  P
Sbjct: 237 PPCPPSGNIPPASIPPAGAPPAAPPVKIPVSVPPPVNTPPPKLP 280

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 44/116 (37%), Positives = 50/116 (43%), Gaps = 8/116 (6%)
 Frame = +1

Query: 82  CMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKP--VKPPGIVPPIVKPPGIVPPIVKPP 255
           C   L+S     G G  G   P     S  P  P  V  P  +P    PP  VPPI  P 
Sbjct: 125 CENKLTSPPQKKGIGKQGSSAPNPPAASNPPVNPAPVNLPPAIPAPANPPANVPPINPPA 184

Query: 256 VILPPVTVPPVTVPPITVPPV-VKPTLPPIPGVTPI-LPPV--PVLN--PPSTPTP 405
              PP   PP + PP   PP  V P  PP   V P+ +PPV  P +N  PPS P P
Sbjct: 185 ANPPPANPPPASAPPAQAPPANVPPANPPPVNVPPVNIPPVNPPTVNIPPPSPPCP 240

[126][TOP]
>UniRef100_O82066 Proline-rich protein n=1 Tax=Solanum tuberosum RepID=O82066_SOLTU
          Length = 491

 Score = 70.1 bits (170), Expect(2) = 5e-11
 Identities = 44/111 (39%), Positives = 50/111 (45%), Gaps = 21/111 (18%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKP-----------PGIVPPIVKP-----PVILPPVT 276
           PK   P KKP  P  P    PP+ KP           P   PP+VKP     PV  PPV 
Sbjct: 299 PKPEPPVKKPCPPSVPKPKPPPVKKPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVV 358

Query: 277 VPPVTVPPITVPPVVKPTLPPI-----PGVTPILPPVPVLNPPSTPTPTTP 414
            P     P+  PPVVKP  PP+     P V P+ PPVP+   P  P P  P
Sbjct: 359 KPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPIYKKPCPPFPHLP 409

 Score = 20.8 bits (42), Expect(2) = 5e-11
 Identities = 8/15 (53%), Positives = 8/15 (53%)
 Frame = +2

Query: 98  PLPPPFSVAAPAVSP 142
           PLPPP  V  P   P
Sbjct: 253 PLPPPVPVYKPKPKP 267

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 54/144 (37%), Positives = 63/144 (43%), Gaps = 51/144 (35%)
 Frame = +1

Query: 136 KPVPKK---HKPSKKPG----KPVKPPGIV--PPIVKP-----PGIVPPIVKP-----PV 258
           KP P K   +KP  KP     KP+ PP  V  PP+VKP     P   PP+VKP     PV
Sbjct: 323 KPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPV 382

Query: 259 ILPPVT----------------------VPPVTVP-----PITVPPVVKPTLPPI----- 342
             PPV                       +PP+  P     PI VPPVVKP  PP+     
Sbjct: 383 YKPPVVKPLPPPVPIYKKPCPPFPHLPPLPPIVKPLPPPVPIYVPPVVKPLPPPVPIYEP 442

Query: 343 PGVTPILPPVPVLNPPSTPTPTTP 414
           P V P+ PPVP+  PP    P  P
Sbjct: 443 PVVKPLPPPVPIYKPPFYKKPCPP 466

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 47/112 (41%), Positives = 52/112 (46%), Gaps = 17/112 (15%)
 Frame = +1

Query: 130 CGKPVPK-KHKPSKKPGKPVKP-----PGIVPPIVKPPGIVPPIVKPPVILP-----PVT 276
           C   VPK K  P KKP  P  P     P   PP+VKP     P+ KPPV+ P     PV 
Sbjct: 309 CPPSVPKPKPPPVKKPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVY 368

Query: 277 VPPVTVP-----PITVPPVVKPTLPPIPGVTPILPPVPVLNP-PSTPTPTTP 414
            PPV  P     P+  PPVVKP  PP+P      PP P L P P    P  P
Sbjct: 369 KPPVVKPLPPPVPVYKPPVVKPLPPPVPIYKKPCPPFPHLPPLPPIVKPLPP 420

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 43/103 (41%), Positives = 50/103 (48%), Gaps = 14/103 (13%)
 Frame = +1

Query: 139 PVPKKHKPSKK-PGKPVKPPGIVPPIVK-------PPGIVPPIVK----PPVILPPVTVP 282
           P PK H   KK P  P  PP  +PP+         PP  +PP+ K    PP++ PPV V 
Sbjct: 183 PFPKDHPWMKKFPKLPPFPP--MPPLKHWGHPFPLPP--IPPLFKKPCPPPLVKPPVPVY 238

Query: 283 PVTVPPITVPPVVKPTLPPIP--GVTPILPPVPVLNPPSTPTP 405
             T  P   PPVVKP  PP+P     P  PPVPV  P   P P
Sbjct: 239 NPTPKPTPEPPVVKPLPPPVPVYKPKPKPPPVPVYKPKPKPPP 281

 Score = 56.2 bits (134), Expect(2) = 7e-07
 Identities = 40/103 (38%), Positives = 46/103 (44%), Gaps = 13/103 (12%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKP-----PGIVPPIVKP-----PVILPPVTVPP 285
           KP+P      KKP  P      +PPIVKP     P  VPP+VKP     P+  PPV  P 
Sbjct: 389 KPLPPPVPIYKKPCPPFPHLPPLPPIVKPLPPPVPIYVPPVVKPLPPPVPIYEPPVVKPL 448

Query: 286 VTVPPITVPPVVKP---TLPPIPGVTPILPPVPVLNPPSTPTP 405
               PI  PP  K     LPP P + P   P+    PP  P P
Sbjct: 449 PPPVPIYKPPFYKKPCPPLPPFPKIPPFHHPLFPPLPPKIPHP 491

 Score = 20.4 bits (41), Expect(2) = 7e-07
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = +2

Query: 98  PLPPPFSVAAPAV 136
           PLPPP  V  P V
Sbjct: 345 PLPPPVPVYKPPV 357

[127][TOP]
>UniRef100_UPI0000F1E1DC PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI0000F1E1DC
          Length = 665

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 39/90 (43%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PVP    P+     PV P P  +PP+   P  +PP+   PV LPPV   PV +PP+T  P
Sbjct: 464 PVP----PAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPAPVQLPPVPPAPVQLPPVTPAP 519

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           V  P +PP P   P +PP PV  PP  P P
Sbjct: 520 VQLPPVPPAPVQLPPVPPAPVQLPPVPPAP 549

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 39/90 (43%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PVP    P+     PV P P  +PP+   P  +PP+   PV LPPVT  PV +PP+   P
Sbjct: 474 PVP----PAPVQLPPVPPTPVQLPPVPPAPVQLPPVPPAPVQLPPVTPAPVQLPPVPPAP 529

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           V  P +PP P   P +PP PV  PP  P P
Sbjct: 530 VQLPPVPPAPVQLPPVPPAPVQLPPVPPAP 559

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 35/76 (46%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +1

Query: 181 PVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTP 357
           PV P P  +PP+   P  +PP+   PV LPPV   PV +PP+   PV  P +PP P   P
Sbjct: 444 PVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPAPVQLP 503

Query: 358 ILPPVPVLNPPSTPTP 405
            +PP PV  PP TP P
Sbjct: 504 PVPPAPVQLPPVTPAP 519

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 38/90 (42%), Positives = 47/90 (52%), Gaps = 1/90 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PVP    P+     PV P P  +PP+   P  +PP+   PV LPPV   PV +PP+   P
Sbjct: 484 PVP----PTPVQLPPVPPAPVQLPPVPPAPVQLPPVTPAPVQLPPVPPAPVQLPPVPPAP 539

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           V  P +PP P   P +PP PV  PP  P P
Sbjct: 540 VQLPPVPPAPVQLPPVPPAPVQLPPVPPAP 569

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 31/71 (43%), Positives = 39/71 (54%)
 Frame = +1

Query: 193 PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPV 372
           P  +PP+   P  +PP+   PV LPPV   PV +PP+   PV  P +PP P   P +PP 
Sbjct: 439 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPA 498

Query: 373 PVLNPPSTPTP 405
           PV  PP  P P
Sbjct: 499 PVQLPPVPPAP 509

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/90 (41%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PVP    P+     PV P P  +PP+   P  +PP+   PV LPPV   PV +PP+   P
Sbjct: 444 PVP----PAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPAP 499

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           V  P +PP P   P + P PV  PP  P P
Sbjct: 500 VQLPPVPPAPVQLPPVTPAPVQLPPVPPAP 529

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/81 (41%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PVP    P+     PV P P  +PP+   P  +PP+   PV LPPV   PV +PP+   P
Sbjct: 494 PVP----PAPVQLPPVPPAPVQLPPVTPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAP 549

Query: 316 VVKPTLPPIPGVTPILPPVPV 378
           V  P +PP P   P +PP PV
Sbjct: 550 VQLPPVPPAPVQLPPVPPAPV 570

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 43/121 (35%), Positives = 56/121 (46%), Gaps = 5/121 (4%)
 Frame = +1

Query: 58  KIHAYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIV--PPIVKPPGI 231
           ++HA L + +  L+  AP+        PV     P      P  PP  V  PP+   P  
Sbjct: 423 RLHA-LPISLKLLALLAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQ 481

Query: 232 VPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPI---PGVTPILPPVPVLNPPSTPT 402
           +PP+   PV LPPV   PV +PP+   PV    LPP+   P   P +PP PV  PP  P 
Sbjct: 482 LPPVPPTPVQLPPVPPAPVQLPPVPPAPV---QLPPVTPAPVQLPPVPPAPVQLPPVPPA 538

Query: 403 P 405
           P
Sbjct: 539 P 539

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 37/103 (35%), Positives = 50/103 (48%), Gaps = 14/103 (13%)
 Frame = +1

Query: 139 PVPKK----HKPSKKPGKP-------VKPPG---IVPPIVKPPGIVPPIVKPPVILPPVT 276
           PVP +      PS++P  P       +  PG    +P  +K   ++ P+  PPV   PV 
Sbjct: 392 PVPARLLALPMPSRRPALPAFLRRLAMPAPGRLHALPISLKLLALLAPVQLPPVPPAPVQ 451

Query: 277 VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           +PPV   P+ +PPV     PP P   P +PP PV  PP  PTP
Sbjct: 452 LPPVPPAPVQLPPV-----PPAPVQLPPVPPAPVQLPPVPPTP 489

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 33/96 (34%), Positives = 39/96 (40%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P      P +PP   P   +PP   P   +PPV  P    PPV+ P    PPV  
Sbjct: 200 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 259

Query: 325 PT--LPPIPGVTPILPPV----PVLNPPSTPTPTTP 414
           P    PP+    P  PPV    P   P S P P  P
Sbjct: 260 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERP 295

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 33/96 (34%), Positives = 39/96 (40%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P      P +PP   P   +PP   P   +PPV  P    PPV+ P    PPV  
Sbjct: 210 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 269

Query: 325 PT--LPPIPGVTPILPPV----PVLNPPSTPTPTTP 414
           P    PP+    P  PPV    P   P S P P  P
Sbjct: 270 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERP 305

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 33/96 (34%), Positives = 39/96 (40%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P      P +PP   P   +PP   P   +PPV  P    PPV+ P    PPV  
Sbjct: 220 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 279

Query: 325 PT--LPPIPGVTPILPPV----PVLNPPSTPTPTTP 414
           P    PP+    P  PPV    P   P S P P  P
Sbjct: 280 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERP 315

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 33/96 (34%), Positives = 39/96 (40%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P      P +PP   P   +PP   P   +PPV  P    PPV+ P    PPV  
Sbjct: 230 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 289

Query: 325 PT--LPPIPGVTPILPPV----PVLNPPSTPTPTTP 414
           P    PP+    P  PPV    P   P S P P  P
Sbjct: 290 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERP 325

[128][TOP]
>UniRef100_Q4A2U1 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
            RepID=Q4A2U1_EHV86
          Length = 2873

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 39/96 (40%), Positives = 41/96 (42%)
 Frame = +1

Query: 127  TCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
            TC KP      PS  P  P   P   PP   PP   PP   PP   PP + PP   PP  
Sbjct: 2663 TCIKPPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSP 2722

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP   P  PP P   P  PP P   PPS P P+ P
Sbjct: 2723 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2758

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 37/92 (40%), Positives = 40/92 (43%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 2687 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 2746

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P   P LPP P  +PP +P P +P
Sbjct: 2747 PPPPSPPPPSPPPPLPPAP--SPPPSPPPPSP 2776

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 37/93 (39%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT-VPP 315
            P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP +  PP
Sbjct: 2676 PPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPP 2735

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P  PP P   P  PP P   PP  P P+ P
Sbjct: 2736 SPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPP 2768

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 2699 PPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2758

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P LPP P   P   P P   PPS P P+ P
Sbjct: 2759 PPLPPAPSPPP--SPPPPSPPPSPPPPSPP 2786

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 31/72 (43%), Positives = 32/72 (44%)
 Frame = +1

Query: 190  PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPP 369
            PP   PP   PP   PP   PP   PP   PP + PP   PP   P  PP P   P  PP
Sbjct: 2254 PPSPPPPSPHPPSPPPPSPPPPS--PPPPTPPPSPPP---PPPTPPPSPPPPSPPPPSPP 2308

Query: 370  VPVLNPPSTPTP 405
             P   PPS P P
Sbjct: 2309 PPSPPPPSQPPP 2320

[129][TOP]
>UniRef100_Q6PZE9 Putative uncharacterized protein (Fragment) n=1 Tax=Brassica napus
           var. napus RepID=Q6PZE9_BRANA
          Length = 225

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 44/101 (43%), Positives = 53/101 (52%), Gaps = 8/101 (7%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPP--IVKPPGIVPPIVKPPV--ILPPVTVPPVTVPPI 303
           KP P +  P+     PVKPP + PP  I  PP + PP+ +PP     PPV  PPV  PP 
Sbjct: 27  KPPPVQKPPTPTYSPPVKPPPVKPPTPIYSPPVMPPPVQQPPTPSYSPPVKPPPVQKPPT 86

Query: 304 -TVPPVVKP---TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            T  P VKP     PP P  +P + P PV  PP TPT + P
Sbjct: 87  PTYSPPVKPPPVQKPPTPTYSPPIKPPPVQKPP-TPTYSPP 126

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 46/109 (42%), Positives = 55/109 (50%), Gaps = 2/109 (1%)
 Frame = +1

Query: 94  LSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPV 273
           LS+  P+    T     P K  P +KP  P   P + PP VKPP    PI  PPV+ PPV
Sbjct: 8   LSNHHPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVKPP---TPIYSPPVMPPPV 64

Query: 274 TVPPVT--VPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP     PP+  PPV K   PP P  +P + P PV  PP TPT + P
Sbjct: 65  QQPPTPSYSPPVKPPPVQK---PPTPTYSPPVKPPPVQKPP-TPTYSPP 109

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 38/94 (40%), Positives = 46/94 (48%), Gaps = 4/94 (4%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIV--PPIVKPPVILPPVTV--PPVTVPPI 303
           KP P +  P+     P+KPP    P+ KPP     PPI  PPV  PP     PPV  PP+
Sbjct: 94  KPPPVQKPPTPTYSPPIKPP----PVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPV 149

Query: 304 TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
             PP   PT  P     P+ PP P+ +PP  P P
Sbjct: 150 QKPPT--PTYSPPIKPPPVKPPTPIYSPPVKPPP 181

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/93 (39%), Positives = 46/93 (49%), Gaps = 3/93 (3%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPG-IVPPIVKPPVILPPVTV--PPVTVPPIT 306
           KP P +  P+     PVKPP    P+ KPP     P +KPP + PP  +  PPV  PP+ 
Sbjct: 128 KPPPVQKPPTPTYSPPVKPP----PVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVQ 183

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            PP   PT  P     P+ PP P  +PP  P P
Sbjct: 184 KPPT--PTYSPPIKPPPVKPPTPTYSPPVKPPP 214

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 41/99 (41%), Positives = 46/99 (46%), Gaps = 6/99 (6%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV--PPITV 309
           KP P +  P+     PVKPP    P+ KPP    P   PP+  PPV  PP     PPI  
Sbjct: 77  KPPPVQKPPTPTYSPPVKPP----PVQKPP---TPTYSPPIKPPPVQKPPTPTYSPPIKP 129

Query: 310 PPVVKPTLPPI-PGVTPI---LPPVPVLNPPSTPTPTTP 414
           PPV KP  P   P V P     PP P  +PP  P P  P
Sbjct: 130 PPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVKP 168

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 40/88 (45%), Positives = 45/88 (51%), Gaps = 2/88 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIV--PPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P K  P +KP  P   P I PP VKPP  +  PP+  PPV  PP    P   PPI  PPV
Sbjct: 143 PVKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVQKPPT---PTYSPPIKPPPV 199

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPT 402
                PP P  +P + P PV  PP TPT
Sbjct: 200 ----KPPTPTYSPPVKPPPVQKPP-TPT 222

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 40/101 (39%), Positives = 49/101 (48%), Gaps = 9/101 (8%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPP---IVKPPGIVPPIVKP--PVILPPVTVPPVTVPPI 303
           P P +  P+     PVKPP +  P      PP   PP+ KP  P   PP+  PPV  PP 
Sbjct: 61  PPPVQQPPTPSYSPPVKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVQKPPT 120

Query: 304 -TVPPVVKP---TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            T  P +KP     PP P  +P + P PV  PP TPT + P
Sbjct: 121 PTYSPPIKPPPVQKPPTPTYSPPVKPPPVQKPP-TPTYSPP 160

[130][TOP]
>UniRef100_Q06763 ADR11 protein (Fragment) n=1 Tax=Glycine max RepID=Q06763_SOYBN
          Length = 151

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 33/65 (50%), Positives = 43/65 (66%), Gaps = 5/65 (7%)
 Frame = +1

Query: 235 PPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTP----- 399
           P   K PV+ PPVT+PP+ VPP+ +PP+VKP     PG   ILPP+P++NPP+TP     
Sbjct: 3   PKTPKTPVVKPPVTIPPINVPPVVLPPIVKP-----PG---ILPPIPIINPPTTPGKGGN 54

Query: 400 TPTTP 414
           TP  P
Sbjct: 55  TPCPP 59

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 33/72 (45%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = +1

Query: 157 KPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTL 333
           K  K P  PV KPP  +PPI  PP ++PPIVKPP ILPP            +P +  PT 
Sbjct: 1   KTPKTPKTPVVKPPVTIPPINVPPVVLPPIVKPPGILPP------------IPIINPPTT 48

Query: 334 PPIPGVTPILPP 369
           P   G TP  PP
Sbjct: 49  PGKGGNTPCPPP 60

[131][TOP]
>UniRef100_O24443 Cell wall type 2 proline rich protein PvPRP2-37 (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=O24443_PHAVU
          Length = 81

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 34/73 (46%), Positives = 39/73 (53%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV KP +   P   P + 
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 367 PVPVLNPPSTPTP 405
             PV  PP    P
Sbjct: 61  KPPVYKPPVEKPP 73

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 33/68 (48%), Positives = 38/68 (55%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV KP +   P   P + 
Sbjct: 11  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 70

Query: 367 PVPVLNPP 390
             PV  PP
Sbjct: 71  KPPVYKPP 78

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 38/79 (48%), Positives = 45/79 (56%), Gaps = 3/79 (3%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P  + P +KP  PV KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV 
Sbjct: 3   PVYNPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 322 KPTL--PPIPGVTPILPPV 372
           KP +  PP+       PPV
Sbjct: 61  KPPVYKPPVEKPPVYKPPV 79

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 29/60 (48%), Positives = 34/60 (56%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PP+ KPPV  PPV  PPV  PP+  PPV K
Sbjct: 22  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 81

[132][TOP]
>UniRef100_A8JFD4 Glyoxal or galactose oxidase (Fragment) n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8JFD4_CHLRE
          Length = 898

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 38/92 (41%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 197 PRPPPPPPSPSPPSP-SPPSPSPPSPSPPSPSPPSPRPPSPRPPSPSPPSPSPPSPRPPS 255

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            +P  PP P   P  PP P   PPS P P+ P
Sbjct: 256 PRPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 287

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 37/90 (41%), Positives = 39/90 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 202 PPPSPSPPSPSPPSP-SPPSPSPPSPSPPSPRPPSPRPPSPSPPSPSPPSPRPPSPRPPS 260

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P  PP P   P  PP P   PPS P P+
Sbjct: 261 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 290

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 38/90 (42%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 209 PSPSPPSPSPPSP-SPPSPSPPSPRPPSPRPPSPSPPSPSPPSPRPPSPRPPSPPPPSPP 267

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P+P TP
Sbjct: 268 PPSPPPPSPPPPSPPPPSPPPPS-PSPPTP 296

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/90 (41%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 214 PSPSPPSPSPPSP-SPPSPRPPSPRPPSPSPPSPSPPSPRPPSPRPPSPPPPSPPPPSPP 272

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P  +PP TP+P  P
Sbjct: 273 PPSPPPPSPPPPSPPPPSPSPP-TPSPPPP 301

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 35/90 (38%), Positives = 36/90 (40%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 188 PADSSPPLPPRPPPPPPSPSPPSPSPPSPSPPSPSPPSPSPPSPRPPSPRPPSPSPPSPS 247

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  PP P   PPS P P+ P
Sbjct: 248 PPSPRPPSPRPPSPPPPSPPPPSPPPPSPP 277

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 33/86 (38%), Positives = 37/86 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P +PP   PP   PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 219 PSPSPPSPSPPSP-RPPSPRPPSPSPPSPSPPSPRPPSPRPPSPPPPSPPPPSPPPPSPP 277

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPT 402
           P  PP P   P  P  P  +PP  P+
Sbjct: 278 PPSPPPPSPPPPSPSPPTPSPPPPPS 303

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 37/94 (39%), Positives = 40/94 (42%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 229 PSPRPPSPRPPSP-SPPSPSPPSPRPPSPRPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 287

Query: 325 PTLPPIPGVTPILPPVPVLN----PPSTPTPTTP 414
           P  P  P  +P  PP  VL     PPS P P  P
Sbjct: 288 PPSPSPPTPSPPPPPSTVLTSPSPPPSPPPPRPP 321

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 36/92 (39%), Positives = 38/92 (41%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 239 PSPSPPSPSPPSP-RPPSPRPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPTPS 297

Query: 325 PTLPPIPGVTPILPP--VPVLNPPSTPTPTTP 414
           P  PP   +T   PP   P   PPS P P  P
Sbjct: 298 PPPPPSTVLTSPSPPPSPPPPRPPSPPPPRPP 329

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 34/92 (36%), Positives = 42/92 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P +  PS  P +P  PP +V P  +P    PP+   P   PP   PP   PP   PP 
Sbjct: 163 PSPPRPPPSPPPPRP--PPPVVTPASRPADSSPPLPPRPPPPPPSPSPPSPSPPSPSPPS 220

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P  P   P  P  P  +PPS P+P +P
Sbjct: 221 PSPPSPSPPSPRPPSPRPPSPSPPS-PSPPSP 251

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 42/110 (38%), Positives = 49/110 (44%), Gaps = 17/110 (15%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVK------PPGI-VPPIVKPPGIVPPIVKPPVILP----PVTVP 282
           +P PK   P KK  K VK      PPG  +PP+   P   PP   PP   P    P   P
Sbjct: 112 RPPPKPPSPPKKKKKKVKVKKRPPPPGPPLPPLPPRPQTPPP--PPPAQSPMSPSPPRPP 169

Query: 283 PVTVPPITVPPVVKP------TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   PP   PPVV P      + PP+P   P  PP P    PS P+P+ P
Sbjct: 170 PSPPPPRPPPPVVTPASRPADSSPPLPPRPPPPPPSPSPPSPSPPSPSPP 219

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 39/107 (36%), Positives = 42/107 (39%), Gaps = 18/107 (16%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV---------PPVT 291
           P P    PS  P  P  PP   PP   PP   PP   PP   PP TV         PP  
Sbjct: 262 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPSPPTPSPPP--PPSTVLTSPSPPPSPPPP 318

Query: 292 VPPITVPPVVKPTLPPIPG---------VTPILPPVPVLNPPSTPTP 405
            PP   PP   P  PP+PG           P  PP   L PP +P+P
Sbjct: 319 RPPSPPPPRPPPPRPPLPGTGGPKPSGDAFPPTPPDAPLFPPLSPSP 365

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 32/92 (34%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P     S     P +PP   PP   PP +V P  +P    PP+   P   PP   PP 
Sbjct: 151 PPPPPPAQSPMSPSPPRPPPSPPPPRPPPPVVTPASRPADSSPPLPPRPPPPPPSPSPPS 210

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P  P  +P  P  P   PPS P P +P
Sbjct: 211 PSPPSPSPPSPSPPSPSPPSPRPPS-PRPPSP 241

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 35/90 (38%), Positives = 36/90 (40%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 249 PSPRPPSPRPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPSPPTPSPP--PPPSTV 305

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            T P  P   P  PP P   PP  P P  P
Sbjct: 306 LTSPSPPPSPP--PPRPPSPPPPRPPPPRP 333

[133][TOP]
>UniRef100_UPI0001985C48 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001985C48
          Length = 533

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 45/108 (41%), Positives = 52/108 (48%), Gaps = 16/108 (14%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGK---PVKPPGIVPPIV------------KPPGIVPPIV-KPPVILPP 270
           P+P KH P  KP     P KPP + PP V            KPP + PP V KPP++ PP
Sbjct: 344 PLPPKHPPHVKPPHTPMPPKPPAVKPPYVPNPPVVEPPYVPKPPVLNPPHVPKPPIVRPP 403

Query: 271 VTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           V  PP     +  PPVV+P  PP P V P  PP P   PP  P    P
Sbjct: 404 VVKPPY----VPKPPVVQP--PPPPVVHPPPPPTPCPPPPPPPKGRPP 445

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 45/100 (45%), Positives = 48/100 (48%), Gaps = 8/100 (8%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPV-------KPPGIVPPIVKPPGIVPPIVKPPVILPP-VTVPPVTV 294
           P P   KP   P  PV       KPP + PP V      PPIV+PPV+ PP V  PPV  
Sbjct: 362 PKPPAVKPPYVPNPPVVEPPYVPKPPVLNPPHVPK----PPIVRPPVVKPPYVPKPPVVQ 417

Query: 295 PPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   PPVV P  PP P   P  PP P   PP  P  T P
Sbjct: 418 PP--PPPVVHPPPPPTPCPPP--PPPPKGRPP--PQQTCP 451

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 45/127 (35%), Positives = 49/127 (38%), Gaps = 27/127 (21%)
 Frame = +1

Query: 115 LGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPP------------- 255
           L C  C  P P K            PP +  P+   P   PP VKPP             
Sbjct: 322 LACSYCPSPTPPK------------PPKVKHPLPPLPPKHPPHVKPPHTPMPPKPPAVKP 369

Query: 256 --VILPPVTVPP------------VTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPS 393
             V  PPV  PP            V  PPI  PPVVKP   P P V    PP PV++PP 
Sbjct: 370 PYVPNPPVVEPPYVPKPPVLNPPHVPKPPIVRPPVVKPPYVPKPPVVQ-PPPPPVVHPPP 428

Query: 394 TPTPTTP 414
            PTP  P
Sbjct: 429 PPTPCPP 435

[134][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0K5_ARATH
          Length = 760

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 47/137 (34%), Positives = 55/137 (40%), Gaps = 26/137 (18%)
 Frame = +1

Query: 82  CMLFLSSAAPILGCGTCGK----------PVPKKHKPSKKPGKPV----------KPPGI 201
           C  FLS      G  +CG+          P+P    PS  P  P+           PP  
Sbjct: 372 CKAFLSRPPVNCGSFSCGRSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSP 431

Query: 202 VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGV------TPIL 363
            PP+  PP   PP   PPV  PP   PP   PP+  PP   P  PP P V      +P  
Sbjct: 432 PPPVYSPPPPPPP--PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPP 489

Query: 364 PPVPVLNPPSTPTPTTP 414
           PP PV +PP  P P  P
Sbjct: 490 PPPPVYSPPPPPPPPPP 506

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/93 (37%), Positives = 39/93 (41%), Gaps = 4/93 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP- 315
           P P    P   P  P  PP   PP+  PP   PP   PPV  PP   PP   PP+  PP 
Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPP 514

Query: 316 ---VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
                 P  PP P  TP+    P   PP +P P
Sbjct: 515 PPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPP 547

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 37/93 (39%), Positives = 41/93 (44%), Gaps = 3/93 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   P    PP   PP   PPV  PP   PP   PP+  PP 
Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPP 499

Query: 319 VKPTLPPIPGVTPILPPVPVLN---PPSTPTPT 408
             P  PP P  +P  PP PV +   PP +P PT
Sbjct: 500 PPPPPPPPPVYSP--PPPPVYSSPPPPPSPAPT 530

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/93 (38%), Positives = 39/93 (41%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP-PVTVPPVTVPPITVPP 315
           P P    P   P  P  PP   PP+  PP   PP   PPV  P P   PP   PP+  PP
Sbjct: 427 PPPSPPPPVYSPPPPPPPP---PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPP 483

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P  +P  PP P   PP    P  P
Sbjct: 484 PPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 35/87 (40%), Positives = 39/87 (44%), Gaps = 2/87 (2%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIV--PPIVKPPVILPPVTVPPVTVPPITVPPVVKPTL 333
           P   P  PV  P   PP   PP +   PP   PP   PPV  PP   PP   PPV  P  
Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPP 499

Query: 334 PPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP P      PP PV +PP  P  ++P
Sbjct: 500 PPPPP-----PPPPVYSPPPPPVYSSP 521

[135][TOP]
>UniRef100_Q8LMV5 Putative proline-rich cell wall protein n=1 Tax=Oryza sativa
           Japonica Group RepID=Q8LMV5_ORYSJ
          Length = 218

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 34/76 (44%), Positives = 42/76 (55%)
 Frame = +1

Query: 172 PGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGV 351
           P  P  PP   P +V P   +PP+  PP I+PP   PP  +P I VPP + PT  P   V
Sbjct: 48  PPLPTTPP---PAVVAPSPPLPPLTPPPAIVPPALPPPPPLPAIVVPPALPPT--PAIAV 102

Query: 352 TPILPPVPVLNPPSTP 399
            P LPP+P + PPS P
Sbjct: 103 PPALPPIPAIVPPSLP 118

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 36/78 (46%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           P+  P   V P   +PP+  PP IVPP + PP  LP + VPP   P  T    V P LPP
Sbjct: 51  PTTPPPAVVAPSPPLPPLTPPPAIVPPALPPPPPLPAIVVPPALPP--TPAIAVPPALPP 108

Query: 340 IPG-VTPILPPVPVLNPP 390
           IP  V P LPP P  N P
Sbjct: 109 IPAIVPPSLPPTPEANLP 126

[136][TOP]
>UniRef100_Q7G4M5 Protease inhibitor/seed storage/LTP family protein n=1 Tax=Oryza
           sativa Japonica Group RepID=Q7G4M5_ORYSJ
          Length = 357

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 34/76 (44%), Positives = 42/76 (55%)
 Frame = +1

Query: 172 PGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGV 351
           P  P  PP   P +V P   +PP+  PP I+PP   PP  +P I VPP + PT  P   V
Sbjct: 48  PPLPTTPP---PAVVAPSPPLPPLTPPPAIVPPALPPPPPLPAIVVPPALPPT--PAIAV 102

Query: 352 TPILPPVPVLNPPSTP 399
            P LPP+P + PPS P
Sbjct: 103 PPALPPIPAIVPPSLP 118

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 36/78 (46%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           P+  P   V P   +PP+  PP IVPP + PP  LP + VPP   P  T    V P LPP
Sbjct: 51  PTTPPPAVVAPSPPLPPLTPPPAIVPPALPPPPPLPAIVVPPALPP--TPAIAVPPALPP 108

Query: 340 IPG-VTPILPPVPVLNPP 390
           IP  V P LPP P  N P
Sbjct: 109 IPAIVPPSLPPTPEANLP 126

[137][TOP]
>UniRef100_Q58NA5 Plus agglutinin (Fragment) n=1 Tax=Chlamydomonas incerta
            RepID=Q58NA5_CHLIN
          Length = 2371

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 39/94 (41%), Positives = 44/94 (46%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P P+   P+ +  +P  P  P   PP   PP  VPP   PP   PP   PP  VPP   P
Sbjct: 1157 PSPQPPSPAPQTPQPPSPDPPSPAPPSPAPPSPVPPSPIPPTPAPPSPEPPSPVPPSPTP 1216

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  +P  P  P   P  P  P  NPPS P PTTP
Sbjct: 1217 PAPQPPSPAPPAPQPPSPAPPSPNPPS-PAPTTP 1249

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/92 (39%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS +P  P +PP   PP  +PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 691 PPPSPAPPSPRPPSP-EPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPPSPEPPSPAPPS 749

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P  P   P  PP P   PPS   P+ P
Sbjct: 750 PPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 781

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 36/92 (39%), Positives = 42/92 (45%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P+P    PS +P  P  PP   PP   PP   PP   PP   PP   PP   PP  VPP 
Sbjct: 1395 PIPPA-PPSPEPPSPA-PPSPAPPSPAPPSPQPPSPAPPSPRPPSPAPPSPAPPSPVPPS 1452

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P  PP P      PP P    P+ P+P +P
Sbjct: 1453 PQPPAPPSPAPPSPAPPSPAPPSPAPPSPASP 1484

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 34/90 (37%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP  +PP   PP  +PP   PP   PP  VPP   PP   
Sbjct: 1401 PSPEPPSPAPPSPA-PPSPAPPSPQPPSPAPPSPRPPSPAPPSPAPPSPVPPSPQPPAPP 1459

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               PP P      PP P    P++P+P  P
Sbjct: 1460 SPAPPSPAPPSPAPPSPAPPSPASPSPVPP 1489

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 37/96 (38%), Positives = 39/96 (40%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
           P P    PS  P  P  P    P   PP  +PP   PP  KPP   PP   PP   PP  
Sbjct: 671 PQPPPAPPSPTPPSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSP 730

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   P  P  P   P  PP P   PPS   P+ P
Sbjct: 731 APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 766

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 961  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPSPEPPSPAPPS 1019

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 1020 PPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 1051

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 976  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPTPPSPEPPSPAPPSPPPPSPEPPSPAPPS 1034

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 1035 PPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 1066

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 991  PPPSPEPPSPAPPSPT-PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 1049

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 1050 PPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 1081

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/90 (40%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP  P +PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 703 PSPEPPSPKPPSP-EPPSPTPPSPQPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 761

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P   P P   PP +P P +P
Sbjct: 762 PPSPPPPSPEP-PSPAPPSPPPPSPEPPSP 790

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 736  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 794

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 795  PPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 826

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 751  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 809

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 810  PPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 841

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 766  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 824

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 825  PPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 856

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 781  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 839

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 840  PPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 871

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 796  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 854

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 855  PPPPSPEPPSPAPPSPPSPSPEPPSPAPPSPP 886

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 946  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 1004

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 1005 PTPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 1036

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/98 (36%), Positives = 44/98 (44%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPV------KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPP 300
            P P+   PS  P  P+      +PP   P   +PP   PP   PP   PP  VPP  +PP
Sbjct: 1138 PSPEPPSPSPSPAPPIPAPPSPQPPSPAPQTPQPPSPDPPSPAPPSPAPPSPVPPSPIPP 1197

Query: 301  ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               PP  +P  P  P  TP  P  P   PP+ P P +P
Sbjct: 1198 TPAPPSPEPPSPVPPSPTPPAPQPPSPAPPA-PQPPSP 1234

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 38/97 (39%), Positives = 42/97 (43%), Gaps = 7/97 (7%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP   PP  VPP  +PP   PP   PP   PP   PP   
Sbjct: 1421 PSPQPPSPAPPSP-RPPSPAPPSPAPPSPVPPSPQPPA--PPSPAPPSPAPPSPAPPSPA 1477

Query: 325  PTLPPIPGVTPILP------PVPVLNP-PSTPTPTTP 414
            P  P  P   P LP      P P  +P P +PTP  P
Sbjct: 1478 PPSPASPSPVPPLPTPPSPAPAPTTSPLPPSPTPALP 1514

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 708 PSPKPPSPEPPSPT-PPSPQPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 766

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  PP P   PPS   P+ P
Sbjct: 767 PPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 796

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/92 (38%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP    P  +PP   PP   PP   PP   PP 
Sbjct: 841  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPSPSPEPPSPAPPSPPPPSPAPPSPAPPS 899

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS  +P+ P
Sbjct: 900  PPPPSPEPPSPAPPSPPPPSPEPPSPASPSPP 931

 Score = 61.6 bits (148), Expect(2) = 5e-09
 Identities = 33/87 (37%), Positives = 36/87 (41%), Gaps = 2/87 (2%)
 Frame = +1

Query: 160  PSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTL 333
            PS  P  P+ P  P   PP   PP   PP   PP   PP   PP   PP   PP   P  
Sbjct: 1388 PSPAPPSPIPPAPPSPEPPSPAPPSPAPPSPAPPSPQPPSPAPPSPRPPSPAPPSPAPPS 1447

Query: 334  PPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P   P  PP P    P+ P+P  P
Sbjct: 1448 PVPPSPQPPAPPSPAPPSPAPPSPAPP 1474

 Score = 22.3 bits (46), Expect(2) = 5e-09
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +2

Query: 95   SPLPPPFSVAAPAVSPSQRNTSPAKSPASP 184
            SP+PP  +  +PA    Q  +    SPA P
Sbjct: 1349 SPIPPSPAPPSPAPPSPQPPSPEPPSPAPP 1378

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 37/94 (39%), Positives = 43/94 (45%), Gaps = 1/94 (1%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           +P  +   PS  P  P  P P  +PP  KPP   PP   PP  LPP  +PP   PP   P
Sbjct: 611 EPPSQPSPPSPDPPSPDPPSPPALPPSPKPPSPKPPTPAPPSPLPPSPLPPSPAPPSPAP 670

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P  PP P      PP P   PP +P P +P
Sbjct: 671 P-QPPPAPPSPTPPSPAPPSP---PPPSPAPPSP 700

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 35/90 (38%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 723 PSPQPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 781

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  PP P   PPS   P+ P
Sbjct: 782 PPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 811

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 36/90 (40%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P +PP   PP  KPP   PP   PP   PP   PP   PP   PP   
Sbjct: 688 PSPPPPSPAPPSP-RPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPPSPEPPSPA 746

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P   P P   PP +P P +P
Sbjct: 747 PPSPPPPSPEP-PSPAPPSPPPPSPEPPSP 775

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 37/96 (38%), Positives = 40/96 (41%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P    PS +P  P  P    P   PP   PP   PP  +PP   PP   PP   PP   P
Sbjct: 913  PSPPPPSPEPPSPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAP 972

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPS--TPTPTTP 414
            P   P  P  P   P  PP P   PPS   P+PT P
Sbjct: 973  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPP 1008

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 34/90 (37%), Positives = 37/90 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 935  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 994

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P  P  P  TP  P  P   PPS P P+
Sbjct: 995  PEPPSPAPPSPTPPSPEPPSPAPPSPPPPS 1024

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 34/90 (37%), Positives = 40/90 (44%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP  VPP   PP   PP  +PP  +PP   PP   PP   PP  +
Sbjct: 1172 PSPDPPSPAPPSPA-PPSPVPPSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAPQ 1230

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P      PP P    P++P P +P
Sbjct: 1231 PPSPAPPSPN---PPSPAPTTPASPEPPSP 1257

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 34/90 (37%), Positives = 37/90 (41%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  PV PP  +PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1177 PSPAPPSPAPPSPV-PPSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAPQPPSPA 1235

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P    P  P+P+ P
Sbjct: 1236 PPSPNPPSPAPTTPASPEPPSPQPPSPSPP 1265

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 808  PSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 866

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P   P P   PP +P P +P
Sbjct: 867  PPSPPSPSPEP-PSPAPPSPPPPSPAPPSP 895

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 33/90 (36%), Positives = 36/90 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 860  PEPPSPAPPSPPSPSPEPPSPAPPSPPPPSPAPPSPAPPSPPPPSPEPPSPAPPSPPPPS 919

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P  P  P   P  P  P   PPS P P+
Sbjct: 920  PEPPSPASPSPPPPSPEPPSPAPPSPPPPS 949

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 958  PSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPSPEPPSPA 1016

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P   P P   PP +P P +P
Sbjct: 1017 PPSPPPPSPEP-PSPAPPSPPPPSPEPPSP 1045

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 988  PSPPPPSPEPPSPA-PPSPTPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 1046

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P   P P   PP +P P +P
Sbjct: 1047 PPSPPPPSPEP-PSPAPPSPPPPSPEPPSP 1075

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/90 (38%), Positives = 40/90 (44%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1003 PSPTPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 1061

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P   P P   PP +P P++P
Sbjct: 1062 PPSPPPPSPEP-PSPAPPSPPPPSPEPSSP 1090

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1018 PSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 1076

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P   P P   PP +P P +P
Sbjct: 1077 PPSPPPPSPEP-SSPAPPSPPPPSPAPPSP 1105

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 35/92 (38%), Positives = 37/92 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP    P   PP   PP 
Sbjct: 826  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPSPSPEPPSPAPPS 884

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 885  PPPPSPAPPSPAPPSPPPPSPEPPSPAPPSPP 916

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP    P 
Sbjct: 871  PSPSPEPPSPAPPSP-PPPSPAPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPASPS 929

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS P P +P
Sbjct: 930  PPPPSPEPPSPAPPSPPPPSPEPPS-PAPPSP 960

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 35/92 (38%), Positives = 37/92 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP    P   PP  +PP   PP   PP   PP   PP 
Sbjct: 901  PPPSPEPPSPAPPSP-PPPSPEPPSPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 959

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 960  PPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 991

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 35/92 (38%), Positives = 37/92 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 931  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 989

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P   PPS   P+ P
Sbjct: 990  PPPPSPEPPSPAPPSPTPPSPEPPSPAPPSPP 1021

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 34/94 (36%), Positives = 41/94 (43%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKP--PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P    PS +P +P  P  P   PP  +PP  +PP   PP   PP   PP   PP   PP 
Sbjct: 1320 PSPAPPSPQPPQPPSPSPPSPAPPSPEPPSPIPPSPAPPSPAPPSPQPPSPEPPSPAPPS 1379

Query: 319  VKP--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P    PP P     +PP P    P +P P +P
Sbjct: 1380 PAPLSPAPPSPAPPSPIPPAPPSPEPPSPAPPSP 1413

 Score = 57.0 bits (136), Expect(2) = 1e-08
 Identities = 32/85 (37%), Positives = 34/85 (40%)
 Frame = +1

Query: 160  PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
            PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   P    P  P 
Sbjct: 1333 PSPSPPSPA-PPSPEPPSPIPPSPAPPSPAPPSPQPPSPEPPSPAPPSPAPLSPAPPSPA 1391

Query: 340  IPGVTPILPPVPVLNPPSTPTPTTP 414
             P   P  PP P    P+ P+P  P
Sbjct: 1392 PPSPIPPAPPSPEPPSPAPPSPAPP 1416

 Score = 25.4 bits (54), Expect(2) = 1e-08
 Identities = 16/45 (35%), Positives = 21/45 (46%)
 Frame = +2

Query: 50   SPQRSMLTSSSACSSSPLPPPFSVAAPAVSPSQRNTSPAKSPASP 184
            SP   +  S +  S +PLPPP       V PS    +P  SP +P
Sbjct: 1261 SPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPS---PAPPPSPPAP 1302

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 33/90 (36%), Positives = 37/90 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P     PP   PP  +PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 680 PTPPSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPPS 739

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            +P  P  P   P  P  P   PPS P P+
Sbjct: 740 PEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 769

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 718 PSPTPPSPQPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 776

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P   P P   PP +P P +P
Sbjct: 777 PPSPPPPSPEP-PSPAPPSPPPPSPEPPSP 805

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 733 PSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 791

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P   P P   PP +P P +P
Sbjct: 792 PPSPPPPSPEP-PSPAPPSPPPPSPEPPSP 820

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 748  PSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 806

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P   P P   PP +P P +P
Sbjct: 807  PPSPPPPSPEP-PSPAPPSPPPPSPEPPSP 835

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 763  PSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 821

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P   P P   PP +P P +P
Sbjct: 822  PPSPPPPSPEP-PSPAPPSPPPPSPEPPSP 850

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 778  PSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 836

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P   P P   PP +P P +P
Sbjct: 837  PPSPPPPSPEP-PSPAPPSPPPPSPEPPSP 865

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 973  PSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPTPPSPEPPSPAPPSPPPPSPEPPSPA 1031

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P   P P   PP +P P +P
Sbjct: 1032 PPSPPPPSPEP-PSPAPPSPPPPSPEPPSP 1060

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 36/94 (38%), Positives = 38/94 (40%), Gaps = 5/94 (5%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P     +P  PP   PP   PP   PP   PP    P  VPP+  PP   P  
Sbjct: 1441 PSPAPPSPVPPSPQPPAPPSPAPPSPAPPSPAPPSPAPPSPASPSPVPPLPTPPSPAPAP 1500

Query: 319  VKPTLPPIPGVTPILP-----PVPVLNPPSTPTP 405
                LPP P  TP LP     P P  NPP  P P
Sbjct: 1501 TTSPLPPSP--TPALPAPPASPAPPPNPPRPPQP 1532

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 33/90 (36%), Positives = 37/90 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 785  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 844

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P  P  P   P  P  P   PPS P+P+
Sbjct: 845  PEPPSPAPPSPPPPSPEPPSPAPPSPPSPS 874

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 35/92 (38%), Positives = 37/92 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 811  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 869

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                 P  P   P  PP P   PPS   P+ P
Sbjct: 870  PPSPSPEPPSPAPPSPPPPSPAPPSPAPPSPP 901

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 35/92 (38%), Positives = 37/92 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP    P   PP   PP   PP 
Sbjct: 886  PPPSPAPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPASPSPPPPSPEPPSPAPPS 944

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 945  PPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 976

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 33/90 (36%), Positives = 36/90 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 950  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPS 1009

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P  P  P   P  P  P   PPS P P+
Sbjct: 1010 PEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 1039

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 33/90 (36%), Positives = 36/90 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 965  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPTPPSPEPPSPAPPSPPPPS 1024

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P  P  P   P  P  P   PPS P P+
Sbjct: 1025 PEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 1054

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 32/92 (34%), Positives = 36/92 (39%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P      P  P    PP   PP   PP  +PP  +PP   PP   PP   PP 
Sbjct: 1310 PAPPPSPPEPPSPAPPSPQPPQPPSPSPPSPAPPSPEPPSPIPPSPAPPSPAPPSPQPPS 1369

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P  P  P   P+ P  P   PPS   P  P
Sbjct: 1370 PEPPSPAPPSPAPLSPAPPSPAPPSPIPPAPP 1401

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 33/90 (36%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P+ PP   PP   PP   PP  +PP   PP   P    PP   PP   
Sbjct: 1338 PSPAPPSPEPPSPI-PPSPAPPSPAPPSPQPPSPEPPSPAPPSPAPLSPAPPSPAPPSPI 1396

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P      PP P    P+ P+P  P
Sbjct: 1397 PPAPPSPEPPSPAPPSPAPPSPAPPSPQPP 1426

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 663 PAPPSPAP---PQPPPAPPSPTPPSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPS 719

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P  P   P  PP P   PPS P P +P
Sbjct: 720 PTPPSPQPPSPAPPSPPPPSPEPPS-PAPPSP 750

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/88 (38%), Positives = 37/88 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP  +
Sbjct: 713 PSPEPPSPTPPSP-QPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPE 771

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           P  P  P   P  P  P   PPS P P+
Sbjct: 772 PPSPAPPSPPPPSPEPPSPAPPSPPPPS 799

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 33/90 (36%), Positives = 36/90 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 725 PQPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 784

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            +P  P  P   P  P  P   PPS P P+
Sbjct: 785 PEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 814

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 33/90 (36%), Positives = 36/90 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 740  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 799

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P  P  P   P  P  P   PPS P P+
Sbjct: 800  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 829

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 33/90 (36%), Positives = 36/90 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 755  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 814

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P  P  P   P  P  P   PPS P P+
Sbjct: 815  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 844

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 33/90 (36%), Positives = 36/90 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 770  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 829

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P  P  P   P  P  P   PPS P P+
Sbjct: 830  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 859

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 36/90 (40%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP  +
Sbjct: 923  PSPASPSPPPPSP-EPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPE 981

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS PTP +P
Sbjct: 982  PPSPAPPSPPPPSPEPPSPAPPS-PTPPSP 1010

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 33/90 (36%), Positives = 36/90 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 980  PEPPSPAPPSPPPPSPEPPSPAPPSPTPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 1039

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P  P  P   P  P  P   PPS P P+
Sbjct: 1040 PEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 1069

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/94 (37%), Positives = 39/94 (41%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P    PS  P  P+ P    P   PP   PP   PP  +PP   PP   PP   PP   P
Sbjct: 1182 PSPAPPSPVPPSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAPQPPSPAPPSPNP 1241

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   PT P  P      PP P  +PP  P+P  P
Sbjct: 1242 PSPAPTTPASPEPPSPQPPSP--SPPVPPSPAPP 1273

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 36/98 (36%), Positives = 42/98 (42%), Gaps = 8/98 (8%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV--------PP 300
            P    PS +P  PV PP   PP  +PP   PP  +PP   PP   PP           PP
Sbjct: 1197 PTPAPPSPEPPSPV-PPSPTPPAPQPPSPAPPAPQPPSPAPPSPNPPSPAPTTPASPEPP 1255

Query: 301  ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               PP   P +PP P      PP P   PP +P P +P
Sbjct: 1256 SPQPPSPSPPVPPSPA-----PPSPAPLPPPSPDPPSP 1288

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 1008 PSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 1066

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  PP P    PS+P P +P
Sbjct: 1067 PPSPEPPSPAPPSPP-PPSPEPSSPAPPSP 1095

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 35/92 (38%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P   +P   P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 666 PSPAPPQPPPAPPSPT-PPSPAPPSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPSPTPPS 724

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            +P  P  P   P  P  P   PPS P P +P
Sbjct: 725 PQPPSPAPPSPPPPSPEPPSPAPPS-PPPPSP 755

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 39/99 (39%), Positives = 41/99 (41%), Gaps = 7/99 (7%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT-------VPPVTVP 297
           P P    PS KP  P KPP   PP   PP  +PP   PP   PP          PP   P
Sbjct: 629 PSPPALPPSPKPPSP-KPPTPAPPSPLPPSPLPPSPAPPSPAPPQPPPAPPSPTPPSPAP 687

Query: 298 PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   PP   P  P  P   P  P  P   PPS PTP +P
Sbjct: 688 PSPPPPSPAPPSPRPPSPEPPSPKPPSPEPPS-PTPPSP 725

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 35/94 (37%), Positives = 40/94 (42%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P    PS +P  P  P    P   PP  +P    PP  +P    PP  VPP   PP   P
Sbjct: 1078 PSPPPPSPEPSSPAPPSPPPPSPAPPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAP 1137

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  +P   P P   P +P  P   PPS P P TP
Sbjct: 1138 PSPEPP-SPSPSPAPPIPAPPSPQPPS-PAPQTP 1169

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 35/93 (37%), Positives = 39/93 (41%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKP-SKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P P    P S  P  P  PP  +PP   PP   PP   PP   PP   PP   PP   PP
Sbjct: 1375 PAPPSPAPLSPAPPSPA-PPSPIPPA--PPSPEPPSPAPPSPAPPSPAPPSPQPPSPAPP 1431

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              +P  P  P   P  P  P   PP+ P+P  P
Sbjct: 1432 SPRPPSPAPPSPAPPSPVPPSPQPPAPPSPAPP 1464

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 34/90 (37%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP    P   PP   
Sbjct: 823  PSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPSPSPEPPSPA 881

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P   P P   PP +P P +P
Sbjct: 882  PPSPPPPSPAP-PSPAPPSPPPPSPEPPSP 910

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP    P  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 853  PSPPPPSPEPPSPA-PPSPPSPSPEPPSPAPPSPPPPSPAPPSPAPPSPPPPSPEPPSPA 911

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P  P  P   PPS P P +P
Sbjct: 912  PPSPPPPSPEPPSPASPSPPPPS-PEPPSP 940

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 34/91 (37%), Positives = 41/91 (45%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV-PPITVPPVV 321
            P  + PS  P  P  P    PP  +PP   PP+   P    P  +PP +  PP  VPP  
Sbjct: 1237 PSPNPPSPAPTTPASPE---PPSPQPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPP-- 1291

Query: 322  KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P   P+P   PPS P P +P
Sbjct: 1292 SPAPPPSPPAPPSPEPIPPAPPPSPPEPPSP 1322

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 34/90 (37%), Positives = 34/90 (37%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP   PP   PP  VPP   PP    P   
Sbjct: 1406 PSPAPPSPAPPSPA-PPSPQPPSPAPPSPRPPSPAPPSPAPPSPVPPSPQPPAPPSPAPP 1464

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               PP P      PP P    P  P PT P
Sbjct: 1465 SPAPPSPAPPSPAPPSPASPSPVPPLPTPP 1494

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/89 (39%), Positives = 36/89 (40%), Gaps = 1/89 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVP-PIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P    PS  P  P  P    P P   PP   PP   PP   PP   PP   PP   PP  
Sbjct: 651 PSPLPPSPLPPSPAPPSPAPPQPPPAPPSPTPPSPAPPSPPPPSPAPPSPRPPSPEPPSP 710

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           KP  P  P  TP  P  P   PPS P P+
Sbjct: 711 KPPSPEPPSPTPPSPQPPSPAPPSPPPPS 739

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 32/90 (35%), Positives = 35/90 (38%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP    P   PP   PP   PP   PP 
Sbjct: 890  PAPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPASPSPPPPSPEPPSPAPPSPPPPS 949

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P  P  P   P  P  P   PPS P P+
Sbjct: 950  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 979

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 33/92 (35%), Positives = 35/92 (38%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP    P        +PP  VPP   PP   PP   PP   PP   PP   PP   P  
Sbjct: 1189 PVPPSPIPPTPAPPSPEPPSPVPPSPTPPAPQPPSPAPPAPQPPSPAPPSPNPPSPAPTT 1248

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                 PP P      PPVP    P +P P  P
Sbjct: 1249 PASPEPPSPQPPSPSPPVPPSPAPPSPAPLPP 1280

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 34/96 (35%), Positives = 42/96 (43%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P+   P+  P  P +PP   PP  +PP   PP   PP   PP   PP  +PP   PP 
Sbjct: 1303 PSPEPIPPAPPPSPP-EPPSPAPPSPQPPQ--PPSPSPPSPAPPSPEPPSPIPPSPAPPS 1359

Query: 319  VKPTLPPIPGVTPILP----PVPVLNPPSTPTPTTP 414
              P  P  P   P  P    P P+   P +P P +P
Sbjct: 1360 PAPPSPQPPSPEPPSPAPPSPAPLSPAPPSPAPPSP 1395

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 37/93 (39%), Positives = 43/93 (46%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGI---VPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P    PS  P  P  PP  VPP  +PP      PP   PP   PP   PP    P  VPP
Sbjct: 1431 PSPRPPSPAPPSPA-PPSPVPPSPQPPAPPSPAPPSPAPPSPAPPSPAPPSPASPSPVPP 1489

Query: 316  VVKPTLP-PIPGVTPILP-PVPVL-NPPSTPTP 405
            +  P  P P P  +P+ P P P L  PP++P P
Sbjct: 1490 LPTPPSPAPAPTTSPLPPSPTPALPAPPASPAP 1522

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 34/90 (37%), Positives = 37/90 (41%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP  +PP   PP   PP   PP    P   PP   PP   
Sbjct: 883  PSPPPPSPAPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPASPSPPPPSPEPPSPA 941

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P   P P   PP +P P +P
Sbjct: 942  PPSPPPPSPEP-PSPAPPSPPPPSPEPPSP 970

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 32/90 (35%), Positives = 35/90 (38%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP    P 
Sbjct: 815  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPSPS 874

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P  P  P   P  P  P   PPS P P+
Sbjct: 875  PEPPSPAPPSPPPPSPAPPSPAPPSPPPPS 904

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 32/90 (35%), Positives = 35/90 (38%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP    P   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 905  PEPPSPAPPSPPPPSPEPPSPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 964

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P  P  P   P  P  P   PPS P P+
Sbjct: 965  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 994

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 35/89 (39%), Positives = 36/89 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 1021 PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 1079

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              P  P      P  PP P   PPS P P
Sbjct: 1080 PPPPSPEPSSPAPPSPPPPSPAPPS-PEP 1107

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 34/98 (34%), Positives = 39/98 (39%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI----LPPVTVPPVTVPPIT 306
            P P+   P     +   PP  VPP   PP   PP  +PP       PP+  PP   PP  
Sbjct: 1105 PEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPAPPIPAPPSPQPPSP 1164

Query: 307  VPPVVKPTL--PPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P   +P    PP P      PP PV   P  PTP  P
Sbjct: 1165 APQTPQPPSPDPPSPAPPSPAPPSPVPPSPIPPTPAPP 1202

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 36/96 (37%), Positives = 39/96 (40%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKP--PVILPPVTVPPVTVPPIT 306
           P    PS KP  P  P    P  +PP   PP   PP   P  P   PP   PP   PP  
Sbjct: 636 PSPKPPSPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQPPPAPPSPTPPSPAPPSPPPPSP 695

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP  +P  P  P   P  P  P   PPS P P +P
Sbjct: 696 APPSPRPPSPEPPSPKPPSPEPPSPTPPS-PQPPSP 730

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 32/90 (35%), Positives = 34/90 (37%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP    P   PP   PP   PP 
Sbjct: 830  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPSPSPEPPSPAPPSPPPPS 889

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
              P  P  P   P  P  P   PPS P P+
Sbjct: 890  PAPPSPAPPSPPPPSPEPPSPAPPSPPPPS 919

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 33/94 (35%), Positives = 35/94 (37%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPP--GIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P P    P      P  PP     PP   PP   PP  +PP   PP   PP   PP    
Sbjct: 868  PSPPSPSPEPPSPAPPSPPPPSPAPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAS 927

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  P  P   P  PP P   PPS   P+ P
Sbjct: 928  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 961

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 31/90 (34%), Positives = 36/90 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 1025 PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPS 1084

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P+ P  P   P  P  P   P S+  P+
Sbjct: 1085 PEPSSPAPPSPPPPSPAPPSPEPQSSAPPS 1114

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/111 (32%), Positives = 38/111 (34%), Gaps = 19/111 (17%)
 Frame = +1

Query: 139 PVPKKHKPS-------------------KKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI 261
           P PK   P+                     P  P  PP   PP   PP   PP   PP  
Sbjct: 641 PSPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQPPPAPPSPTPPSPAPPSPPPPSPAPPSP 700

Query: 262 LPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   PP   PP   PP   P  P  P   P  PP P   PPS   P+ P
Sbjct: 701 RPPSPEPPSPKPPSPEPPSPTPPSPQPPSPAPPSPPPPSPEPPSPAPPSPP 751

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 35/100 (35%), Positives = 40/100 (40%), Gaps = 8/100 (8%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT---V 309
            PVP   +P   P     PP   PP   PP   PP    P  +PP+  PP   P  T   +
Sbjct: 1448 PVPPSPQPPAPPSPA--PPSPAPPSPAPPSPAPPSPASPSPVPPLPTPPSPAPAPTTSPL 1505

Query: 310  PPVVKPTLP-----PIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   P LP     P P   P  PP P   PP +P    P
Sbjct: 1506 PPSPTPALPAPPASPAPPPNPPRPPQPPAAPPPSPAAPPP 1545

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 34/95 (35%), Positives = 38/95 (40%), Gaps = 5/95 (5%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT---VPPVTVPPITVPP 315
            P    PS  P  P  PP   PP    P  VPP+  PP   P  T   +PP   P +  PP
Sbjct: 1459 PSPAPPSPAPPSPA-PPSPAPPSPASPSPVPPLPTPPSPAPAPTTSPLPPSPTPALPAPP 1517

Query: 316  V--VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                 P  PP P   P  PP     PP +P P  P
Sbjct: 1518 ASPAPPPNPPRPPQPPAAPPPSPAAPPPSPAPLAP 1552

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 34/99 (34%), Positives = 39/99 (39%), Gaps = 7/99 (7%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPP-----VTVPPVTVPPI 303
            P P    P   P    +PP   PP   PP   PP   PP   PP        PP   PP 
Sbjct: 1040 PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPSSPAPPSPPPPS 1099

Query: 304  TVPPVVKP--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              PP  +P  + PP P      PP PV   P+ P+P  P
Sbjct: 1100 PAPPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPP 1138

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 34/90 (37%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP  +PP   PP   P    PP   PP  +PP   PP  +
Sbjct: 1348 PSPIPPSPAPPSPA-PPSPQPPSPEPPSPAPPSPAPLSPAPPSPAPPSPIPP--APPSPE 1404

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1405 PPSPAPPSPAPPSPAPPSPQPPS-PAPPSP 1433

 Score = 54.7 bits (130), Expect(2) = 1e-06
 Identities = 31/92 (33%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           PVP+    + +P +P  PP   PP    P   PP   PP   PP    P +  P +  P 
Sbjct: 572 PVPRPPPRAPRPPRPPSPPA--PPAPPDPPTAPPSPDPPSPEPPSQPSPPSPDPPSPDPP 629

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P LPP P      PP P    P  P+P  P
Sbjct: 630 SPPALPPSPKPPSPKPPTPAPPSPLPPSPLPP 661

 Score = 20.8 bits (42), Expect(2) = 1e-06
 Identities = 10/25 (40%), Positives = 11/25 (44%)
 Frame = +2

Query: 71  TSSSACSSSPLPPPFSVAAPAVSPS 145
           T  S   + P PPP     PA  PS
Sbjct: 507 TPPSPPPTPPAPPPVPPLPPAPPPS 531

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/94 (36%), Positives = 37/94 (39%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPP--GIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P P    P     +P  P      PP  +PP   PP   PP   PP   PP   PP   P
Sbjct: 923  PSPASPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEP 982

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  PP P   P  P  P   PPS P P +P
Sbjct: 983  PSPAPPSPPPPSPEPPSPAPPSPTPPS-PEPPSP 1015

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 31/95 (32%), Positives = 37/95 (38%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +P    PP   PP   PP  +P    PP   P  + PP  VPP 
Sbjct: 1070 PEPPSPAPPSPPPPSPEPSSPAPPSPPPPSPAPPSPEPQSSAPPSPEPQSSAPPSPVPPS 1129

Query: 319  VKPTLPPIPGVTPILP---PVPVLNPPSTPTPTTP 414
              P  P  P   P  P   P P +  P +P P +P
Sbjct: 1130 PAPPSPAPPSPEPPSPSPSPAPPIPAPPSPQPPSP 1164

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/90 (37%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P +PP   PP   P    PP   PP  +PP   PP   PP   PP   
Sbjct: 1358 PSPAPPSPQPPSP-EPPSPAPPSPAPLSPAPPSPAPPSPIPP--APPSPEPPSPAPPSPA 1414

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1415 PPSPAPPSPQPPSPAPPSPRPPS-PAPPSP 1443

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 43/110 (39%), Positives = 49/110 (44%), Gaps = 13/110 (11%)
 Frame = +1

Query: 124 GTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGI-VPPIVKPPVILPPVTVP-PVTVP 297
           G C  P P    PS  P +P   P   PP  +PP   VPP   P    PP T P P  VP
Sbjct: 466 GQCLAPPPS---PSPAPPRPPPFPPSPPPNPRPPSPPVPPSPPPTPPSPPPTPPAPPPVP 522

Query: 298 PITVPPVVKPTLPPIP---------GVTPILP-PVPVL-NPPSTPTPTTP 414
           P+   P   P LPP P         GV   +P PVP L +PP  P+P  P
Sbjct: 523 PLPPAPPPSPPLPPEPPFIALCIRAGVLCAMPSPVPPLPSPPRPPSPQPP 572

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 37/113 (32%), Positives = 44/113 (38%), Gaps = 20/113 (17%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP------------------PVI 261
           +P P+  +P + P  P  PP    P   PP   PP  +P                  P  
Sbjct: 575 RPPPRAPRPPRPPSPPA-PPAPPDPPTAPPSPDPPSPEPPSQPSPPSPDPPSPDPPSPPA 633

Query: 262 LPPVTVPPVTVPPITVPPVVKP--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           LPP   PP   PP   PP   P   LPP P      PP P   PP+ P+PT P
Sbjct: 634 LPPSPKPPSPKPPTPAPPSPLPPSPLPPSPAPPSPAPPQP---PPAPPSPTPP 683

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 31/92 (33%), Positives = 35/92 (38%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP    P  +PP   P    PP   PP   PP    P 
Sbjct: 1279 PPPSPDPPSPVPPSPAPPPS--PPAPPSPEPIPPAPPPSPPEPPSPAPPSPQPPQPPSPS 1336

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                 PP P     +PP P    P+ P+P  P
Sbjct: 1337 PPSPAPPSPEPPSPIPPSPAPPSPAPPSPQPP 1368

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 34/90 (37%), Positives = 36/90 (40%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   P    PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1363 PSPQPPSPEPPSPA-PPSPAPLSPAPPSPAPPSPIPPA--PPSPEPPSPAPPSPAPPSPA 1419

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1420 PPSPQPPSPAPPSPRPPSPAPPS-PAPPSP 1448

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 36/106 (33%), Positives = 41/106 (38%), Gaps = 11/106 (10%)
 Frame = +1

Query: 130 CGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI-LPPVTVPPVTVPPIT 306
           C  P P    PS     P +PP   PP+ +PP   P   +PP    PP    P T PP  
Sbjct: 551 CAMPSPVPPLPS-----PPRPPSPQPPVPRPPPRAPRPPRPPSPPAPPAPPDPPTAPPSP 605

Query: 307 VPPVVKPTLPPIPGVT----------PILPPVPVLNPPSTPTPTTP 414
            PP  +P   P P             P LPP P    P  PTP  P
Sbjct: 606 DPPSPEPPSQPSPPSPDPPSPDPPSPPALPPSPKPPSPKPPTPAPP 651

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 36/98 (36%), Positives = 41/98 (41%), Gaps = 8/98 (8%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPP--------IVKPPVILPPVTVPPVTVPP 300
            P    P+ +P  P  PP   PP   PP   PP          +PP   PP   PP  VPP
Sbjct: 1212 PSPTPPAPQPPSPA-PPAPQPPSPAPPSPNPPSPAPTTPASPEPPSPQPPSPSPP--VPP 1268

Query: 301  ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               PP   P  PP P     +PP P   PPS P P +P
Sbjct: 1269 SPAPPSPAPLPPPSPDPPSPVPPSPA-PPPSPPAPPSP 1305

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 35/96 (36%), Positives = 38/96 (39%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
            PVP    P   P  P  P    P   P   +PP   PP  +PP   PP   PP   PP  
Sbjct: 1288 PVPPSPAPPPSPPAPPSPEPIPPAPPPSPPEPPSPAPPSPQPP--QPPSPSPPSPAPPSP 1345

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP   P  P  P   P  P  P   PPS P P +P
Sbjct: 1346 EPPSPIPPSPAPPSPAPPSPQPPSPEPPS-PAPPSP 1380

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 33/94 (35%), Positives = 38/94 (40%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP----PITVP 312
            P    PS  P  P +P    PP  +P    PP   PP   PP   PP   P    P   P
Sbjct: 1093 PSPPPPSPAPPSP-EPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPAP 1151

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P+  P  P  P   P  P  P  +PPS P P +P
Sbjct: 1152 PIPAPPSPQPPSPAPQTPQPPSPDPPS-PAPPSP 1184

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 34/94 (36%), Positives = 39/94 (41%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS +P     PP   P    PP  VPP   PP   PP   PP +  P   PP+
Sbjct: 1096 PPPSPAPPSPEPQSSA-PPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPP-SPSPSPAPPI 1153

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPST--PTPTTP 414
              P  P  P   P  P  P  +PPS   P+P  P
Sbjct: 1154 PAPPSPQPPSPAPQTPQPPSPDPPSPAPPSPAPP 1187

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 33/100 (33%), Positives = 37/100 (37%), Gaps = 8/100 (8%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP----PVTVPPVTVPPIT 306
            P P   +P        +P    PP   PP   PP   PP   P    P   PP+  PP  
Sbjct: 1100 PAPPSPEPQSSAPPSPEPQSSAPPSPVPPSPAPPSPAPPSPEPPSPSPSPAPPIPAPPSP 1159

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPS----TPTPTTP 414
             PP   P  P  P   P  P  P   PPS    +P P TP
Sbjct: 1160 QPPSPAPQTPQPPSPDPPSPAPPSPAPPSPVPPSPIPPTP 1199

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 32/93 (34%), Positives = 37/93 (39%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGK-PVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P P    P   P   P  P  + PP   PP  VPP   PP   PP    P  +PP   P 
Sbjct: 1257 PQPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPS-PPAPPSPEPIPPAPPPS 1315

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              +P  P  P   P  PP P    P+ P+P  P
Sbjct: 1316 PPEPPSPAPPSPQPPQPPSPSPPSPAPPSPEPP 1348

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 35/96 (36%), Positives = 43/96 (44%)
 Frame = +1

Query: 127  TCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
            T   P P   +P   P  PV PP   PP   P  + PP   PP  +PP   PP + P   
Sbjct: 1248 TPASPEPPSPQPPS-PSPPV-PPSPAPP--SPAPLPPPSPDPPSPVPPSPAPPPSPP--- 1300

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP  +P +PP P  +P  PP P    P  P P +P
Sbjct: 1301 APPSPEP-IPPAPPPSPPEPPSPAPPSPQPPQPPSP 1335

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 31/90 (34%), Positives = 36/90 (40%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  P    P  + PP   PP   PP   PP + PP    P  +PP   
Sbjct: 1255 PSPQPPSPSPPVPPSPAPPSPAPLPPPSPDPPSPVPPSPAPPPS-PPAPPSPEPIPPAPP 1313

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P+ P  P   P  P  P    PS P+P  P
Sbjct: 1314 PSPPEPPSPAPPSPQPPQPPSPSPPSPAPP 1343

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 34/90 (37%), Positives = 37/90 (41%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP   PP   P    PP   PP  +PP   PP   PP   
Sbjct: 1353 PSPAPPSPAPPSP-QPPSPEPPSPAPPSPAPLSPAPPSPAPPSPIPP--APPSPEPPSPA 1409

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1410 PPSPAPPSPAPPSPQPPSPAPPS-PRPPSP 1438

[138][TOP]
>UniRef100_B8BG20 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=B8BG20_ORYSI
          Length = 322

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 34/76 (44%), Positives = 42/76 (55%)
 Frame = +1

Query: 172 PGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGV 351
           P  P  PP   P +V P   +PP+  PP I+PP   PP  +P I VPP + PT  P   V
Sbjct: 48  PPLPTTPP---PAVVAPAPPLPPLTPPPAIVPPALPPPPPLPAIVVPPALPPT--PAIAV 102

Query: 352 TPILPPVPVLNPPSTP 399
            P LPP+P + PPS P
Sbjct: 103 PPALPPIPAIVPPSLP 118

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 36/78 (46%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           P+  P   V P   +PP+  PP IVPP + PP  LP + VPP   P  T    V P LPP
Sbjct: 51  PTTPPPAVVAPAPPLPPLTPPPAIVPPALPPPPPLPAIVVPPALPP--TPAIAVPPALPP 108

Query: 340 IPG-VTPILPPVPVLNPP 390
           IP  V P LPP P  N P
Sbjct: 109 IPAIVPPSLPPTPEANLP 126

[139][TOP]
>UniRef100_B6SUZ1 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6SUZ1_MAIZE
          Length = 284

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 37/92 (40%), Positives = 43/92 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           PVP    P+  P  P KPP + P +   P   PP+  PPV  PP T PP T P +  P V
Sbjct: 104 PVPTTPAPTATPVAPAKPPPVAPAVA--PAKPPPVTPPPVTPPPATPPPATPPAVLPPAV 161

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           + P   P P  TP     P   P S P  TTP
Sbjct: 162 LPPAAAPPPTATP-----PAEAPASLPPATTP 188

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/100 (36%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +1

Query: 109 PILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPV 288
           P     T     P K  P      P KPP + PP V PP   PP   PP +LPP  +PP 
Sbjct: 106 PTTPAPTATPVAPAKPPPVAPAVAPAKPPPVTPPPVTPPPATPPPATPPAVLPPAVLPPA 165

Query: 289 TVPPIT-VPPVVKP-TLPPIPGVTPILPPVPVLNPPSTPT 402
             PP T  PP   P +LPP     P+      L P   P+
Sbjct: 166 AAPPPTATPPAEAPASLPPATTPPPVAEAPAELPPAEAPS 205

[140][TOP]
>UniRef100_A7QFS2 Chromosome undetermined scaffold_89, whole genome shotgun sequence
           n=1 Tax=Vitis vinifera RepID=A7QFS2_VITVI
          Length = 234

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 45/108 (41%), Positives = 52/108 (48%), Gaps = 16/108 (14%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGK---PVKPPGIVPPIV------------KPPGIVPPIV-KPPVILPP 270
           P+P KH P  KP     P KPP + PP V            KPP + PP V KPP++ PP
Sbjct: 45  PLPPKHPPHVKPPHTPMPPKPPAVKPPYVPNPPVVEPPYVPKPPVLNPPHVPKPPIVRPP 104

Query: 271 VTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           V  PP     +  PPVV+P  PP P V P  PP P   PP  P    P
Sbjct: 105 VVKPPY----VPKPPVVQP--PPPPVVHPPPPPTPCPPPPPPPKGRPP 146

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 45/100 (45%), Positives = 48/100 (48%), Gaps = 8/100 (8%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPV-------KPPGIVPPIVKPPGIVPPIVKPPVILPP-VTVPPVTV 294
           P P   KP   P  PV       KPP + PP V      PPIV+PPV+ PP V  PPV  
Sbjct: 63  PKPPAVKPPYVPNPPVVEPPYVPKPPVLNPPHVPK----PPIVRPPVVKPPYVPKPPVVQ 118

Query: 295 PPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   PPVV P  PP P   P  PP P   PP  P  T P
Sbjct: 119 PP--PPPVVHPPPPPTPCPPP--PPPPKGRPP--PQQTCP 152

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 45/127 (35%), Positives = 49/127 (38%), Gaps = 27/127 (21%)
 Frame = +1

Query: 115 LGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPP------------- 255
           L C  C  P P K            PP +  P+   P   PP VKPP             
Sbjct: 23  LACSYCPSPTPPK------------PPKVKHPLPPLPPKHPPHVKPPHTPMPPKPPAVKP 70

Query: 256 --VILPPVTVPP------------VTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPS 393
             V  PPV  PP            V  PPI  PPVVKP   P P V    PP PV++PP 
Sbjct: 71  PYVPNPPVVEPPYVPKPPVLNPPHVPKPPIVRPPVVKPPYVPKPPVVQ-PPPPPVVHPPP 129

Query: 394 TPTPTTP 414
            PTP  P
Sbjct: 130 PPTPCPP 136

[141][TOP]
>UniRef100_Q4A2S9 Putative membrane protein n=2 Tax=Emiliania huxleyi virus 86
           RepID=Q4A2S9_EHV86
          Length = 621

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 144 PPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 203

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 204 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 235

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 139 PPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 198

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 199 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 230

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/90 (40%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP   
Sbjct: 205 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 264

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 265 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 294

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 374 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPP 433

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 434 PSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 465

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/92 (41%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 401 PPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPP--SPPSPPPPSPPPPSPPPPSPPPPS 458

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 459 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 490

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/92 (41%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 422 PPPSPPPPSPPPPSPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 478

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 479 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 510

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 38/92 (41%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P +  PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 120 PPPSQPPPSPPPPSP-PPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPS 178

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 179 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 210

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 36/90 (40%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP   
Sbjct: 200 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 259

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 260 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 289

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 38/92 (41%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 135 PPPSPPPPSPPPPSPPPPPSPPPP-PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 193

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 194 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 225

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 38/92 (41%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 160 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 218

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 219 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 250

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 38/92 (41%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 165 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 223

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 224 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 255

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 38/92 (41%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 170 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 228

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 229 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 260

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 36/90 (40%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP   PP   
Sbjct: 210 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPP 269

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 270 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 299

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 37/90 (41%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P +P  PP   PP   PP   PP   PP   PP + PP   PP   PP   
Sbjct: 113 PTTPPPSPPPSQP--PPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPP 170

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 171 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 200

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 38/93 (40%), Positives = 40/93 (43%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           +P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP
Sbjct: 124 QPPPSPPPPSPPPPSP-PPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPP 182

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P   P  PP P   PPS P P+ P
Sbjct: 183 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 215

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 38/92 (41%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 155 PPPPPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 213

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 214 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 245

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 36/90 (40%), Positives = 38/90 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP + PP   PP   PP   
Sbjct: 215 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPP 274

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 275 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 304

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 36/92 (39%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  P    PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 294 PPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 353

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P  +PP +P P +P
Sbjct: 354 PPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSP 385

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 37/90 (41%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS+ P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 117 PPSPPPSQPPPSP-PPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPPPSPP 175

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 176 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 205

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/92 (41%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 175 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 233

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P  P
Sbjct: 234 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 265

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 240 PPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 299

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P  +PP +P P +P
Sbjct: 300 PPSPPPPSPPPPSPPPPPPSPPPSPPPPSP 329

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 299 PPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 358

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  P  P   PP +P P +P
Sbjct: 359 PPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSP 390

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 36/92 (39%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 304 PPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 363

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P  +P   P P   PP +P P +P
Sbjct: 364 PPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSP 395

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 386 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPP 445

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 446 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 475

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 396 PPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPP 455

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 456 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 485

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 38/92 (41%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 130 PPPSPPPPSPPPPSP-PPPSPPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 188

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 189 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 220

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 220 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPP 279

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 280 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 309

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 38/92 (41%), Positives = 43/92 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 355 PPPSPPPPSPPPPSPPPPPPSPPPSPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPSPPP- 412

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P   P  PP P   PPS P+P  P
Sbjct: 413 --PSPPPPPSPPPPSPPPPSPPPPSPPSPPPP 442

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 391 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPP 450

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 451 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 480

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 406 PPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 465

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 466 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 495

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P     PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 429 PSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 488

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 489 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 520

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 151 PPPSPPPPPPPPSPP--PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 208

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 209 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 240

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 225 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPP 284

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 285 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 314

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 37/92 (40%), Positives = 42/92 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 252 PSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP- 310

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P   P  PP P   PPS P P+ P
Sbjct: 311 --PSPPPPPPSPPPSPPPPSPPPPSPPPPSPP 340

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 381 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPSPP 440

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 441 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 470

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP + PP   PP   PP 
Sbjct: 369 PPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSPPP 428

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P  P   P  PP P   PPS P P+ P
Sbjct: 429 PSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPP 460

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 410 PPPPSPPPPPSPPPPSPPPPSPPP-PSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 468

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 469 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 500

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/94 (39%), Positives = 41/94 (43%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPI--TVP 312
           P P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP   + P
Sbjct: 262 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPP 321

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P  PP P   P  PP P   PPS P P+ P
Sbjct: 322 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 355

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 38/93 (40%), Positives = 42/93 (45%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 279 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP 337

Query: 319 VKPT-LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P   PP P   P  PP P   PPS P P+ P
Sbjct: 338 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 370

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/94 (39%), Positives = 42/94 (44%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP- 315
           P P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 303 PPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 362

Query: 316 -VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P+ PP P   P  PP P   PPS P P+ P
Sbjct: 363 SPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPP 396

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/94 (39%), Positives = 41/94 (43%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT--VP 312
           P P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP +   P
Sbjct: 313 PPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 372

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P  PP P   P  PP P   PPS P P+ P
Sbjct: 373 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 406

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/94 (39%), Positives = 41/94 (43%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPI--TVP 312
           P P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP   + P
Sbjct: 318 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPP 377

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P  PP P   P  PP P   PPS P P+ P
Sbjct: 378 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 411

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/92 (40%), Positives = 42/92 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 359 PPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP- 417

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P  +PPS P P+ P
Sbjct: 418 --PPSPPPPSPPPPSPPPP--SPPSPPPPSPP 445

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 416 PPPPSPPPPSPP--PPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 473

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 474 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 505

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/94 (39%), Positives = 41/94 (43%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT--VP 312
           P P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP +   P
Sbjct: 257 PSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 316

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P  PP P   P  PP P   PPS P P+ P
Sbjct: 317 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 350

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS     P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 427 PPPSPPPPSPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 483

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 484 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 515

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/93 (39%), Positives = 42/93 (45%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 340 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPP 398

Query: 319 VKPT-LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P   PP P   P  PP P   PP +P P +P
Sbjct: 399 SPPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSP 431

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 38/92 (41%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 185 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 243

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 244 PPPPSPPPPSPPPPSPPPPP-PPPSPPPPSPP 274

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP   
Sbjct: 195 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 254

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P P   P  PP P   PPS P P+ P
Sbjct: 255 PPPSPPPPPPPPSPPPPSPPPPSPPPPSPP 284

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 38/93 (40%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT-VPP 315
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP + PP +  PP
Sbjct: 330 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPP 388

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P   P  PP P   PPS P P +P
Sbjct: 389 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSP 421

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 37/93 (39%), Positives = 42/93 (45%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 335 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPP 393

Query: 319 VKPT-LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P   PP P   P  PP P   PP +P P +P
Sbjct: 394 SPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPSP 426

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 37/92 (40%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 440 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 498

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P  +PP +P P+ P
Sbjct: 499 PPPPSPPPPSPPPPSPPPP--SPPPSPPPSHP 528

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 37/92 (40%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 180 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 238

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P  +PP  P P +P
Sbjct: 239 PPPPSPPPPSPPPPSPPPP--SPPPPPPPPSP 268

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP   
Sbjct: 190 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 249

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P P   P  PP P   PPS P P+ P
Sbjct: 250 PPPSPPPPSPPPPPPPPSPPPPSPPPPSPP 279

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 36/90 (40%), Positives = 38/90 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP + PP   PP   
Sbjct: 274 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PPPSPPPSPPPPSPP 330

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 331 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 360

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 37/96 (38%), Positives = 41/96 (42%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPV----ILPPVTVPPVTVPPIT 306
           P P    PS  P  P  PP   PP   PP   PP   PP       PP + PP + PP  
Sbjct: 360 PPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 419

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   P  P  P  +P  PP P   PPS P P+ P
Sbjct: 420 SPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPP 455

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 35/87 (40%), Positives = 35/87 (40%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 230 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 289

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P  PP P   P  PP P   PPS P P
Sbjct: 290 PPSPPPPSPPPPSPPPPSPPPPSPPPP 316

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 245 PPPSPPPPSPPPPSPPPPPP--PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 302

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  P  P   PP +P P +P
Sbjct: 303 PPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSP 334

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 34/90 (37%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 250 PPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 309

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P  +P   P P   PP +P P +P
Sbjct: 310 PPSPPPPPPSPPPSPPPPSPPPPSPPPPSP 339

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 38/93 (40%), Positives = 39/93 (41%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 311 PSPPPPPPSPPPSPP--PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 368

Query: 319 VKPTLP-PIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P P P   P  PP P   PPS P P+ P
Sbjct: 369 PPPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 401

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 35/92 (38%), Positives = 35/92 (38%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P     PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 434 PSPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 493

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P    P
Sbjct: 494 PPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 525

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/90 (37%), Positives = 35/90 (38%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 235 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 294

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PP    P +P
Sbjct: 295 PPSPPPPSPPPPSPPPPSPPPPPPSPPPSP 324

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/92 (38%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 284 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPPPSPPPSPPPPSPPPPSPPPPSPPPP 342

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P   P P   P   P P   PP +P P  P
Sbjct: 343 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 374

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 31/74 (41%), Positives = 32/74 (43%)
 Frame = +1

Query: 193 PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPV 372
           P   PP   PP   PP   PP   PP   PP   PP   PP   P  PP P   P  PP 
Sbjct: 112 PPTTPPPSPPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPSPPP 171

Query: 373 PVLNPPSTPTPTTP 414
           P   PPS P P+ P
Sbjct: 172 PSPPPPSPPPPSPP 185

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 38/99 (38%), Positives = 40/99 (40%), Gaps = 8/99 (8%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 450 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 508

Query: 319 VKPTLPPIPGVTPILPPV-----PVLNPPSTP---TPTT 411
             P  PP P   P  PP      P ++PP  P    PTT
Sbjct: 509 PPPPSPPPPSPPPSPPPSHPPSHPPMHPPMHPPFLPPTT 547

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 37/96 (38%), Positives = 38/96 (39%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPV--KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P P    PS  P  P    PP   PP   PP   PP   PP   PP   PP   PP   P
Sbjct: 445 PPPSPPPPSPPPPSPPPPSPP---PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 501

Query: 313 PVVKPTLPPIPGVTPILPP--VPVLNPPSTPTPTTP 414
           P   P  PP P   P  PP   P  +PPS P    P
Sbjct: 502 PSPPPPSPPPPSPPPPSPPPSPPPSHPPSHPPMHPP 537

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 30/72 (41%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
 Frame = +1

Query: 202 VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLP-PIPGVTPILPPVPV 378
           +PP   PP   PP  +PP   PP + PP + PP + PP   P  P P P   P  PP P 
Sbjct: 111 IPPTTPPPS--PPPSQPPPSPPPPSPPPPSPPPPSPPPPSPPPPPSPPPPPPPPSPPPPS 168

Query: 379 LNPPSTPTPTTP 414
             PPS P P+ P
Sbjct: 169 PPPPSPPPPSPP 180

[142][TOP]
>UniRef100_A8IGC9 Fibrocystin-L-like protein n=1 Tax=Chlamydomonas reinhardtii
            RepID=A8IGC9_CHLRE
          Length = 4806

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 39/90 (43%), Positives = 43/90 (47%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  PV PP   PP   PPG +PP  +PP   PP   PP   PP   PP  +
Sbjct: 4539 PSPAPPSPAPPSPV-PPSPAPPSPAPPGPLPPSPRPPA--PPSPSPPSPRPPSPNPPSPR 4595

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P  PPVP   PP  P P +P
Sbjct: 4596 PPAPPSP---PPKPPVPPSPPPKPPVPPSP 4622

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 35/90 (38%), Positives = 40/90 (44%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS    +P  PP   PP  +PP   PP   PP  +PP   PP   PP  +PP  +
Sbjct: 4513 PSPPSPSPPSPRPPAPPSPSPPSPRPPSPAPPSPAPPSPVPPSPAPPSPAPPGPLPPSPR 4572

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P      PP P  NPPS   P  P
Sbjct: 4573 PPAPPSPSPPSPRPPSP--NPPSPRPPAPP 4600

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 39/92 (42%), Positives = 44/92 (47%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP    PS  P  P  PPG +PP  +PP   PP   PP   PP   PP   PP    P 
Sbjct: 4551 PVP----PSPAPPSPA-PPGPLPPSPRPPA--PPSPSPPSPRPPSPNPPSPRPPAPPSPP 4603

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             KP +PP P   P +PP P   PP  P P +P
Sbjct: 4604 PKPPVPPSPPPKPPVPPSPPPAPPMPPRPPSP 4635

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 35/90 (38%), Positives = 43/90 (47%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P +PP  VPP   PP   PP  +PP+  PP   PP  +PP   PP  +
Sbjct: 4455 PSPRPPSPRPPSP-RPPSPVPPSPVPPSPAPPSPRPPLPSPPAPRPPRPLPPSPRPP--R 4511

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P      PP P    P +P P +P
Sbjct: 4512 PPSPPSPSPPSPRPPAPPSPSPPSPRPPSP 4541

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 39/98 (39%), Positives = 42/98 (42%), Gaps = 8/98 (8%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV-PPITVPPVV 321
            P    PS     P  PP  VPP   PP   PP   PP  LPPV   P+   PP   PP  
Sbjct: 4674 PSPAPPSPPSPAPPVPPSPVPPSPSPPSPAPPSPSPPSPLPPVPPSPLPPRPPSPTPPSP 4733

Query: 322  KPT-------LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            KP         PP+P   P  PPVP   PP  P+P  P
Sbjct: 4734 KPPRPPSPPPAPPVPPSPPPSPPVPPGPPPKPPSPPRP 4771

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 37/94 (39%), Positives = 42/94 (44%)
 Frame = +1

Query: 133  GKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            G+  P    PS  P  P   P   PP   PP   PP  +PP   PP  VPP  VPP   P
Sbjct: 4427 GRAPPSPAPPSPDPPSPPPLPPPSPPT--PPSPRPPSPRPPSPRPPSPVPPSPVPPSPAP 4484

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  +P LP  P   P  P  P   PP  P+P +P
Sbjct: 4485 PSPRPPLPSPPAPRPPRPLPPSPRPPRPPSPPSP 4518

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 36/90 (40%), Positives = 42/90 (46%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP  +PP   PP  +PP  +PP  VPP   PP   PP+  
Sbjct: 4436 PSPDPPSPPPLPPPSPP--TPPSPRPPSPRPPSPRPPSPVPPSPVPPSPAPPSPRPPLPS 4493

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P+P+ P
Sbjct: 4494 PPAPRPPRPLPPSPRPP--RPPSPPSPSPP 4521

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/93 (37%), Positives = 41/93 (44%), Gaps = 3/93 (3%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIV---PPIVKPPVILPPVTVPPVTVPPITVPP 315
            P+   PS +P +P  PP   PP  +PP      PP  +PP   PP   PP  VPP   PP
Sbjct: 4500 PRPLPPSPRPPRPPSPPSPSPPSPRPPAPPSPSPPSPRPPSPAPPSPAPPSPVPPSPAPP 4559

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P  P  P   P  PP P    P  P+P  P
Sbjct: 4560 SPAPPGPLPPSPRPPAPPSPSPPSPRPPSPNPP 4592

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 39/102 (38%), Positives = 45/102 (44%), Gaps = 10/102 (9%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPG----IVPPIVKPPVILPP------VTVPPV 288
            P P    P + P  P +PP   PP  KPPG      PP   PP   PP        VPP 
Sbjct: 4633 PSPSPPSP-RPPSPPPRPPSPTPPSPKPPGPSPPPAPPSPSPPSPAPPSPPSPAPPVPPS 4691

Query: 289  TVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             VPP   PP   P  P  P   P +PP P+   P +PTP +P
Sbjct: 4692 PVPPSPSPPSPAPPSPSPPSPLPPVPPSPLPPRPPSPTPPSP 4733

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 36/96 (37%), Positives = 42/96 (43%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPP------VTVPPIT 306
            P    PS +P  PV PP  VPP   PP   PP+  PP   PP  +PP         PP  
Sbjct: 4460 PSPRPPSPRPPSPV-PPSPVPPSPAPPSPRPPLPSPPAPRPPRPLPPSPRPPRPPSPPSP 4518

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP  +P  PP P      PP P    P+ P+P  P
Sbjct: 4519 SPPSPRPPAPPSPSPPSPRPPSPAPPSPAPPSPVPP 4554

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 32/85 (37%), Positives = 37/85 (43%)
 Frame = +1

Query: 160  PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
            P   P  P  PP   PP  +PP   PP   PP  +PP   PP   PP+  PP  +P  P 
Sbjct: 4444 PPLPPPSPPTPPSPRPPSPRPPSPRPPSPVPPSPVPPSPAPPSPRPPLPSPPAPRPPRPL 4503

Query: 340  IPGVTPILPPVPVLNPPSTPTPTTP 414
             P   P  PP P    P +P P  P
Sbjct: 4504 PPSPRPPRPPSPPSPSPPSPRPPAP 4528

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 37/93 (39%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P PK   PS  P  P   PP   PP   PP   PP+  PP  +PP   PP   PP   PP
Sbjct: 4655 PSPKPPGPSPPPAPPSPSPPSPAPP--SPPSPAPPV--PPSPVPPSPSPPSPAPPSPSPP 4710

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P +PP P   P  PP P    P  P P +P
Sbjct: 4711 SPLPPVPPSP--LPPRPPSPTPPSPKPPRPPSP 4741

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/90 (37%), Positives = 40/90 (44%), Gaps = 1/90 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS     P  PP   PP+  PP  VPP   PP   PP   PP  +PP+   P+
Sbjct: 4664 PPPAPPSPSPPSPAPPSPPSPAPPV--PPSPVPPSPSPPSPAPPSPSPPSPLPPVPPSPL 4721

Query: 319  V-KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              +P  P  P   P  PP P   PP  P+P
Sbjct: 4722 PPRPPSPTPPSPKPPRPPSPPPAPPVPPSP 4751

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 41/111 (36%), Positives = 42/111 (37%), Gaps = 19/111 (17%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPG------IVPPIVKPPVILPPVTVPPVTVPP 300
            P P   KP   P  P  PP   PP   PP        VPP   PP   PP   PP   PP
Sbjct: 4652 PTPPSPKPPG-PSPPPAPPSPSPPSPAPPSPPSPAPPVPPSPVPPSPSPPSPAPPSPSPP 4710

Query: 301  ITVPPVVKPTL-------------PPIPGVTPILPPVPVLNPPSTPTPTTP 414
              +PPV    L             PP P   P  PPVP   PPS P P  P
Sbjct: 4711 SPLPPVPPSPLPPRPPSPTPPSPKPPRPPSPPPAPPVPPSPPPSPPVPPGP 4761

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/100 (35%), Positives = 41/100 (41%), Gaps = 10/100 (10%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPV----------KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV 294
            P    P+ +P +P+           PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 4490 PLPSPPAPRPPRPLPPSPRPPRPPSPPSPSPPSPRPP--APPSPSPPSPRPPSPAPPSPA 4547

Query: 295  PPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP  VPP   P  P  PG  P  P  P    PS P+P  P
Sbjct: 4548 PPSPVPPSPAPPSPAPPGPLPPSPRPPAPPSPSPPSPRPP 4587

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 38/94 (40%), Positives = 43/94 (45%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVP--PIVKPPVILPPVTVPPVTVPPITVP 312
            PVP    P+  P  P +PP   PP  +PP   P  P   PP   PP   PP   PP   P
Sbjct: 4617 PVPPSPPPA--PPMPPRPPSPSPPSPRPPSPPPRPPSPTPPSPKPPGPSPP-PAPPSPSP 4673

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  PP P   P +PP PV   PS P+P  P
Sbjct: 4674 PSPAPPSPPSP--APPVPPSPVPPSPSPPSPAPP 4705

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/85 (42%), Positives = 40/85 (47%)
 Frame = +1

Query: 160  PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
            PS  P  P +PP   PP  +PP    P  KPPV   P   PPV   P   PP+  P  PP
Sbjct: 4577 PSPSPPSP-RPPSPNPPSPRPPAPPSPPPKPPVPPSPPPKPPVPPSPPPAPPM--PPRPP 4633

Query: 340  IPGVTPILPPVPVLNPPSTPTPTTP 414
             P      PP P   PPS PTP +P
Sbjct: 4634 SPSPPSPRPPSPPPRPPS-PTPPSP 4657

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 35/94 (37%), Positives = 40/94 (42%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI--LPPVTVPPVTVPPITVP 312
            PVP    P  KP  P  PP   P   +PP   PP  +PP     PP   PP   PP   P
Sbjct: 4607 PVPPS--PPPKPPVPPSPPPAPPMPPRPPSPSPPSPRPPSPPPRPPSPTPPSPKPPGPSP 4664

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P+  P P   P  PP P    P +P P +P
Sbjct: 4665 PPAPPSPSP-PSPAPPSPPSPAPPVPPSPVPPSP 4697

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 35/93 (37%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPP-VILPPVTVPPVTVPPITVPP 315
            PVP    PS  P  P +PP   PP  +PP  +PP  +PP    PP   PP   PP    P
Sbjct: 4477 PVP----PSPAPPSP-RPPLPSPPAPRPPRPLPPSPRPPRPPSPPSPSPPSPRPPAPPSP 4531

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                  PP P      PP PV   P+ P+P  P
Sbjct: 4532 SPPSPRPPSPAPPSPAPPSPVPPSPAPPSPAPP 4564

[143][TOP]
>UniRef100_Q67WV0 Os06g0643500 protein n=1 Tax=Oryza sativa Japonica Group
           RepID=Q67WV0_ORYSJ
          Length = 255

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 58/164 (35%), Positives = 71/164 (43%), Gaps = 43/164 (26%)
 Frame = +1

Query: 52  SSKIHAYLFLCMLFLSSA-APILG-----CGTCGKPV-PKKHKPSKKPGKPVKPPGIVP- 207
           S+K+  +L   +L LS+  A IL      C  C KP  PK   PS  PG P  P    P 
Sbjct: 4   STKLRPFLLTLLLLLSTTVASILAEYDPECD-CDKPKHPKPSHPSPSPGHPKGPKNPTPR 62

Query: 208 ---------PIVKPPGIVPP------------IVKPPVIL---PPVTVPPVTV------- 294
                    P+ +PP +V P            + +PP +    PPVT PPV V       
Sbjct: 63  PPKGPTYPSPVTRPPPLVAPPKVPVTHPPKGPVTRPPPVTYPTPPVTTPPVVVGPPVTYP 122

Query: 295 -PPITVPPVV--KPTLPPIPGVTPILPPVPVLNPP-STPTPTTP 414
            PP+T PPVV   P   P P VT   PPV    PP +TP P  P
Sbjct: 123 TPPVTTPPVVVGPPVTYPTPPVTYPTPPVTYPTPPTTTPCPPPP 166

[144][TOP]
>UniRef100_Q5I2R0 Minus agglutinin n=1 Tax=Chlamydomonas incerta RepID=Q5I2R0_CHLIN
          Length = 4027

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 38/93 (40%), Positives = 45/93 (48%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPG-KPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P+P    P + P  +P +PP   PPI +PP   P I  PP   PP   PP  VPP   PP
Sbjct: 831  PIPHLPPPPEPPSPEPPRPPSPEPPIPEPPSPAPLIPAPPSPAPPSPQPPSPVPPSPAPP 890

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              +P  P  P   P  P  P   PPS PTP +P
Sbjct: 891  SPEPPSPTPPSPAPPSPAPPSPEPPS-PTPPSP 922

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 39/96 (40%), Positives = 45/96 (46%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P PK  KPS +P  P +PP  +PP  KPP   PP   PP   PP   PP   PP   PP 
Sbjct: 717  PSPKPPKPSPRPPSP-RPPSPIPPSPKPPTPAPPSPAPPRPNPPSPGPPNLNPPSPEPPS 775

Query: 319  VKPTLPPIPGVTPI----LPPVPVLNPPSTPTPTTP 414
              P  P  P   P      PP+P    PS+P P +P
Sbjct: 776  PLPPSPAPPSPAPQPPSPSPPLPPSPAPSSPEPPSP 811

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/91 (40%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  PV PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 870  PSPAPPSPQPPSPV-PPSPAPPSPEPPSPTPPSPAPPSPAPPSPEPPSPTPPSPQPPSPA 928

Query: 325  PTLPPIPGVTPILPPVPVLNPPST-PTPTTP 414
            P LP  P   P  P  P   PPS  P P +P
Sbjct: 929  PALPTPPSPVPPSPAPPSPEPPSPFPPPPSP 959

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 42/106 (39%), Positives = 49/106 (46%), Gaps = 1/106 (0%)
 Frame = +1

Query: 100  SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPP-GIVPPIVKPPGIVPPIVKPPVILPPVT 276
            S AP L       P P+   PS +P  P  PP    PP  +PP   PP  +PP   P + 
Sbjct: 1033 SPAPALPAPPSPVP-PRPAPPSPEPPSPFPPPPSPAPPSPEPPSPAPPSPQPPSPAPALP 1091

Query: 277  VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP  VPP  VPP   P+ PP P  +P  P  P   PPS P P  P
Sbjct: 1092 APPSPVPPSPVPP--SPSEPPSPFPSPPSPVPPSPEPPS-PAPPRP 1134

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 45/97 (46%), Gaps = 4/97 (4%)
 Frame = +1

Query: 136  KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            +P P + +P     +  +PP   P +  PP  VPP   PP   PP   PP   PP   PP
Sbjct: 1238 RPTPPRPEPPSPTPQIPQPPSPAPALPAPPSPVPPSPAPPSPEPPSPRPPSPEPPSPTPP 1297

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPS----TPTPTTP 414
            +     PP P   P+LP  P   PPS    +PTP+ P
Sbjct: 1298 IPPSPTPPSP--QPLLPAPPSPEPPSPAPPSPTPSVP 1332

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 36/95 (37%), Positives = 40/95 (42%), Gaps = 5/95 (5%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P    PS  P  P  P    P   PP  +PP   PP  +PP   PP   PP  +PP   P
Sbjct: 972  PSPQPPSPAPALPAPPSPVPPSPAPPSPEPPSPFPPSPEPPNPAPPSPEPPSPIPPSPQP 1031

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPST-PTPTTP 414
            P   P LP  P   P  P  P   PPS  P P +P
Sbjct: 1032 PSPAPALPAPPSPVPPRPAPPSPEPPSPFPPPPSP 1066

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 36/92 (39%), Positives = 41/92 (44%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP  +PP   PP  +PP   P +  PP  VPP   PP  +
Sbjct: 890  PSPEPPSPTPPSPA-PPSPAPPSPEPPSPTPPSPQPPSPAPALPTPPSPVPPSPAPPSPE 948

Query: 325  P--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P    PP P   P  P  P   PPS P P +P
Sbjct: 949  PPSPFPPPPSPAPPSPEPPSPTPPS-PQPPSP 979

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 41/109 (37%), Positives = 46/109 (42%), Gaps = 4/109 (3%)
 Frame = +1

Query: 100  SAAPILGCGTCGKPVPKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILP 267
            S AP L       P P    PS +P  P  P    P   PP  +PP   PP  +PP   P
Sbjct: 1148 SPAPALPAPRSPVP-PSPAPPSPEPPSPFPPSPAQPSPAPPSPEPPSPTPPSPQPPSPAP 1206

Query: 268  PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +  PP  VPP   PP  +P  P  P   P  P  P   PPS PTP  P
Sbjct: 1207 ALPAPPSPVPPSPAPPSPEPPSPFPPSPAPPRPTPPRPEPPS-PTPQIP 1254

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 36/90 (40%), Positives = 42/90 (46%), Gaps = 2/90 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P +PP   PPI  PP   PP  +P +  PP   PP   PP   P V  
Sbjct: 1277 PSPEPPSPRPPSP-EPPSPTPPI--PPSPTPPSPQPLLPAPPSPEPPSPAPPSPTPSVPA 1333

Query: 325  PTLPPIPGVTP--ILPPVPVLNPPSTPTPT 408
            P  P  P  TP  + PP P   PPS P P+
Sbjct: 1334 PPSPAPPSPTPPQLPPPAPSPQPPSQPPPS 1363

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/92 (39%), Positives = 43/92 (46%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP  +PP  +PP  +PP   P +  PP  VPP   PP  +
Sbjct: 997  PSPEPPSPFPPSP-EPPNPAPPSPEPPSPIPPSPQPPSPAPALPAPPSPVPPRPAPPSPE 1055

Query: 325  P--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P    PP P   P  P  P   PPS P P +P
Sbjct: 1056 PPSPFPPPPSPAPPSPEPPSPAPPS-PQPPSP 1086

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 39/105 (37%), Positives = 43/105 (40%)
 Frame = +1

Query: 100  SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
            S AP L       P P    PS +P  P  PP   PP   PP   PP   P +  PP   
Sbjct: 1203 SPAPALPAPPSPVP-PSPAPPSPEPPSPF-PPSPAPPRPTPPRPEPPSPTPQIPQPPSPA 1260

Query: 280  PPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P +  PP  VPP   P  P  P   P  P  P   PP  P+PT P
Sbjct: 1261 PALPAPPSPVPPSPAPPSPEPPSPRPPSPEPPSPTPPIPPSPTPP 1305

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 34/94 (36%), Positives = 40/94 (42%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP-- 312
            P P    PS+ P     PP  VPP  +PP   PP  +PP   PP   PP   P +  P  
Sbjct: 1099 PSPVPPSPSEPPSPFPSPPSPVPPSPEPPSPAPPRPEPPSPTPPSPQPPSPAPALPAPRS 1158

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PV     PP P      PP P    P+ P+P  P
Sbjct: 1159 PVPPSPAPPSPEPPSPFPPSPAQPSPAPPSPEPP 1192

 Score = 57.4 bits (137), Expect(2) = 2e-08
 Identities = 35/88 (39%), Positives = 42/88 (47%), Gaps = 3/88 (3%)
 Frame = +1

Query: 160  PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPP---VILPPVTVPPVTVPPITVPPVVKPT 330
            PS  P  P +PP   PP   PP   PP  +PP     LPP   PP   PP   PP  +P 
Sbjct: 799  PSPAPSSP-EPPSPAPPSPDPPSPTPPSPQPPSPIPHLPPPPEPPSPEPP--RPPSPEPP 855

Query: 331  LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            +P  P   P++P  P   PPS P P +P
Sbjct: 856  IPEPPSPAPLIPAPPSPAPPS-PQPPSP 882

 Score = 24.6 bits (52), Expect(2) = 2e-08
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 2/47 (4%)
 Frame = +2

Query: 50  SPQRSMLTSSSACSSSPLPPPFSVAAPAVSPSQRN--TSPAKSPASP 184
           SP    L   S    SPLPP  +  +PA  P   +    P+ +P+SP
Sbjct: 760 SPGPPNLNPPSPEPPSPLPPSPAPPSPAPQPPSPSPPLPPSPAPSSP 806

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 42/92 (45%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P+P+   PS  P  P  PP   PP  +PP  VPP   PP   PP   PP   PP   PP 
Sbjct: 855  PIPEP--PSPAPLIPA-PPSPAPPSPQPPSPVPPSPAPPSPEPPSPTPPSPAPPSPAPPS 911

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P  P  P   P   P P L  P +P P +P
Sbjct: 912  PEPPSPTPPSPQP-PSPAPALPTPPSPVPPSP 942

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 40/106 (37%), Positives = 46/106 (43%), Gaps = 1/106 (0%)
 Frame = +1

Query: 100  SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPP-GIVPPIVKPPGIVPPIVKPPVILPPVT 276
            S AP L       P P    PS +P  P  PP    PP  +PP   PP  +PP   P + 
Sbjct: 926  SPAPALPTPPSPVP-PSPAPPSPEPPSPFPPPPSPAPPSPEPPSPTPPSPQPPSPAPALP 984

Query: 277  VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP  VPP   PP  +P  P  P   P  P  P   PPS P P +P
Sbjct: 985  APPSPVPPSPAPPSPEPPSPFPPSPEPPNPAPPSPEPPS-PIPPSP 1029

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 37/95 (38%), Positives = 44/95 (46%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139  PVPK-KHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P P+    PS  P  P  PP  VPP   PP   PP  +PP   PP   PP  +PP   PP
Sbjct: 1249 PTPQIPQPPSPAPALPA-PPSPVPPSPAPPSPEPPSPRPPSPEPPSPTPP--IPPSPTPP 1305

Query: 316  VVKPTLPPIPGVTP--ILPPVPVLNPPSTPTPTTP 414
              +P LP  P   P    PP P  + P+ P+P  P
Sbjct: 1306 SPQPLLPAPPSPEPPSPAPPSPTPSVPAPPSPAPP 1340

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/92 (38%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  P    PP   PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 1192 PSPTPPSPQPPSPA-PALPAPPSPVPPSPAPPSPEPPSPFPPSPAPPRPTPPRPEPPSPT 1250

Query: 325  PTLPPIPGVTPIL--PPVPVLNPPSTPTPTTP 414
            P +P  P   P L  PP PV   P+ P+P  P
Sbjct: 1251 PQIPQPPSPAPALPAPPSPVPPSPAPPSPEPP 1282

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/90 (37%), Positives = 41/90 (45%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP  +PP   P I +PP   P +  PP  VPP   PP  +
Sbjct: 1222 PSPEPPSPFPPSPA-PPRPTPPRPEPPSPTPQIPQPPSPAPALPAPPSPVPPSPAPPSPE 1280

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P+   P +PTP +P
Sbjct: 1281 PPSPRPPSPEPPSPTPPI---PPSPTPPSP 1307

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/94 (38%), Positives = 38/94 (40%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P    PS  P  P  P    P   PP  +PP   PP   PP   PP   PP   P I  P
Sbjct: 1197 PSPQPPSPAPALPAPPSPVPPSPAPPSPEPPSPFPPSPAPPRPTPPRPEPPSPTPQIPQP 1256

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P LP  P   P  P  P   PPS P P +P
Sbjct: 1257 PSPAPALPAPPSPVPPSPAPPSPEPPS-PRPPSP 1289

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 38/99 (38%), Positives = 44/99 (44%), Gaps = 7/99 (7%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPP-----VILPPVTVPPVTVPPI 303
            P P+   P      P +PP   PP  +PP   PPI +PP     +  PP   PP   PP 
Sbjct: 824  PSPQPPSPIPHLPPPPEPPSPEPP--RPPSPEPPIPEPPSPAPLIPAPPSPAPPSPQPPS 881

Query: 304  TVPPVVKPTLPPIPGVTPILPPVPVLNPPS--TPTPTTP 414
             VPP   P  P  P  TP  P  P   PPS   P+PT P
Sbjct: 882  PVPPSPAPPSPEPPSPTPPSPAPPSPAPPSPEPPSPTPP 920

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/101 (35%), Positives = 42/101 (41%), Gaps = 11/101 (10%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPV-------KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPI 303
            P    PS +P +P        +PP   P I  PP   PP  +PP  +PP   PP   PP 
Sbjct: 837  PPPEPPSPEPPRPPSPEPPIPEPPSPAPLIPAPPSPAPPSPQPPSPVPPSPAPPSPEPPS 896

Query: 304  TVPPVVKPTLPPIPGVTPILPPVPVLNPPS----TPTPTTP 414
              PP   P  P  P   P  P  P   PPS     PTP +P
Sbjct: 897  PTPPSPAPPSPAPPSPEPPSPTPPSPQPPSPAPALPTPPSP 937

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 35/99 (35%), Positives = 43/99 (43%), Gaps = 9/99 (9%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV-----PPVTVPPITV 309
            P   +PS  P  P +PP   PP  +PP   P +  PP  +PP        PP   PP   
Sbjct: 1177 PSPAQPSPAPPSP-EPPSPTPPSPQPPSPAPALPAPPSPVPPSPAPPSPEPPSPFPPSPA 1235

Query: 310  PPVVKPTLPPIPGVTPILP----PVPVLNPPSTPTPTTP 414
            PP   P  P  P  TP +P    P P L  P +P P +P
Sbjct: 1236 PPRPTPPRPEPPSPTPQIPQPPSPAPALPAPPSPVPPSP 1274

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 35/96 (36%), Positives = 40/96 (41%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPV----KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
            P P    PS +P  P     +PP   P +  PP  VPP   PP   PP   PP   PP  
Sbjct: 955  PPPSPAPPSPEPPSPTPPSPQPPSPAPALPAPPSPVPPSPAPPSPEPPSPFPPSPEPPNP 1014

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP  +P  P  P   P   P P L  P +P P  P
Sbjct: 1015 APPSPEPPSPIPPSPQP-PSPAPALPAPPSPVPPRP 1049

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 42/97 (43%), Positives = 46/97 (47%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP    PS  P  PV PP  +PP  +PP   PP   P    PP + PP  VPP   PP 
Sbjct: 1443 PVPPA-PPSPAPPSPV-PPSPLPPSPEPPSPAPPSPAPNAPSPPSSAPPAPVPPSPGPPS 1500

Query: 319  VKPTLPPIPGVTP--ILPP---VPVLNPPSTPTPTTP 414
             +P   P PG  P   LPP    P L PPS P P  P
Sbjct: 1501 PQP---PSPGPAPPVQLPPSPRPPSLEPPS-PAPRPP 1533

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/96 (36%), Positives = 41/96 (42%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP  +PP   P +  PP  +PP   PP   PP   PP   
Sbjct: 900  PSPAPPSPAPPSP-EPPSPTPPSPQPPSPAPALPTPPSPVPPSPAPPSPEPPSPFPPPPS 958

Query: 325  PT--LPPIPGVTPILP----PVPVLNPPSTPTPTTP 414
            P    P  P  TP  P    P P L  P +P P +P
Sbjct: 959  PAPPSPEPPSPTPPSPQPPSPAPALPAPPSPVPPSP 994

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 37/92 (40%), Positives = 38/92 (41%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVP--PIVKPPVILPPVTVPPVTVPPITVPPV 318
            P    PS  P  P  PP  VPP   PP   P  P   PP   PP   PP   PP   PP 
Sbjct: 920  PSPQPPSPAPALPT-PPSPVPPSPAPPSPEPPSPFPPPPSPAPPSPEPPSPTPPSPQPPS 978

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P LP  P   P  P  P   PPS P P +P
Sbjct: 979  PAPALPAPPSPVPPSPAPPSPEPPS-PFPPSP 1009

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 36/92 (39%), Positives = 39/92 (42%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP    P + PG P  PP   PP   PP   PP  +P    PP  VPP    P    PV
Sbjct: 1400 PVPPG-PPPQPPGAPA-PPAPPPPSPAPPSPAPPSPEPRPPQPPSPVPPAPPSPAPPSPV 1457

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                LPP P      PP P  N PS P+   P
Sbjct: 1458 PPSPLPPSPEPPSPAPPSPAPNAPSPPSSAPP 1489

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 38/96 (39%), Positives = 42/96 (43%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP    PS  P  P +PP   PP   PP   PP  +PP   PP   PP   P +  PP 
Sbjct: 882  PVP----PSPAPPSP-EPPSPTPPSPAPPSPAPPSPEPPSPTPPSPQPPSPAPALPTPPS 936

Query: 319  VKP--TLPPIPGVTPILPPVPVLNPPS--TPTPTTP 414
              P    PP P      PP P   PPS   P+PT P
Sbjct: 937  PVPPSPAPPSPEPPSPFPPPPSPAPPSPEPPSPTPP 972

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 33/92 (35%), Positives = 40/92 (43%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P +PP   PP  +PP   P +  PP  +PP   PP   PP   PP 
Sbjct: 950  PSPFPPPPSPAPPSP-EPPSPTPPSPQPPSPAPALPAPPSPVPPSPAPPSPEPPSPFPPS 1008

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P  P  P   P   P+P    P +P P  P
Sbjct: 1009 PEPPNPAPPSPEPP-SPIPPSPQPPSPAPALP 1039

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 35/93 (37%), Positives = 42/93 (45%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP    PS  P  P +PP   PP  +PP   PP  +PP  +PP   PP   P +  PP 
Sbjct: 989  PVP----PSPAPPSP-EPPSPFPPSPEPPNPAPPSPEPPSPIPPSPQPPSPAPALPAPPS 1043

Query: 319  VKPTLPPIPGVTPILP-PVPVLNPPSTPTPTTP 414
              P  P  P   P  P P P    P +P P +P
Sbjct: 1044 PVPPRPAPPSPEPPSPFPPPPSPAPPSPEPPSP 1076

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 33/100 (33%), Positives = 42/100 (42%), Gaps = 10/100 (10%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPV----KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P    PS +P  P     +PP  +PP  +PP   P +  PP  +PP   PP   PP   P
Sbjct: 1002 PSPFPPSPEPPNPAPPSPEPPSPIPPSPQPPSPAPALPAPPSPVPPRPAPPSPEPPSPFP 1061

Query: 313  PVVKPTLPPIPGVTPILP------PVPVLNPPSTPTPTTP 414
            P   P  P     +P  P      P P L  P +P P +P
Sbjct: 1062 PPPSPAPPSPEPPSPAPPSPQPPSPAPALPAPPSPVPPSP 1101

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 35/92 (38%), Positives = 38/92 (41%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVP--PIVKPPVILPPVTVPPVTVPPITVPPV 318
            P    PS  P  P  PP  VPP   PP   P  P   PP   PP   PP   PP   PP 
Sbjct: 1027 PSPQPPSPAPALPA-PPSPVPPRPAPPSPEPPSPFPPPPSPAPPSPEPPSPAPPSPQPPS 1085

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P LP  P   P  P  P  + P +P P+ P
Sbjct: 1086 PAPALPAPPSPVPPSPVPPSPSEPPSPFPSPP 1117

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 37/94 (39%), Positives = 43/94 (45%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P +PP   PP  +PP   PP  +PP   P +  P   VPP   PP 
Sbjct: 1110 PSPFPSPPSPVPPSP-EPPSPAPPRPEPPSPTPPSPQPPSPAPALPAPRSPVPPSPAPPS 1168

Query: 319  VKP--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P    PP P      PP P   PPS PTP +P
Sbjct: 1169 PEPPSPFPPSPAQPSPAPPSP--EPPS-PTPPSP 1199

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 39/105 (37%), Positives = 46/105 (43%)
 Frame = +1

Query: 100  SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
            S AP L       P P    PS +P  P +PP   PP   PP  +PP   PP   P +  
Sbjct: 1258 SPAPALPAPPSPVP-PSPAPPSPEPPSP-RPPSPEPPSPTPP--IPPSPTPPSPQPLLPA 1313

Query: 280  PPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   PP   PP   P++P  P   P  P  P L PP  P+P  P
Sbjct: 1314 PPSPEPPSPAPPSPTPSVPAPPSPAPPSPTPPQL-PPPAPSPQPP 1357

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 38/109 (34%), Positives = 44/109 (40%), Gaps = 17/109 (15%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV------------- 279
            P P    PS  P  P +PP   PP  +PP   P +  PP  +PP  V             
Sbjct: 1057 PSPFPPPPSPAPPSP-EPPSPAPPSPQPPSPAPALPAPPSPVPPSPVPPSPSEPPSPFPS 1115

Query: 280  PPVTVPPITVPPVVKPTLPPIPGVTPILP----PVPVLNPPSTPTPTTP 414
            PP  VPP   PP   P  P  P  TP  P    P P L  P +P P +P
Sbjct: 1116 PPSPVPPSPEPPSPAPPRPEPPSPTPPSPQPPSPAPALPAPRSPVPPSP 1164

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 37/92 (40%), Positives = 40/92 (43%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP    PS  P  P +PP    P   PP  VPP  +PP   PP   PP   PP   PP 
Sbjct: 1096 PVP----PSPVPPSPSEPPS---PFPSPPSPVPPSPEPPSPAPPRPEPPSPTPPSPQPPS 1148

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P LP      P  P  P   PPS P P +P
Sbjct: 1149 PAPALPAPRSPVPPSPAPPSPEPPS-PFPPSP 1179

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/94 (37%), Positives = 37/94 (39%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVK----PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P    PS  P  P      PP   PP  +PP   PP    P   PP   PP   PP   P
Sbjct: 1142 PSPQPPSPAPALPAPRSPVPPSPAPPSPEPPSPFPPSPAQPSPAPPSPEPPSPTPPSPQP 1201

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P LP  P   P  P  P   PPS P P +P
Sbjct: 1202 PSPAPALPAPPSPVPPSPAPPSPEPPS-PFPPSP 1234

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 36/94 (38%), Positives = 40/94 (42%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP--PVTVPPVTVPPITVPPV 318
            P    PS  P  P +PP   P +  PP  VPP   PP   P  P   PP   PP   PP 
Sbjct: 910  PSPEPPSPTPPSP-QPPSPAPALPTPPSPVPPSPAPPSPEPPSPFPPPPSPAPPSPEPPS 968

Query: 319  VKPTLPPIPGVTPIL--PPVPVLNPPSTPTPTTP 414
              P  P  P   P L  PP PV   P+ P+P  P
Sbjct: 969  PTPPSPQPPSPAPALPAPPSPVPPSPAPPSPEPP 1002

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/92 (39%), Positives = 41/92 (44%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGI--VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P    PS  P  P  P  I  +PP  +PP   PP  +PP   PP+  PP   P I  PP 
Sbjct: 814  PSPDPPSPTPPSPQPPSPIPHLPPPPEPPSPEPP--RPPSPEPPIPEPPSPAPLIPAPPS 871

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P   PPS PTP +P
Sbjct: 872  PAPPSPQPPSPVPPSPAPPSPEPPS-PTPPSP 902

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 37/106 (34%), Positives = 42/106 (39%), Gaps = 1/106 (0%)
 Frame = +1

Query: 100  SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
            S AP++       P P    PS  P  P  PP   PP   PP   PP   PP   PP   
Sbjct: 861  SPAPLIPAPPSPAP-PSPQPPSPVPPSPA-PPSPEPPSPTPPSPAPPSPAPPSPEPPSPT 918

Query: 280  PPVTVPPITVPPVVKPTLPPIPGVTPILP-PVPVLNPPSTPTPTTP 414
            PP   PP   P +  P  P  P   P  P P     PP +P P +P
Sbjct: 919  PPSPQPPSPAPALPTPPSPVPPSPAPPSPEPPSPFPPPPSPAPPSP 964

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 33/92 (35%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P     +P +PP  VPP        PP   PP  +PP  +PP   PP   PP 
Sbjct: 1423 PAPPSPAPPSPEPRPPQPPSPVPP-------APPSPAPPSPVPPSPLPPSPEPPSPAPPS 1475

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P   PPS P P +P
Sbjct: 1476 PAPNAPSPPSSAPPAPVPPSPGPPS-PQPPSP 1506

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 36/96 (37%), Positives = 41/96 (42%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPV----KPPGIVPPIVKPPGIVPPIVKPPVILP--PVTVPPVTVPPIT 306
            P    PS +P  P+    +PP   P +  PP  VPP   PP   P  P   PP   PP  
Sbjct: 1012 PNPAPPSPEPPSPIPPSPQPPSPAPALPAPPSPVPPRPAPPSPEPPSPFPPPPSPAPPSP 1071

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP   P  P  P   P LP  P   PPS P P +P
Sbjct: 1072 EPPSPAPPSPQPPSPAPALPAPPSPVPPS-PVPPSP 1106

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 36/106 (33%), Positives = 42/106 (39%), Gaps = 14/106 (13%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGI-VPPIVKPPGIVPPIVKPPVI-------------LPPVT 276
            P P +      PG P +PPG   PP   PP   PP   PP                PP  
Sbjct: 1392 PAPLEPAAPVPPGPPPQPPGAPAPPAPPPPSPAPPSPAPPSPEPRPPQPPSPVPPAPPSP 1451

Query: 277  VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP  VPP  +PP  +P  P  P   P  P  P   PP+ P P +P
Sbjct: 1452 APPSPVPPSPLPPSPEPPSPAPPSPAPNAPSPPSSAPPA-PVPPSP 1496

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 35/96 (36%), Positives = 39/96 (40%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P  +P +P  P    PP   PP  VPP   PP   PP   PP   P    PP 
Sbjct: 1426 PSPAPPSPEPRPPQPPSPVPPAPPSPAPPSPVPPSPLPPSPEPPSPAPPSPAPNAPSPPS 1485

Query: 319  VKP--TLPPIPGVTPILPPVPVLNPP--STPTPTTP 414
              P   +PP PG     PP P   PP    P+P  P
Sbjct: 1486 SAPPAPVPPSPGPPSPQPPSPGPAPPVQLPPSPRPP 1521

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 36/93 (38%), Positives = 40/93 (43%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            PVP    PS  P  P  P PG  PP+  PP   PP ++PP   P    P  + P    PP
Sbjct: 1491 PVP----PSPGPPSPQPPSPGPAPPVQLPPSPRPPSLEPPSPAPRPPQPSPSPPSNPSPP 1546

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P  PP P      PP P L PP  P P  P
Sbjct: 1547 SRPPAPPPAP-----QPPSPPLAPPPAPPPPAP 1574

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/97 (37%), Positives = 43/97 (44%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIV---PPIVKPP--GIVPPIVKPPVILPPVTVPPVTVPPI 303
           P+P    P + P  P+ PP      PP  KPP     PP  +PP  +PP   PP   PP 
Sbjct: 693 PIPPSPAPPQPP--PLPPPVASLPPPPSPKPPKPSPRPPSPRPPSPIPPSPKPPTPAPPS 750

Query: 304 TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP   P  P  P + P  P  P   PPS P P +P
Sbjct: 751 PAPPRPNPPSPGPPNLNPPSPEPPSPLPPS-PAPPSP 786

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/97 (37%), Positives = 39/97 (40%), Gaps = 7/97 (7%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPP---IVKPPVILPPVTVPPVTVPPITVPP 315
            P    PS  P  P  PP  VPP   PP    P      PP  +PP   PP   PP   PP
Sbjct: 1079 PSPQPPSPAPALPA-PPSPVPPSPVPPSPSEPPSPFPSPPSPVPPSPEPPSPAPPRPEPP 1137

Query: 316  VVKPTLPPIPGVTPILP----PVPVLNPPSTPTPTTP 414
               P  P  P   P LP    PVP    P +P P +P
Sbjct: 1138 SPTPPSPQPPSPAPALPAPRSPVPPSPAPPSPEPPSP 1174

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 35/93 (37%), Positives = 42/93 (45%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P+P    PS  P  P +P    PP  +PP   PP   P V  PP   PP   PP   PP 
Sbjct: 1297 PIP----PSPTPPSP-QPLLPAPPSPEPPSPAPPSPTPSVPAPPSPAPPSPTPPQLPPPA 1351

Query: 319  VKPTLPPIPGVTPILP-PVPVLNPPSTPTPTTP 414
              P  P  P  +P LP P P+   P +P P +P
Sbjct: 1352 PSPQPPSQPPPSPALPSPHPLAPFPPSPQPPSP 1384

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 35/92 (38%), Positives = 39/92 (42%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI--LPPVTVPPVTVPPITVPPV 318
            P    PS  P  P  PP   PP   PP   PP  +PP     PPV +PP   PP   PP 
Sbjct: 1469 PSPAPPSPAPNAP-SPPSSAPPAPVPPSPGPPSPQPPSPGPAPPVQLPPSPRPPSLEPPS 1527

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P  +P   P P   PP+ P    P
Sbjct: 1528 PAPR-PPQPSPSPPSNPSPPSRPPAPPPAPQP 1558

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 33/99 (33%), Positives = 41/99 (41%), Gaps = 7/99 (7%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV---PPITV 309
            P P    P      P  PP   P   +PP   PP   PP   PP   PP  +   PP   
Sbjct: 781  PAPPSPAPQPPSPSPPLPPSPAPSSPEPPSPAPPSPDPPSPTPPSPQPPSPIPHLPPPPE 840

Query: 310  PPVVKPTLPPIPGVTPILP----PVPVLNPPSTPTPTTP 414
            PP  +P  PP P   P +P    P P++  P +P P +P
Sbjct: 841  PPSPEPPRPPSP--EPPIPEPPSPAPLIPAPPSPAPPSP 877

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 32/90 (35%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P+   PS  P  P +PP   P +  P   VPP   PP   PP   PP    P   PP  +
Sbjct: 1132 PRPEPPSPTPPSP-QPPSPAPALPAPRSPVPPSPAPPSPEPPSPFPPSPAQPSPAPPSPE 1190

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P   P P L  P +P P +P
Sbjct: 1191 PPSPTPPSPQP-PSPAPALPAPPSPVPPSP 1219

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 34/90 (37%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P +P  PP   PP + PP       +PP  LPP   PP   P    PP   
Sbjct: 744 PTPAPPSPAPPRP-NPPSPGPPNLNPPS-----PEPPSPLPPSPAPPSPAPQ---PPSPS 794

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P LPP P  +   PP P    P  P+PT P
Sbjct: 795 PPLPPSPAPSSPEPPSPAPPSPDPPSPTPP 824

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/91 (37%), Positives = 38/91 (41%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
            P    PS  P  P  +PP   PP+  PP   P   +PP   PP   PP   PP   PP  
Sbjct: 774  PSPLPPSPAPPSPAPQPPSPSPPL--PPSPAPSSPEPPSPAPPSPDPPSPTPPSPQPPSP 831

Query: 322  KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P LPP P      PP P    P  P P +P
Sbjct: 832  IPHLPPPPEPPSPEPPRPPSPEPPIPEPPSP 862

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 30/85 (35%), Positives = 34/85 (40%)
 Frame = +1

Query: 160  PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
            PS  P +P  P    PP   P    PP   PP   PP   PP   P    PP   P  PP
Sbjct: 1390 PSPAPLEPAAPVPPGPPPQPPGAPAPPAPPPPSPAPPSPAPPSPEPRPPQPPSPVPPAPP 1449

Query: 340  IPGVTPILPPVPVLNPPSTPTPTTP 414
             P     +PP P+   P  P+P  P
Sbjct: 1450 SPAPPSPVPPSPLPPSPEPPSPAPP 1474

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 34/94 (36%), Positives = 40/94 (42%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVP-PIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
            P  + PS +P  P+ P    P P  +PP   PP+  PP   P    PP   PP   PP  
Sbjct: 764  PNLNPPSPEPPSPLPPSPAPPSPAPQPPSPSPPL--PPSPAPSSPEPPSPAPPSPDPPSP 821

Query: 322  KPTLPPIPGVTPILPPVPVL---NPPSTPTPTTP 414
             P  P  P   P LPP P      PP  P+P  P
Sbjct: 822  TPPSPQPPSPIPHLPPPPEPPSPEPPRPPSPEPP 855

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 33/87 (37%), Positives = 38/87 (43%), Gaps = 2/87 (2%)
 Frame = +1

Query: 160  PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKP--TL 333
            PS  P  P  PP   PP   PP   PP   PP   PP  +PP   PP   P +  P   +
Sbjct: 987  PSPVPPSPA-PPSPEPPSPFPPSPEPPNPAPPSPEPPSPIPPSPQPPSPAPALPAPPSPV 1045

Query: 334  PPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP P      PP P   PP +P P +P
Sbjct: 1046 PPRPAPPSPEPPSP-FPPPPSPAPPSP 1071

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 36/103 (34%), Positives = 41/103 (39%), Gaps = 11/103 (10%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKP-VKPPGIVPPIVKPPGIVP--PIVKPPVILPPV--------TVPP 285
            P P +  P   PG P + PP   PP   PP   P  P  +PP   PP+          PP
Sbjct: 751  PAPPRPNPPS-PGPPNLNPPSPEPPSPLPPSPAPPSPAPQPPSPSPPLPPSPAPSSPEPP 809

Query: 286  VTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               PP   PP   P  P  P   P LPP P    P  P P +P
Sbjct: 810  SPAPPSPDPPSPTPPSPQPPSPIPHLPPPPEPPSPEPPRPPSP 852

[145][TOP]
>UniRef100_Q3HTK5 Pherophorin-C2 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK5_CHLRE
          Length = 853

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 38/92 (41%), Positives = 44/92 (47%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPPPSPPPP---PPPSPPPPSPPPPSPPPPSPPPPSPPPP 377

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P   PPS P P+ P
Sbjct: 378 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 409

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 38/92 (41%), Positives = 44/92 (47%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 223 PPPSPPPPSPPPPSPPPPP---PPSPPPPSPPPPSPPPP---PPPSPPPPSPPPPSPPPP 276

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P   PPS P P+ P
Sbjct: 277 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 308

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 37/92 (40%), Positives = 43/92 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 276 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP--PPPPSPPPPSPPPPSPPPPSPPPP 333

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P   PPS P P+ P
Sbjct: 334 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 365

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 37/90 (41%), Positives = 43/90 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP   
Sbjct: 437 PPPPPPSPPPPPPPSPPPPPPPSPPPP---PPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 493

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P+ PP P  +P  PP P   PPS P P+ P
Sbjct: 494 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 523

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   P    PP   PP 
Sbjct: 333 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 392

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 393 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 424

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   P    PP   PP 
Sbjct: 447 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 506

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 507 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 538

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 36/90 (40%), Positives = 42/90 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP   
Sbjct: 375 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPPP 433

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P+ PP P  +P  PP P   PP  P+P  P
Sbjct: 434 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 463

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 360 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP--PPPSPPPPSPPPPSPPPPSPPPPS 417

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP +P P  P
Sbjct: 418 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 36/92 (39%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP   PP 
Sbjct: 377 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PPP 433

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP +P P  P
Sbjct: 434 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 36/92 (39%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 365 PPPSPPPPSPPPPPPPSPPPPPPPSPPPP---PPPSPPPPSPPPPSPPPPSPPPPSPPPP 421

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P   P P   P  PP P  +PP  P P+ P
Sbjct: 422 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 453

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 37/93 (39%), Positives = 38/93 (40%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV-KPPVILPPVTVPPVTVPPITVPP 315
           P P    PS  P  P  PP   PP   PP   PP    PP   PP   PP   PP   PP
Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 318

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P   P  PP P   PP +P P  P
Sbjct: 319 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 37/92 (40%), Positives = 43/92 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 316 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP---PPPSPPPPSPPPPSPPPPSPPP- 371

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P   PP  P+P  P
Sbjct: 372 --PSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 401

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 37/92 (40%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP    P   PP + PP + PP 
Sbjct: 246 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 305

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P  P
Sbjct: 306 SPPPPPP-PSPPPPSPPPPSPPPPSPPPPPPP 336

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 35/92 (38%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P     PP   PP   PP   PP   PP   PP    P   PP + PP 
Sbjct: 388 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 447

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P   PPS P P+ P
Sbjct: 448 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 479

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 36/92 (39%), Positives = 42/92 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 203 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPP---PPPSPPPPSPPPPSPPPP 258

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP     P  PP P  +PP  P P+ P
Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 290

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 36/92 (39%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP + PP 
Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP---PPPSPPPP 284

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  P  P  +PP  P P+ P
Sbjct: 285 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 316

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 38/92 (41%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP + PP 
Sbjct: 293 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP---PPPSPPPP 349

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P   P  PP P   PPS P P  P
Sbjct: 350 PPPSPPP-PSPPPPSPPPPSPPPPSPPPPPPP 380

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/92 (38%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   P    PP   PP   PP   PP   PP 
Sbjct: 348 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 407

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P+P  P
Sbjct: 408 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 439

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/90 (40%), Positives = 42/90 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP   
Sbjct: 274 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP---PPPSPPPPSPPPPSPPP--- 327

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P+ PP P  +P  PP P   PP  P+P  P
Sbjct: 328 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 357

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 37/91 (40%), Positives = 38/91 (41%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV-PPITVPPVV 321
           P    PS  P  P  PP   PP   PP   PP   PP   PP   PP    PP   PP  
Sbjct: 339 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P  PP P   PPS P P+ P
Sbjct: 399 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 429

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 36/90 (40%), Positives = 38/90 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   PP   PP   PP + PP   P    PP   
Sbjct: 331 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPPPPSPPPPPPPS 389

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 419

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 37/96 (38%), Positives = 38/96 (39%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVK----PPVILPPVTVPPVTVPPIT 306
           P P    PS  P  P  PP   PP   PP   PP       PP   PP   PP   PP  
Sbjct: 414 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 473

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   P  PP P   P  PP P   PP +P P  P
Sbjct: 474 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 36/90 (40%), Positives = 38/90 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   PP   PP   PP + PP   P    PP   
Sbjct: 445 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP-PPPSPPPPPPPSPPPPPPPS 503

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS P P+ P
Sbjct: 504 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 533

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 39/108 (36%), Positives = 41/108 (37%), Gaps = 2/108 (1%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVPKKHKPSKKPGKPV--KPPGIVPPIVKPPGIVPPIVKPPVILPP 270
           +   PI   G    P P    PS  P  P    PP   PP   PP   PP   PP   PP
Sbjct: 179 NDCCPISTPGIPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 238

Query: 271 VTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              PP   PP   PP   P  PP P      PP P   PP +P P  P
Sbjct: 239 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 286

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 42/92 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 430 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP---PPPSPPPPSPPPPSPPPPSPPP- 485

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P   PP  P+P  P
Sbjct: 486 --PSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 515

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 37/91 (40%), Positives = 37/91 (40%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV-PPITVPPVV 321
           P    PS  P  P  PP   PP   PP   PP   PP   PP   PP    PP   PP  
Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P  PP P   PPS P P  P
Sbjct: 513 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 543

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   P    PP   PP   PP   PP   PP 
Sbjct: 462 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 521

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 522 PPPPSPPPPSPPPPSPPPP--PPPSPPPPSPP 551

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP    P   PP + PP   P    PP 
Sbjct: 399 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 458 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 489

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 37/92 (40%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP + PP   PP 
Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP---PPPSPPP-PPPPS 353

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P+P  P
Sbjct: 354 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 385

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/90 (38%), Positives = 36/90 (40%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 370 PPPSPPPPPPPSPPPPPPPSPPPPPPPS--PPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 427

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PP +P P  P
Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  P    PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP--PPSPPPPSPPPPSPPPPS 526

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 527 PPPPSPPPPSPPP--PPPPSPPPPSPPPPSPP 556

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/90 (38%), Positives = 36/90 (40%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 208 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PPPPSPPPPSPPPPSPPPPPPPSPP 264

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PP +P P  P
Sbjct: 265 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  P    PP   PP   PP   PP   PP + PP   PP   PP 
Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP---PPPSPPP---PPPPSPPP 462

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P  P
Sbjct: 463 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 494

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 37/92 (40%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  P    PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 355 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP--PPSPPPPSPPPPSPPPPS 412

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P  P
Sbjct: 413 PPPPSPPPPSPPPPSPPPP--PPPSPPPPPPP 442

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 34/92 (36%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   P    PP   PP   PP 
Sbjct: 392 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPS 451

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P   P P   PP +P P +P
Sbjct: 452 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSP 483

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 35/90 (38%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  P    PP   PP   PP   PP   PP + PP + PP + PP   
Sbjct: 256 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP---PPPSPPPPSPPPPSPPPPPP 312

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P+ PP P   P  PP P   PP  P+P  P
Sbjct: 313 PS-PPPPSPPPPSPPPPSPPPPPPPSPPPP 341

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 35/92 (38%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P      P  PP   PP   PP   PP   PP   PP + PP   P    PP 
Sbjct: 285 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPS-PPPPSPPPPSPPPPSPPPPPPPSPPPPPP 343

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 344 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 375

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/90 (38%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPP---PPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 269

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P  +PP  P P+ P
Sbjct: 270 PPSPP-PPPPPSPPPPPPPSPPPPPPPSPP 298

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 35/90 (38%), Positives = 36/90 (40%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   P    PP   PP   PP   PP   PP   
Sbjct: 308 PPPPPPSPPPPSP--PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 365

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PP +P P  P
Sbjct: 366 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/92 (39%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  P    PP   PP   PP   PP   PP   PP   PP + PP   
Sbjct: 238 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP---PPPSPPPPPP 294

Query: 325 PTLPP--IPGVTPILPPVPVLNPPSTPTPTTP 414
           P+ PP   P  +P  PP P   PPS P P+ P
Sbjct: 295 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 326

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 34/89 (38%), Positives = 37/89 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP 
Sbjct: 483 PPPPSPPPPPPPSPPPPPPPSPPP--PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP- 539

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
                PP P   P  PP     PPS P P
Sbjct: 540 -----PPPPSPPPPSPP-----PPSPPPP 558

[146][TOP]
>UniRef100_Q2PET4 Putative uncharacterized protein n=1 Tax=Trifolium pratense
           RepID=Q2PET4_TRIPR
          Length = 478

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 39/95 (41%), Positives = 45/95 (47%), Gaps = 1/95 (1%)
 Frame = +1

Query: 124 GTCGKPVPKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPP 300
           G  G  VP +  P  KP  PV KPP   PP+ KPP   PPI  PP+  PP   PP+  PP
Sbjct: 352 GKKGISVPVETPPVYKP--PVEKPPVYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPP 409

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              PPV KP +   P   P     P+  PP    P
Sbjct: 410 FEKPPVYKPPIEEPPFYKPPFENPPIYKPPYEKPP 444

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 36/85 (42%), Positives = 40/85 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PPI KPP   PP+ KPP+  PP   PP   PPI  PP  K
Sbjct: 383 PPMYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKPPIEEPPFYKPPFENPPIYKPPYEK 442

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTP 399
           P L   P   P L   P   PP  P
Sbjct: 443 PPLYKPPFEKPPLYKPPFEEPPHHP 467

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 37/88 (42%), Positives = 40/88 (45%), Gaps = 1/88 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P +  P  KP  PV KPP   PPI  PP   PP  KPP+  PP   PPV  PPI  PP  
Sbjct: 369 PVEKPPVYKP--PVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKPPIEEPPFY 426

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           KP     P   P     P+  PP    P
Sbjct: 427 KPPFENPPIYKPPYEKPPLYKPPFEKPP 454

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 36/95 (37%), Positives = 41/95 (43%), Gaps = 5/95 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP-----PVILPPVTVPPVTVPPITV 309
           P  +KP  +     KPP   PPI KPP   PPI KP     PV  PP+  PP   PP   
Sbjct: 373 PPVYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKPPIEEPPFYKPPFEN 432

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP+ KP     P   P     P+  PP    P  P
Sbjct: 433 PPIYKPPYEKPPLYKPPFEKPPLYKPPFEEPPHHP 467

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 32/87 (36%), Positives = 40/87 (45%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  +KP  +     KPP   PP+ KPP   PPI KPP   PP+  PP   PP+  PP+ +
Sbjct: 363 PPVYKPPVEKPPVYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKPPIEE 422

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P     P   P +   P   PP    P
Sbjct: 423 PPFYKPPFENPPIYKPPYEKPPLYKPP 449

[147][TOP]
>UniRef100_Q1KUY6 Putative uncharacterized protein n=1 Tax=Cleome spinosa
           RepID=Q1KUY6_9ROSI
          Length = 328

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 38/94 (40%), Positives = 49/94 (52%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPI--VKPPVILPP--VTVPPVTVPPITVP 312
           P    P     K V   G+  P  +P    PPI  + PP +LPP  +  PP  +PP+   
Sbjct: 215 PLPPNPVSLQNKKVDSLGVKKPDAQPDFFFPPIPFLPPPSLLPPNPLLPPPSGLPPLPFQ 274

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P LPP+P + P LPPVP LNPP +P P+ P
Sbjct: 275 PPPAPLLPPLPSI-PTLPPVPGLNPPPSPPPSLP 307

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 36/87 (41%), Positives = 47/87 (54%), Gaps = 4/87 (4%)
 Frame = +1

Query: 166 KKPGKPVKPPGIVPPI--VKPPGIVPP--IVKPPVILPPVTVPPVTVPPITVPPVVKPTL 333
           KKP    +P    PPI  + PP ++PP  ++ PP  LPP+   P   P +   P + PTL
Sbjct: 234 KKPD--AQPDFFFPPIPFLPPPSLLPPNPLLPPPSGLPPLPFQPPPAPLLPPLPSI-PTL 290

Query: 334 PPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP+PG+ P  PP P   PPS P P  P
Sbjct: 291 PPVPGLNP--PPSP---PPSLPIPLPP 312

[148][TOP]
>UniRef100_UPI0000DC195F UPI0000DC195F related cluster n=1 Tax=Rattus norvegicus
           RepID=UPI0000DC195F
          Length = 434

 Score = 67.0 bits (162), Expect(2) = 1e-10
 Identities = 38/94 (40%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPP--IVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P+P     S  P  P+  P + PP  +  PP + PP++ PP +LPP   PP+  PP+  P
Sbjct: 281 PLPPPPPSSSFPPLPLPLPLLPPPPLLPSPPLLPPPLLPPPPLLPP---PPLLPPPLLPP 337

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P LPP     P+LPP P+L PP  P P  P
Sbjct: 338 P---PLLPP----PPLLPPPPLLPPPLLPPPLLP 364

 Score = 22.3 bits (46), Expect(2) = 1e-10
 Identities = 10/19 (52%), Positives = 10/19 (52%)
 Frame = +2

Query: 89  SSSPLPPPFSVAAPAVSPS 145
           SSSP PPP     P   PS
Sbjct: 270 SSSPPPPPLPPPLPPPPPS 288

 Score = 60.1 bits (144), Expect(2) = 2e-08
 Identities = 35/95 (36%), Positives = 45/95 (47%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPP---IVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P P    P   P  P+ PP ++PP   +  PP + PP + PP +LPP  +PP  +PP  +
Sbjct: 314 PPPLLPPPPLLPPPPLLPPPLLPPPPLLPPPPLLPPPPLLPPPLLPPPLLPPPLLPPPLL 373

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP     LPP     P LPP P L     P    P
Sbjct: 374 PPPPPLLLPP----PPPLPPPPPLGHAMEPGSQEP 404

 Score = 21.6 bits (44), Expect(2) = 2e-08
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = +2

Query: 74  SSSACSSSPLPPPFSVAAPAVS 139
           SSS+    PLPPP     P+ S
Sbjct: 269 SSSSPPPPPLPPPLPPPPPSSS 290

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 38/116 (32%), Positives = 50/116 (43%), Gaps = 15/116 (12%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP 282
           A P++   T   PVP    P    G P+ P    P    PPG       PP + PP+  P
Sbjct: 226 APPLMNGLTPCPPVPDALPPPPPGGLPLPPMPTGPAPSGPPGPSSSSPPPPPLPPPLPPP 285

Query: 283 PVT--VPPITV-------------PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P +   PP+ +             PP++ P L P P   P+LPP P+L PP  P P
Sbjct: 286 PPSSSFPPLPLPLPLLPPPPLLPSPPLLPPPLLPPP---PLLPPPPLLPPPLLPPP 338

[149][TOP]
>UniRef100_Q6SSE8 Minus agglutinin n=1 Tax=Chlamydomonas reinhardtii RepID=Q6SSE8_CHLRE
          Length = 3889

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 36/92 (39%), Positives = 39/92 (42%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 1040 PPPSPEPPSPAPPSPA-PPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPS 1098

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P  P  P   P  PP P   PPS   P+ P
Sbjct: 1099 PRPPSPEPPSPVPPSPPPPSPEPPSPAPPSPP 1130

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 37/90 (41%), Positives = 39/90 (43%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP  VPP   
Sbjct: 1057 PSPEPPSPAPPSPA-PPSPEPPSPAPPSPAPPSPEPPSPAPPSPRPPSPEPPSPVPPSPP 1115

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  PP P L PPS   P+ P
Sbjct: 1116 PPSPEPPSPAPPSPPPPSLEPPSPAPPSPP 1145

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 37/96 (38%), Positives = 42/96 (43%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
            P P    PS +P  P  P    P  +PP   PP   PP  KPP  +PP  +PP   PP  
Sbjct: 782  PPPSPGPPSPEPPSPAPPSAAPPSPMPPSPAPPSPDPPSPKPPSPVPPSPLPPSPEPPSP 841

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            VPP   P  P      P  PP P   PPS   P+ P
Sbjct: 842  VPPSPPPASPEPTSPAPPSPPPPSPEPPSPAPPSPP 877

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 36/94 (38%), Positives = 43/94 (45%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P   + PP   PP  +PP   PP   PP  +PP   PP   PP   PP 
Sbjct: 766  PSPAPPSPPPPPSPSIPPPSPGPPSPEPPSPAPPSAAPPSPMPPSPAPPSPDPPSPKPPS 825

Query: 319  VKPT--LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P   LPP P     +PP P   PP++P PT+P
Sbjct: 826  PVPPSPLPPSPEPPSPVPPSP---PPASPEPTSP 856

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 36/90 (40%), Positives = 42/90 (46%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP  +PP   PP  VPP   PP   PP   
Sbjct: 1067 PSPAPPSPEPPSPA-PPSPAPPSPEPPSPAPPSPRPPSPEPPSPVPPSPPPPSPEPPSPA 1125

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P + P   P P   PP +P P +P
Sbjct: 1126 PPSPPPPSLEP-PSPAPPSPPPPSPEPPSP 1154

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 37/97 (38%), Positives = 43/97 (44%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPV-KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P P    P   PG P  +PP   PP   PP  +PP   PP   PP   PP  VPP  +PP
Sbjct: 775  PPPSPSIPPPSPGPPSPEPPSPAPPSAAPPSPMPPSPAPPSPDPPSPKPPSPVPPSPLPP 834

Query: 316  VVKPTLPPIPGVTPILP----PVPVLNPPSTPTPTTP 414
              +P  P  P   P  P    P P   PP +P P +P
Sbjct: 835  SPEPPSPVPPSPPPASPEPTSPAPPSPPPPSPEPPSP 871

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 37/92 (40%), Positives = 40/92 (43%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP+  PP   PP   PP 
Sbjct: 922  PPPSPEPPSPAPSPP--PPSPEPPSPAPPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPS 979

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P LPP P   PPS   P+ P
Sbjct: 980  PPPPSPEPPSPAP-LPPPPSPEPPSPAPPSPP 1010

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/96 (38%), Positives = 41/96 (42%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS +P  P  PP   PP  +PP   PP+  PP   PP   PP   PP   PP 
Sbjct: 931  PAPSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPS 989

Query: 319  VKPTLPP----IPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP     P   P  PP P   PPS   P+ P
Sbjct: 990  PAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 1025

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/90 (40%), Positives = 42/90 (46%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  PV PP   PP  +PP   PP   PP + PP   PP   PP   PP   
Sbjct: 1097 PSPRPPSPEPPSPV-PPSPPPPSPEPPSPAPPSPPPPSLEPPSPAPPSPPPPSPEPPSPA 1155

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P+ PP     P   PVP   PP +P P +P
Sbjct: 1156 PSPPPPSPEPP--SPVPPSPPPPSPEPPSP 1183

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 35/96 (36%), Positives = 39/96 (40%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 1029 PEPPSPAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPS 1088

Query: 319  VKPTLPPIPGVTPILP----PVPVLNPPSTPTPTTP 414
             +P  P  P   P  P    PVP   PP +P P +P
Sbjct: 1089 PEPPSPAPPSPRPPSPEPPSPVPPSPPPPSPEPPSP 1124

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 36/88 (40%), Positives = 39/88 (44%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P+ PP   PP   PP   PP   PP  LPP   PP  VPP   P   +
Sbjct: 794  PSPAPPSAAPPSPM-PPSPAPPSPDPPSPKPPSPVPPSPLPPSPEPPSPVPPSPPPASPE 852

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            PT P  P   P  P  P   PPS P P+
Sbjct: 853  PTSPAPPSPPPPSPEPPSPAPPSPPPPS 880

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 35/92 (38%), Positives = 37/92 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 1025 PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPAPPS 1083

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P   PPS   P+ P
Sbjct: 1084 PAPPSPEPPSPAPPSPRPPSPEPPSPVPPSPP 1115

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 37/92 (40%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS KP  PV PP  +PP  +PP  VPP   P    P    PP   PP   PP   
Sbjct: 814  PSPDPPSPKPPSPV-PPSPLPPSPEPPSPVPPSPPPASPEPTSPAPPSPPPPSPEPPSPA 872

Query: 325  PTLPPIPGVTP--ILPPVPVLNPPSTPTPTTP 414
            P  PP P   P    PP P L  P  P+P  P
Sbjct: 873  PPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPP 904

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 36/92 (39%), Positives = 40/92 (43%), Gaps = 3/92 (3%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPP---VTVPPVTVPPITV 309
            P P    PS +P  PV PP   PP  +PP   PP   PP+ LPP      PP  VPP   
Sbjct: 1154 PAPSPPPPSPEPPSPV-PPSPPPPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSPA 1212

Query: 310  PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            P    P  P  P      PP P    PS+P P
Sbjct: 1213 PSAPSPPSPQPPSPLAPSPPSPAPQAPSSPFP 1244

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 1010 PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPS 1068

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P   PPS P P +P
Sbjct: 1069 PAPPSPEPPSPAPPSPAPPSPEPPS-PAPPSP 1099

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/100 (36%), Positives = 42/100 (42%), Gaps = 8/100 (8%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKP--------PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV 294
            P P    PS  P  P  P        P   PP  +PP  VPP   PP   PP   PP   
Sbjct: 1130 PPPSLEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPVPPSPPPPSPEPPSPAPPSPA 1189

Query: 295  PPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP+ +PP      PP P     +PP P  + PS P+P  P
Sbjct: 1190 PPLPLPPSPHTQSPPSP-----VPPSPAPSAPSPPSPQPP 1224

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 37/99 (37%), Positives = 45/99 (45%), Gaps = 7/99 (7%)
 Frame = +1

Query: 139  PVPKKHKP-SKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P P  H P S +P  P  PP  +PP  +PP   PP   P V  PP   PP  +PP   P 
Sbjct: 1280 PSPTPHAPPSPEPPSPT-PPSPLPPSPEPPSPSPPSPAPSVPSPPSPAPPSPMPPSPAPL 1338

Query: 316  VVKPTLPPIPGVTPILPPVPV------LNPPSTPTPTTP 414
              +P  P  P   P +PP P        +PP  P+PT P
Sbjct: 1339 APQPPSPTPPSPAPPVPPSPEPPVPPGPDPPLPPSPTPP 1377

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 33/92 (35%), Positives = 37/92 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P+   P+       +PP   PP   PP   PP   PP   P V  PP   PP  +PP 
Sbjct: 1275 PAPQPPSPTPHAPPSPEPPSPTPPSPLPPSPEPPSPSPPSPAPSVPSPPSPAPPSPMPPS 1334

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P  TP  P  PV   P  P P  P
Sbjct: 1335 PAPLAPQPPSPTPPSPAPPVPPSPEPPVPPGP 1366

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 995  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 1053

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P   PPS P P +P
Sbjct: 1054 PAPPSPEPPSPAPPSPAPPSPEPPS-PAPPSP 1084

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 36/92 (39%), Positives = 39/92 (42%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P+P    PS  P  P  PP   PP   PP   PP  +PP   P    PP   PP   PP 
Sbjct: 892  PLPSPEPPSPAPPLP-PPPSPEPPSPAPPSPPPPSPEPPSPAPSPP-PPSPEPPSPAPPS 949

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P LPP P   PPS   P+ P
Sbjct: 950  PPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPP 981

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 37/96 (38%), Positives = 42/96 (43%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P +PP   PP   PP   PP   PP+  PP   PP   PP   PP 
Sbjct: 926  PEPPSPAPSPPPPSP-EPPSPAPPSPPPPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPS 984

Query: 319  VKP----TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P     LPP P   P   P P   PP +P P +P
Sbjct: 985  PEPPSPAPLPPPPSPEP-PSPAPPSPPPPSPEPPSP 1019

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/92 (36%), Positives = 37/92 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 1014 PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPS 1073

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P  P  P   P  P  P   PPS P P +P
Sbjct: 1074 PEPPSPAPPSPAPPSPEPPSPAPPS-PRPPSP 1104

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 37/98 (37%), Positives = 42/98 (42%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP----PVTVPPVTVPPIT 306
            P P    PS  P  P  PP + PP   PP   PP  +PP   P    P   PP  VPP  
Sbjct: 1115 PPPSPEPPSPAPPSP-PPPSLEPPSPAPPSPPPPSPEPPSPAPSPPPPSPEPPSPVPPSP 1173

Query: 307  VPPVVKPTLPPIPGVTP--ILPPVPVLNPPSTPTPTTP 414
             PP  +P  P  P   P   LPP P    P +P P +P
Sbjct: 1174 PPPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPVPPSP 1211

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 36/95 (37%), Positives = 42/95 (44%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPP---VTVPPITV 309
            P P    PS  P  P +PP  VPP   PP   PP   PP   PP+ +PP      PP  V
Sbjct: 1149 PEPPSPAPSPPPPSP-EPPSPVPPSPPPPSPEPPSPAPPSPAPPLPLPPSPHTQSPPSPV 1207

Query: 310  PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   P+ P  P      PP P+   P +P P  P
Sbjct: 1208 PPSPAPSAPSPPSPQ---PPSPLAPSPPSPAPQAP 1239

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 981  PPPSPEPPSPAPLPP--PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPS 1038

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P   PPS P P +P
Sbjct: 1039 PPPPSPEPPSPAPPSPAPPSPEPPS-PAPPSP 1069

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/92 (39%), Positives = 39/92 (42%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP 
Sbjct: 990  PAPLPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 1048

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  P  P   PPS P P +P
Sbjct: 1049 PAPPSPAPPSPEPPSPAPPSPAPPS-PEPPSP 1079

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 34/92 (36%), Positives = 37/92 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 999  PEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPAPPS 1058

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P  P  P   P  P  P   PPS P P +P
Sbjct: 1059 PEPPSPAPPSPAPPSPEPPSPAPPS-PAPPSP 1089

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/91 (38%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   P +  PP   PP   PP   P    PP   PP   PPV  
Sbjct: 1298 PSPLPPSPEPPSP-SPPSPAPSVPSPPSPAPPSPMPPSPAPLAPQPPSPTPPSPAPPVPP 1356

Query: 325  PTLPPIP-GVTPILPPVPVLNPPSTPTPTTP 414
               PP+P G  P LPP P    P +P P  P
Sbjct: 1357 SPEPPVPPGPDPPLPPSPT---PPSPQPPVP 1384

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 34/92 (36%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            PVP    P+        PP   PP  +PP   PP   PP   PP   PP    P   PP 
Sbjct: 841  PVPPSPPPASPEPTSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPS 900

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P LPP P   P   P P   PP +P P +P
Sbjct: 901  PAPPLPPPPSPEP-PSPAPPSPPPPSPEPPSP 931

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1022 PSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPAPPSPEPPSPAPPSPAPPSPEPPSPA 1080

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1081 PPSPAPPSPEPPSPAPPSPRPPS-PEPPSP 1109

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 38/96 (39%), Positives = 41/96 (42%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT------ 306
            P    PS  P  P  PP   PP  KPP  VPP   PP   PP  VPP + PP +      
Sbjct: 799  PSAAPPSPMPPSPA-PPSPDPPSPKPPSPVPPSPLPPSPEPPSPVPP-SPPPASPEPTSP 856

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP   P  P  P   P  PP P   PPS   P+ P
Sbjct: 857  APPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 892

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/92 (38%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    PS  P  P  PP   PP   PP    P  +PP   PP+  PP   PP   PP 
Sbjct: 862  PPPSPEPPSPAPPSP-PPPSPEPPSPAPPSPPLPSPEPPSPAPPLPPPPSPEPPSPAPPS 920

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS   P+ P
Sbjct: 921  PPPPSPEPPSPAP-SPPPPSPEPPSPAPPSPP 951

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 1007 PSPPPPSPEPPSPA-PPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPAPPSPEPPSPA 1065

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P   PPS P P +P
Sbjct: 1066 PPSPAPPSPEPPSPAPPSPAPPS-PEPPSP 1094

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/97 (36%), Positives = 43/97 (44%), Gaps = 7/97 (7%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVP---PIVKPPVILPPVTVPPVTVPPITVPP 315
            P    PS  P  P  PP   PP  +PP   P   P  +PP   PP  +PP   PP   PP
Sbjct: 1255 PPPFPPSPAPPSPT-PPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPLPPSPEPPSPSPP 1313

Query: 316  VVKPTLPPIPGVTPILP----PVPVLNPPSTPTPTTP 414
               P++P  P   P  P    P P+   P +PTP +P
Sbjct: 1314 SPAPSVPSPPSPAPPSPMPPSPAPLAPQPPSPTPPSP 1350

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 37/93 (39%), Positives = 40/93 (43%), Gaps = 3/93 (3%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV-- 318
            P    PS  P  P  PP   PP   PP   P   +PP   PP   PPV  PP   PPV  
Sbjct: 1308 PSPSPPSPAPSVP-SPPSPAPPSPMPPSPAPLAPQPPSPTPPSPAPPV--PPSPEPPVPP 1364

Query: 319  -VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P LPP P      PPVP    P +P P +P
Sbjct: 1365 GPDPPLPPSPTPPSPQPPVPPSPTPPSPQPPSP 1397

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 39/102 (38%), Positives = 46/102 (45%), Gaps = 10/102 (9%)
 Frame = +1

Query: 139  PVPKKHKPSKKPG-KPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P P    P   P  +P  PPG  PP+  PP   PP  +PPV  PP   PP   PP   PP
Sbjct: 1345 PTPPSPAPPVPPSPEPPVPPGPDPPL--PPSPTPPSPQPPV--PPSPTPPSPQPPSPAPP 1400

Query: 316  VVKPTLP--PIPGVTPILPPVPV-------LNPPSTPTPTTP 414
               P+ P  P P      PP P         +PPSTP+P +P
Sbjct: 1401 SPAPSAPLQPSPDPPSPQPPSPAPGPPPSPPSPPSTPSPPSP 1442

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 37/94 (39%), Positives = 39/94 (41%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP--PVILPPVTVPPVTVPPITVP 312
            P P    PS  P  P  PP   PP   PP   PP  +P  P  LPP   PP   PP   P
Sbjct: 951  PPPSPEPPSPAPPLP-PPPSPEPPSPAPPSPPPPSPEPPSPAPLPP---PPSPEPPSPAP 1006

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  P  P   P  PP P   PPS   P+ P
Sbjct: 1007 PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPP 1040

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 33/92 (35%), Positives = 38/92 (41%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P   +P+        PP   PP   PP   PP  +PP   PP    P   PP   PP+
Sbjct: 846  PPPASPEPTSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPL 905

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P  PP P   PPS P P+ P
Sbjct: 906  PPPPSPEPPSPAPPSPPPPSPEPPS-PAPSPP 936

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/94 (37%), Positives = 39/94 (41%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P  PP    P  +PP   PP+  PP   PP   PP   PP   PP   
Sbjct: 874  PSPPPPSPEPPSPA-PPSPPLPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPA 932

Query: 325  PTLPP----IPGVTPILPPVPVLNPPSTPTPTTP 414
            P+ PP     P   P  PP P   PPS   P  P
Sbjct: 933  PSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPLPP 966

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 36/94 (38%), Positives = 40/94 (42%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVP----PIVKPPVILPPVTVPPVTVPPITVP 312
            P    PS +P  P  PP   PP  +PP   P    P  +PP   PP   PP   PP   P
Sbjct: 904  PLPPPPSPEPPSPA-PPSPPPPSPEPPSPAPSPPPPSPEPPSPAPPSPPPPSPEPPSPAP 962

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P+  P  P  P   P  PP P   PPS P P  P
Sbjct: 963  PLPPPPSPEPPSPAPPSPPPPSPEPPS-PAPLPP 995

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/90 (38%), Positives = 40/90 (44%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP  +PP   PP   PP   PP   PP   PP   PP ++
Sbjct: 1077 PSPAPPSPAPPSP-EPPSPAPPSPRPPSPEPPSPVPPSPPPPSPEPPSPAPPSPPPPSLE 1135

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P     P   P  PP P   PPS P P+ P
Sbjct: 1136 P-----PSPAPPSPPPPSPEPPS-PAPSPP 1159

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 31/92 (33%), Positives = 35/92 (38%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P     +P  P    PP  +PP   PP   PP   PP   PP   P +  PP 
Sbjct: 1265 PSPTPPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPLPPSPEPPSPSPPSPAPSVPSPPS 1324

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  P  P   P+ P  P   PPS   P  P
Sbjct: 1325 PAPPSPMPPSPAPLAPQPPSPTPPSPAPPVPP 1356

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/100 (37%), Positives = 38/100 (38%), Gaps = 10/100 (10%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPP----------VILPPVTVPPVTV 294
            P    PS  P  P KPP  VPP   PP   PP   PP             PP   PP   
Sbjct: 809  PSPAPPSPDPPSP-KPPSPVPPSPLPPSPEPPSPVPPSPPPASPEPTSPAPPSPPPPSPE 867

Query: 295  PPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   PP   P  P  P   P  PP+P   PPS   P  P
Sbjct: 868  PPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPLPP 907

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 36/94 (38%), Positives = 40/94 (42%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVP----PIVKPPVILPPVTVPPVTVPPITVP 312
            P    PS +P  P  PP   PP  +PP   P    P  +PP   PP   PP   PP   P
Sbjct: 963  PLPPPPSPEPPSPA-PPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAP 1021

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  P  P   P  PP P   PPS P P +P
Sbjct: 1022 PSPPPPSPEPPSPAPPSPPPPSPEPPS-PAPPSP 1054

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 35/90 (38%), Positives = 38/90 (42%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS +P  P   P   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 978  PSPPPPSPEPPSPAPLPP--PPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPA 1035

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  PP P   P  P  P   PPS P P +P
Sbjct: 1036 PPSPPPPSPEPPSPAPPSPAPPS-PEPPSP 1064

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 35/93 (37%), Positives = 40/93 (43%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           +P P K  P  KP  P +P    PP   PP  +PP   PP  LPP   PP   PP   PP
Sbjct: 722 RPPPPKSPPPPKPSPPPRPS---PPPRPPPRPLPPSPPPPPPLPPN--PPSPAPPSPPPP 776

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                 PP PG     PP P     + P+P  P
Sbjct: 777 PSPSIPPPSPGPPSPEPPSPAPPSAAPPSPMPP 809

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 34/93 (36%), Positives = 38/93 (40%), Gaps = 3/93 (3%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP---PVTVPPITVPP 315
            P    P  +P  P  PP   PP   PP   PP  +PP   PP   P   P   PP   PP
Sbjct: 1239 PSSPFPPPQPTAPTAPPPPFPPSPAPPSPTPPSPEPPAPQPPSPTPHAPPSPEPPSPTPP 1298

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                 LPP P      PP P  + PS P+P  P
Sbjct: 1299 ---SPLPPSPEPPSPSPPSPAPSVPSPPSPAPP 1328

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 35/92 (38%), Positives = 40/92 (43%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPV--KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P    PS +P  PV   PP   P   +P    PP   PP   PP   PP   PP   PP 
Sbjct: 829  PSPLPPSPEPPSPVPPSPPPASP---EPTSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPS 885

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP+P   P   P P L PP +P P +P
Sbjct: 886  PAPPSPPLPSPEP-PSPAPPLPPPPSPEPPSP 916

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 35/95 (36%), Positives = 42/95 (44%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPP---VILPPVTVPPVTVPPITV 309
            P P+   P+  P  P  PP   PP   PP   PP  +PP      PP   PP   PP  +
Sbjct: 1244 PPPQPTAPTAPP--PPFPPSPAPPSPTPPSPEPPAPQPPSPTPHAPPSPEPPSPTPPSPL 1301

Query: 310  PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP  +P  P  P   P +P  P   PPS P P +P
Sbjct: 1302 PPSPEPPSPSPPSPAPSVPSPPSPAPPS-PMPPSP 1335

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 34/96 (35%), Positives = 38/96 (39%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPP----IVKPPVILPPVTVPPVTVPPIT 306
            P P    P   P    +PP   PP   PP   PP    +  PP   PP   PP   PP  
Sbjct: 955  PEPPSPAPPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSP 1014

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP   P  PP P   P   P P   PP +P P +P
Sbjct: 1015 EPPSPAPPSPPPPSPEPP-SPAPPSPPPPSPEPPSP 1049

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 35/97 (36%), Positives = 41/97 (42%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIV--KPPGIVPPIVKPPV---ILPPVTVPPVTVPPI 303
            P P+   P + P +P+ P    PP +   PP   PP   PP    I PP   PP   PP 
Sbjct: 736  PPPRPSPPPRPPPRPLPPSPPPPPPLPPNPPSPAPPSPPPPPSPSIPPPSPGPPSPEPPS 795

Query: 304  TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              PP   P  P  P   P  P  P   PPS P P +P
Sbjct: 796  PAPPSAAPPSPMPPSPAPPSPDPPSPKPPS-PVPPSP 831

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 39/90 (43%), Positives = 45/90 (50%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    PS  P  P +PP   PP   PP  VPP  +PPV  PP   PP  +PP   PP  +
Sbjct: 1328 PSPMPPSPAPLAP-QPPSPTPPSPAPP--VPPSPEPPV--PPGPDPP--LPPSPTPPSPQ 1380

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P +PP P  TP  P  P   PPS P P+ P
Sbjct: 1381 PPVPPSP--TPPSPQPPSPAPPS-PAPSAP 1407

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 40/93 (43%), Positives = 45/93 (48%), Gaps = 6/93 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGK-----PVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT-VPPVTVPPIT 306
           P+   P   PGK     P +PP    P   PP  +PP   PP  LPPVT  PP   PP  
Sbjct: 672 PRPPLPPTWPGKWEGAWPFRPPIPPRPPRPPPPPLPP--SPP--LPPVTPSPPPRPPPPK 727

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            PP  KP+ PP P   P  PP P+  PPS P P
Sbjct: 728 SPPPPKPSPPPRPSPPPRPPPRPL--PPSPPPP 758

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 34/101 (33%), Positives = 38/101 (37%), Gaps = 9/101 (8%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV-------- 294
            P P    P   P    +PP   PP   PP + PP   PP   PP   PP           
Sbjct: 1104 PEPPSPVPPSPPPPSPEPPSPAPPSPPPPSLEPPSPAPPSPPPPSPEPPSPAPSPPPPSP 1163

Query: 295  -PPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP  VPP   P  P  P   P  P  P+  PPS  T + P
Sbjct: 1164 EPPSPVPPSPPPPSPEPPSPAPPSPAPPLPLPPSPHTQSPP 1204

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 35/93 (37%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIV-KPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           P+P +  P + P  P+ P   +PP+   PP   PP   PP   P  + PP   PP   PP
Sbjct: 693 PIPPR--PPRPPPPPLPPSPPLPPVTPSPPPRPPPPKSPPP--PKPSPPPRPSPPPRPPP 748

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P   P  PP P   PPS P P +P
Sbjct: 749 RPLPPSPPPPPPLPPNPPSPA--PPSPPPPPSP 779

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 32/90 (35%), Positives = 36/90 (40%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P    P   P    +PP   PP    P   PP   PP+  PP   PP   PP   PP 
Sbjct: 866  PEPPSPAPPSPPPPSPEPPSPAPPSPPLPSPEPPSPAPPLPPPPSPEPPSPAPPSPPPPS 925

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             +P   P P   P  P  P   PPS P P+
Sbjct: 926  PEPP-SPAPSPPPPSPEPPSPAPPSPPPPS 954

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 38/115 (33%), Positives = 45/115 (39%), Gaps = 23/115 (20%)
 Frame = +1

Query: 139  PVPKKHKPSKKPG--------------KPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT 276
            PVP   +P   PG              +P  PP   PP  +PP   PP   P   L P  
Sbjct: 1353 PVPPSPEPPVPPGPDPPLPPSPTPPSPQPPVPPSPTPPSPQPPSPAPPSPAPSAPLQPSP 1412

Query: 277  VPPVTVPPITVP-----PVVKPTLPPIPGVTPI--LPPVPVL--NPPSTPTPTTP 414
             PP   PP   P     P   P+ P  P   P+   PPVP +   PPS P P+ P
Sbjct: 1413 DPPSPQPPSPAPGPPPSPPSPPSTPSPPSPAPLAPAPPVPPMAPQPPSPPLPSPP 1467

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 35/90 (38%), Positives = 42/90 (46%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P+   P+     P  PP   PP+  PPG  PP+  PP   PP   PP  VPP   PP  +
Sbjct: 1340 PQPPSPTPPSPAPPVPPSPEPPV--PPGPDPPL--PPSPTPPSPQPP--VPPSPTPPSPQ 1393

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  P  P   P  P  P  +PPS P P +P
Sbjct: 1394 PPSPAPPSPAPSAPLQPSPDPPS-PQPPSP 1422

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 36/94 (38%), Positives = 42/94 (44%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP---PVILPPVTVPPVTVPPITVPP 315
           P+   P   P  P+ P    PP   PP   PP  KP   P   PP   PP  +PP   PP
Sbjct: 699 PRPPPPPLPPSPPLPPVTPSPPPRPPPPKSPPPPKPSPPPRPSPPPRPPPRPLPPSPPPP 758

Query: 316 VVKPTLPPIPGV-TPILPPVPVLNPPSTPTPTTP 414
              P  PP P   +P  PP P + PPS P P +P
Sbjct: 759 PPLPPNPPSPAPPSPPPPPSPSIPPPS-PGPPSP 791

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 32/85 (37%), Positives = 36/85 (42%)
 Frame = +1

Query: 160  PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
            PS +P  P+ P    P    P    PP        PP   PP   PP   PP  +P  P 
Sbjct: 1219 PSPQPPSPLAPSPPSPAPQAPSSPFPPPQPTAPTAPPPPFPPSPAPPSPTPPSPEPPAPQ 1278

Query: 340  IPGVTPILPPVPVLNPPSTPTPTTP 414
             P  TP  PP P   PPS PTP +P
Sbjct: 1279 PPSPTPHAPPSP--EPPS-PTPPSP 1300

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 34/98 (34%), Positives = 38/98 (38%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPP---IVKPPGIVPPIVKPPVILPPVTVPPVTV---PP 300
            P P    PS  P  P  PP  +PP      PP  VPP   P    PP   PP  +   PP
Sbjct: 1174 PPPSPEPPSPAPPSPA-PPLPLPPSPHTQSPPSPVPPSPAPSAPSPPSPQPPSPLAPSPP 1232

Query: 301  ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
               P       PP     P  PP P    P+ P+PT P
Sbjct: 1233 SPAPQAPSSPFPPPQPTAPTAPPPPFPPSPAPPSPTPP 1270

[150][TOP]
>UniRef100_O42854 SH3 domain-containing protein C23A1.17 n=1 Tax=Schizosaccharomyces
            pombe RepID=YFHH_SCHPO
          Length = 1611

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 44/112 (39%), Positives = 54/112 (48%), Gaps = 7/112 (6%)
 Frame = +1

Query: 97   SSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP----PVIL 264
            S A P+        PVP    PS  P  P KP    PP+  P   +PP+ KP    P + 
Sbjct: 1137 SGAPPVPKPSVAAPPVPA---PSGAPPVP-KPSVAAPPVPAPSSGIPPVPKPAAGVPPVP 1192

Query: 265  PPVTVPPVTVPPITVPPVVKP-TLPPIPGVTPILPPVPV--LNPPSTPTPTT 411
            PP   PPV  P + VPPV  P T PP+P  +  LPPVPV     P  P P++
Sbjct: 1193 PPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSS 1244

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 46/112 (41%), Positives = 54/112 (48%), Gaps = 8/112 (7%)
 Frame = +1

Query: 97   SSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT 276
            S A P+        PVP    PS  P  PV  P +  P V  P   PP+ KP V  PPV 
Sbjct: 1118 SGAPPVPKPSVAAPPVPV---PSGAP--PVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVP 1172

Query: 277  -----VPPVTVPPITVPPVVKPT-LPPIPGVTPILPPVPVLNPPST--PTPT 408
                 +PPV  P   VPPV  P+  PP+P  +  +PPVP   PPST  P PT
Sbjct: 1173 APSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVP---PPSTAPPVPT 1221

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 47/111 (42%), Positives = 54/111 (48%), Gaps = 8/111 (7%)
 Frame = +1

Query: 97   SSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT 276
            S AAP +   +   PVPK   PS        P   +PP+ KP   VPP V PP   PPV 
Sbjct: 1146 SVAAPPVPAPSGAPPVPK---PSVAAPPVPAPSSGIPPVPKPAAGVPP-VPPPSEAPPVP 1201

Query: 277  VPPVTVPPI----TVPPVVKPT--LPPIPGVTPILPPVPV--LNPPSTPTP 405
             P V VPP+    T PPV  P+  LPP+P  T   PPVP      PS  TP
Sbjct: 1202 KPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTP 1252

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 48/121 (39%), Positives = 56/121 (46%), Gaps = 16/121 (13%)
 Frame = +1

Query: 100  SAAPILGCGTCGKPVPKKHK--PSKKPGKP--------VKPPGIVPPIVKPPGIVPPIVK 249
            S AP +   T   PVPK     PS  P  P        +  P   PP+  P GI PP+ K
Sbjct: 1038 STAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGI-PPVPK 1096

Query: 250  PPVILPPVTVPPVTVPPIT----VPPVVKPTL--PPIPGVTPILPPVPVLNPPSTPTPTT 411
            P V  PPV  P V VPP+      PPV KP++  PP+P V    PPVP    PS   P  
Sbjct: 1097 PSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVP-VPSGAPPVP---KPSVAAPPV 1152

Query: 412  P 414
            P
Sbjct: 1153 P 1153

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/108 (37%), Positives = 50/108 (46%), Gaps = 19/108 (17%)
 Frame = +1

Query: 139  PVPKKHKPSKKPG---KPVKPPGIVPPIVKPPGI-----------VPPIVKP----PVIL 264
            PVP    P  KP     PV  P   PP+ KP  +           +PP+ KP    P + 
Sbjct: 1134 PVPSGAPPVPKPSVAAPPVPAPSGAPPVPKP-SVAAPPVPAPSSGIPPVPKPAAGVPPVP 1192

Query: 265  PPVTVPPVTVPPITVPPVVKP-TLPPIPGVTPILPPVPVLNPPSTPTP 405
            PP   PPV  P + VPPV  P T PP+P  +  LPPVPV    + P P
Sbjct: 1193 PPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVP 1240

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 33/89 (37%), Positives = 43/89 (48%)
 Frame = +1

Query: 142  VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
            +P    PS  P  PV  P  +PP+ KP    PP+ KP V +PPV  P    PP+  P V 
Sbjct: 1073 IPSIPAPSGAP--PVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPS-GAPPVPKPSVA 1129

Query: 322  KPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             P +P   G  P+  P P +  P  P P+
Sbjct: 1130 APPVPVPSGAPPV--PKPSVAAPPVPAPS 1156

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 44/120 (36%), Positives = 55/120 (45%), Gaps = 17/120 (14%)
 Frame = +1

Query: 100  SAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV 279
            S AP +   +   PVPK   PS       KP   VPP+  P G  PP+ KP V  PPV V
Sbjct: 1080 SGAPPVPAPSGIPPVPK---PSVAAPPVPKPSVAVPPVPAPSG-APPVPKPSVAAPPVPV 1135

Query: 280  PP---------VTVPPIT----VPPVVKPTL--PPIPGVTPILPPV--PVLNPPSTPTPT 408
            P          V  PP+      PPV KP++  PP+P  +  +PPV  P    P  P P+
Sbjct: 1136 PSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPS 1195

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 44/114 (38%), Positives = 55/114 (48%), Gaps = 9/114 (7%)
 Frame = +1

Query: 97   SSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP----PVIL 264
            SS  P +   +   PVP    PS  P  P KP    PP+ KP   VPP+  P    PV  
Sbjct: 1070 SSEIPSIPAPSGAPPVPA---PSGIPPVP-KPSVAAPPVPKPSVAVPPVPAPSGAPPVPK 1125

Query: 265  PPVTVPPVTVPPITVPPVVKPTL--PPIP---GVTPILPPVPVLNPPSTPTPTT 411
            P V  PPV VP    PPV KP++  PP+P   G  P+  P P +  P  P P++
Sbjct: 1126 PSVAAPPVPVPS-GAPPVPKPSVAAPPVPAPSGAPPV--PKPSVAAPPVPAPSS 1176

[151][TOP]
>UniRef100_O41160 A678R protein n=1 Tax=Paramecium bursaria Chlorella virus 1
           RepID=O41160_PBCV1
          Length = 385

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 39/96 (40%), Positives = 40/96 (41%)
 Frame = +1

Query: 124 GTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPI 303
           G CG      H P      P KPP   PP  KPP   PP  KPP   PP T PP T PP 
Sbjct: 45  GECGNLTDYGHAPLP----PTKPPSTKPPSTKPPSTKPPSTKPPSTKPPSTKPPSTKPPS 100

Query: 304 TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
           T PP  KP               P   PPST  PT+
Sbjct: 101 TKPPSTKP---------------PSTKPPSTKPPTS 121

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 36/86 (41%), Positives = 38/86 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS KP    KPP   PP  KPP   PP  KPP   PP T PP +   I V P   
Sbjct: 74  PSTKPPSTKPPS-TKPPSTKPPSTKPPSTKPPSTKPPSTKPPSTKPPTSSRSIQVNPQGV 132

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPT 402
             L   P V P LP   +  PPS  T
Sbjct: 133 GDL-KYPKVLPSLPATAI--PPSGST 155

[152][TOP]
>UniRef100_B4WHY0 Putative uncharacterized protein n=1 Tax=Synechococcus sp. PCC 7335
           RepID=B4WHY0_9SYNE
          Length = 762

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 43/93 (46%), Positives = 50/93 (53%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTV-PPITVPP 315
           PVP +  P  +P  PV+PP  V P V+PP  V P V+PPV  P    PPV V PP+ V P
Sbjct: 628 PVPVE--PPVEPPAPVEPPVPVEPPVEPPVPVEPPVEPPVEPPVPVEPPVPVEPPVPVEP 685

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P   P+ PPVPV  P   P P  P
Sbjct: 686 ---PVEPPGPVEPPVEPPVPVELPVEPPGPVEP 715

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 37/91 (40%), Positives = 48/91 (52%), Gaps = 4/91 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIV-PPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P   +P  +P  PV+PP  V P V+PP  V PP+   P + PPV V P   PP+  P  V
Sbjct: 612 PTPVEPPVEPPAPVEPPVPVEPPVEPPAPVEPPVPVEPPVEPPVPVEPPVEPPVEPPVPV 671

Query: 322 KPTL---PPIPGVTPILPPVPVLNPPSTPTP 405
           +P +   PP+P   P+ PP PV  P   P P
Sbjct: 672 EPPVPVEPPVPVEPPVEPPGPVEPPVEPPVP 702

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 42/112 (37%), Positives = 58/112 (51%), Gaps = 10/112 (8%)
 Frame = +1

Query: 109 PILGCGTCGKPVPKKHKPSKKPGKPVKPP-GIVPPI-VKPPGIVPPIVKPPV-------I 261
           P++  G   +P P   +P  +P  P++PP  I PP+ ++PP  V P V+PP        +
Sbjct: 573 PVMDPGVPVEP-PVPVEPPVEPPAPIEPPVPIEPPVPIEPPTPVEPPVEPPAPVEPPVPV 631

Query: 262 LPPVTVPPVTVPPITVPPVVKPTLPPIPGV-TPILPPVPVLNPPSTPTPTTP 414
            PPV  P    PP+ V P V+P +P  P V  P+ PPVPV  PP    P  P
Sbjct: 632 EPPVEPPAPVEPPVPVEPPVEPPVPVEPPVEPPVEPPVPV-EPPVPVEPPVP 682

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 39/89 (43%), Positives = 48/89 (53%), Gaps = 2/89 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPV-ILPPVTVPPVTVPPITVPP 315
           PVP +     +P  PV+PP      V+PPG V P V+PPV +  PV  P    PP  V P
Sbjct: 668 PVPVEPPVPVEPPVPVEPP------VEPPGPVEPPVEPPVPVELPVEPPGPVEPPTPVEP 721

Query: 316 VVKPTLPPIPGVTPILPPVPVLNP-PSTP 399
            V+P   P+   TP+ PPVPV  P PS P
Sbjct: 722 PVEPP-GPVEPPTPVEPPVPVEPPVPSGP 749

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 36/82 (43%), Positives = 45/82 (54%)
 Frame = +1

Query: 169 KPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPG 348
           +P  PV+PP  V P V+PPG V P V+PPV   PV +P     P+  P  V+P + P PG
Sbjct: 672 EPPVPVEPPVPVEPPVEPPGPVEPPVEPPV---PVELPVEPPGPVEPPTPVEPPVEP-PG 727

Query: 349 VTPILPPVPVLNPPSTPTPTTP 414
             P+ PP PV  PP    P  P
Sbjct: 728 --PVEPPTPV-EPPVPVEPPVP 746

[153][TOP]
>UniRef100_A8NQG1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130
           RepID=A8NQG1_COPC7
          Length = 418

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 39/93 (41%), Positives = 48/93 (51%), Gaps = 3/93 (3%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP  +  KP  +P KP KPP + PP+   P + PP  KPPV+ P    PPV  P    PP
Sbjct: 117 KPPVEPPKPPVEPPKPPKPP-VEPPVPPKPPVEPP--KPPVVPPFPPKPPVEPPAPPKPP 173

Query: 316 V---VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           V     P +PP P   P+ PP P + PP  P P
Sbjct: 174 VEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKP 206

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 39/98 (39%), Positives = 51/98 (52%), Gaps = 7/98 (7%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVP----PIVKPPG--IVPPIVKPPVILPPVTV-PPVTV 294
           KP  +   P K P +P KPP + P    P V+PP   +VPP    P + PPV   PPV  
Sbjct: 205 KPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPVPPKPPVEP 264

Query: 295 PPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           P  T  P   P +PP+P    ++PP P + PP+ P PT
Sbjct: 265 PKPTAVPPKPPVVPPLPPKPTVVPPKPPVVPPAPPKPT 302

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 42/103 (40%), Positives = 51/103 (49%), Gaps = 13/103 (12%)
 Frame = +1

Query: 139 PVPKKH--KPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP-----------PVTV 279
           PVP K   +P K    P KPP +VPP+   P +VPP  KPPV+ P           P  V
Sbjct: 255 PVPPKPPVEPPKPTAVPPKPP-VVPPLPPKPTVVPP--KPPVVPPAPPKPTDVPPKPPVV 311

Query: 280 PPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           PP    P  VPP   P +PP P    + PP P + PP+ P PT
Sbjct: 312 PPAPPKPTVVPPK-PPVVPPAPPKPTVAPPKPPVVPPAPPKPT 353

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 44/105 (41%), Positives = 53/105 (50%), Gaps = 12/105 (11%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKP------PGIVPPIVKPPGIVPPIVKPPVILP----PVTVPP 285
           KP  +   P K P +P KP      P +VPP+   P +VPP  KPPV+ P    P  VPP
Sbjct: 249 KPPVEPPVPPKPPVEPPKPTAVPPKPPVVPPLPPKPTVVPP--KPPVVPPAPPKPTDVPP 306

Query: 286 VTVPPITVPPVVKPT-LPPIPGVTPILPPVPVLNPPSTP-TPTTP 414
              PP+  P   KPT +PP P V P  PP P + PP  P  P  P
Sbjct: 307 --KPPVVPPAPPKPTVVPPKPPVVPPAPPKPTVAPPKPPVVPPAP 349

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 43/101 (42%), Positives = 49/101 (48%), Gaps = 11/101 (10%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKP------PGIVPPIVKPPGIVPPIVKPPVILP----PVTVPP 285
           KP     KP   P  P KP      P +VPP    P + PP  KPPV+ P    P  VPP
Sbjct: 300 KPTDVPPKPPVVPPAPPKPTVVPPKPPVVPPAPPKPTVAPP--KPPVVPPAPPKPTVVPP 357

Query: 286 VTVPPITVPPVVKPTL-PPIPGVTPILPPVPVLNPPSTPTP 405
              PP+  P   KPT+ PP P V P  PP P + PPS P P
Sbjct: 358 --KPPVVPPAPPKPTVAPPKPPVVPPAPPKPTVVPPSPPKP 396

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 39/93 (41%), Positives = 47/93 (50%), Gaps = 3/93 (3%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           KP  +   P K P +P KPP +VPP    P + PP  KPPV+ P    PPV  P    PP
Sbjct: 161 KPPVEPPAPPKPPVEPPKPP-VVPPFPPKPPVEPP--KPPVVPPFPPKPPVEPPAPPKPP 217

Query: 316 V---VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           V     P +PP P   P+ PP P + PP  P P
Sbjct: 218 VEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKP 250

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 41/108 (37%), Positives = 48/108 (44%), Gaps = 17/108 (15%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKP------PGIVPPIVKPPGIVPPIVKPPVILP---------- 267
           KP     KP   P  P KP      P +VPP    P +VPP  KPPV+ P          
Sbjct: 283 KPTVVPPKPPVVPPAPPKPTDVPPKPPVVPPAPPKPTVVPP--KPPVVPPAPPKPTVAPP 340

Query: 268 -PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            P  VPP    P  VPP   P +PP P    + PP P + PP+ P PT
Sbjct: 341 KPPVVPPAPPKPTVVPPK-PPVVPPAPPKPTVAPPKPPVVPPAPPKPT 387

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 40/91 (43%), Positives = 49/91 (53%), Gaps = 8/91 (8%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPI-VKPPVILP-PVTVP--PVTVPPI----TVPP 315
           P K P +P KPP +VPP    P + PP+  KPPV  P P  VP  P  VPP+    TV P
Sbjct: 230 PPKPPVEPPKPP-VVPPFPPKPPVEPPVPPKPPVEPPKPTAVPPKPPVVPPLPPKPTVVP 288

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
              P +PP P     +PP P + PP+ P PT
Sbjct: 289 PKPPVVPPAPPKPTDVPPKPPVVPPAPPKPT 319

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 40/92 (43%), Positives = 46/92 (50%), Gaps = 4/92 (4%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPI-VKPPV--ILPPVTVPPVTVPPIT 306
           KP  +   P K P +P KPP +VPP    P + PP   KPPV    PPV  P    PP+ 
Sbjct: 134 KPPVEPPVPPKPPVEPPKPP-VVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVE 192

Query: 307 VP-PVVKPTLPPIPGVTPILPPVPVLNPPSTP 399
            P P V P  PP P V P  PP P + PP  P
Sbjct: 193 PPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPP 224

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 36/94 (38%), Positives = 48/94 (51%), Gaps = 6/94 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPP----IVKPPGIVPPIVKPPVILP--PVTVPPVTVPPIT 306
           P   KP  +P  P KPP + PP    +   P +VPP+   P ++P  P  VPP    P  
Sbjct: 245 PFPPKPPVEPPVPPKPP-VEPPKPTAVPPKPPVVPPLPPKPTVVPPKPPVVPPAPPKPTD 303

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           VPP   P +PP P    ++PP P + PP+ P PT
Sbjct: 304 VPP-KPPVVPPAPPKPTVVPPKPPVVPPAPPKPT 336

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 43/107 (40%), Positives = 50/107 (46%), Gaps = 16/107 (14%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKP------PGIVPPIVKPPGIVPPIVKPPVILP----PVTVP- 282
           KP     KP   P  P KP      P +VPP    P  VPP  KPPV+ P    P  VP 
Sbjct: 266 KPTAVPPKPPVVPPLPPKPTVVPPKPPVVPPAPPKPTDVPP--KPPVVPPAPPKPTVVPP 323

Query: 283 -PVTVPPI----TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            P  VPP     TV P   P +PP P    ++PP P + PP+ P PT
Sbjct: 324 KPPVVPPAPPKPTVAPPKPPVVPPAPPKPTVVPPKPPVVPPAPPKPT 370

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 42/101 (41%), Positives = 50/101 (49%), Gaps = 10/101 (9%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI-----LPPVTVP-PVTVP 297
           KP  +  KP   P  P KPP + PP    P + PP  KPPV+      PPV  P P  VP
Sbjct: 188 KPPVEPPKPPVVPPFPPKPP-VEPPAPPKPPVEPP--KPPVVPPFPPKPPVEPPKPPVVP 244

Query: 298 PITVPPVVKPTLPPIPGVTP----ILPPVPVLNPPSTPTPT 408
           P    P V+P +PP P V P     +PP P + PP  P PT
Sbjct: 245 PFPPKPPVEPPVPPKPPVEPPKPTAVPPKPPVVPPLPPKPT 285

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 42/102 (41%), Positives = 46/102 (45%), Gaps = 12/102 (11%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKP------PGIVPPIVKPPGIVPPIVKPPVILP----PVTVPP 285
           KP     KP   P  P KP      P +VPP    P +VPP  KPPV+ P    P   PP
Sbjct: 317 KPTVVPPKPPVVPPAPPKPTVAPPKPPVVPPAPPKPTVVPP--KPPVVPPAPPKPTVAPP 374

Query: 286 V--TVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
               VPP    P V P  PP P V P  PP P + PP  P P
Sbjct: 375 KPPVVPPAPPKPTVVPPSPPKPPVVPPFPPKPTVVPPK-PKP 415

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 38/85 (44%), Positives = 43/85 (50%), Gaps = 2/85 (2%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIV-KPPVILP-PVTVPPVTVPPITVPPVVKPTL 333
           P K P +P KPP +VPP    P + PP   KPPV  P P  VPP    P   PP   P +
Sbjct: 186 PPKPPVEPPKPP-VVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPK-PPVV 243

Query: 334 PPIPGVTPILPPVPVLNPPSTPTPT 408
           PP P   P+ PPVP   P   P PT
Sbjct: 244 PPFPPKPPVEPPVPPKPPVEPPKPT 268

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 39/92 (42%), Positives = 46/92 (50%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVP----PIVKPPVILPPVTVPPVTVPPITVP 312
           PK  KP  +P  P KPP + PP  KPP + P    P V+PP    P   PP   PP+  P
Sbjct: 130 PKPPKPPVEPPVPPKPP-VEPP--KPPVVPPFPPKPPVEPPAPPKPPVEPP--KPPVVPP 184

Query: 313 -PVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            P   P  PP P V P  PP P + PP+ P P
Sbjct: 185 FPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKP 216

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 39/86 (45%), Positives = 46/86 (53%), Gaps = 3/86 (3%)
 Frame = +1

Query: 157 KPSKKPGKPVKPPGIVP-PIVKPPGIVPPIVKPPVI-LPPVTVP-PVTVPPITVPPVVKP 327
           +P K P +P KPP   P P V+PP    P V+PPV   PPV  P P  VPP    P V+P
Sbjct: 107 EPPKPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPPVEPPKPPVVPPFPPKPPVEP 166

Query: 328 TLPPIPGVTPILPPVPVLNPPSTPTP 405
             PP P   P+ PP P + PP  P P
Sbjct: 167 PAPPKP---PVEPPKPPVVPPFPPKP 189

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 37/88 (42%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKP-PGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PV     P + P  PV+PP   PP+  P P + PP    P + PPV   P   PP   PP
Sbjct: 98  PVEPPKPPVEPPKPPVEPP--KPPVEPPKPPVEPPKPPKPPVEPPVPPKPPVEPP--KPP 153

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTP 399
           VV P  PP P V P  PP P + PP  P
Sbjct: 154 VV-PPFPPKPPVEPPAPPKPPVEPPKPP 180

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 40/91 (43%), Positives = 49/91 (53%), Gaps = 3/91 (3%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKP-VKPPGIVPPIVKP-PGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           KP  +  KP+  P KP V+PP   PP+  P P + PP  KPPV  P   V P   PP+  
Sbjct: 68  KPTVEPPKPTVAPPKPPVEPPK--PPVEPPKPPVEPP--KPPVEPPKPPVEPPK-PPVEP 122

Query: 310 P-PVVKPTLPPIPGVTPILPPVPVLNPPSTP 399
           P P V+P  PP P V P +PP P + PP  P
Sbjct: 123 PKPPVEPPKPPKPPVEPPVPPKPPVEPPKPP 153

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 38/90 (42%), Positives = 47/90 (52%), Gaps = 1/90 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKP-PGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PV     P + P  PV+PP   PP+  P P + PP  KPPV  P    PPV  PP+   P
Sbjct: 91  PVEPPKPPVEPPKPPVEPPK--PPVEPPKPPVEPP--KPPVEPPKPPKPPVE-PPVPPKP 145

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            V+P  PP+  V P  PP P + PP+ P P
Sbjct: 146 PVEPPKPPV--VPPF-PPKPPVEPPAPPKP 172

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 39/93 (41%), Positives = 48/93 (51%), Gaps = 3/93 (3%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKP-VKPPGIVPPIVKP-PGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           KP     KP  +P KP V+PP   PP+  P P + PP  KPPV  P   V P   PP+  
Sbjct: 75  KPTVAPPKPPVEPPKPPVEPPK--PPVEPPKPPVEPP--KPPVEPPKPPVEPPK-PPVEP 129

Query: 310 PPVVKPTL-PPIPGVTPILPPVPVLNPPSTPTP 405
           P   KP + PP+P   P+ PP P + PP  P P
Sbjct: 130 PKPPKPPVEPPVPPKPPVEPPKPPVVPPFPPKP 162

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 36/93 (38%), Positives = 42/93 (45%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKP-PGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PV     P + P  PV+PP   PP+  P P + PP  KPPV  P   V P   P   V P
Sbjct: 84  PVEPPKPPVEPPKPPVEPPK--PPVEPPKPPVEPP--KPPVEPPKPPVEPPKPPKPPVEP 139

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            V P  P  P   P++PP P   P   P P  P
Sbjct: 140 PVPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKP 172

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 39/92 (42%), Positives = 44/92 (47%), Gaps = 2/92 (2%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGK-PVKPPGIVPPIVKP-PGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           KP     KP+ +P K  V PP   PP+  P P + PP  KPPV  P    PPV  P   V
Sbjct: 61  KPPVDPPKPTVEPPKPTVAPP--KPPVEPPKPPVEPP--KPPVEPPK---PPVEPPKPPV 113

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            P   P  PP P V P  PP P + PP  P P
Sbjct: 114 EPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKP 145

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 40/94 (42%), Positives = 49/94 (52%), Gaps = 5/94 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKP-VKPPGIVPPIVKPPG--IVPPIVKPPVILPPVTVPPVTVPPITV 309
           PVP +  P+  P KP V PP    P V+PP   + PP  KPPV  P   V P   PP+  
Sbjct: 50  PVPPQ--PTDLPTKPPVDPP---KPTVEPPKPTVAPP--KPPVEPPKPPVEPPK-PPVEP 101

Query: 310 P-PVVKPTLPPI-PGVTPILPPVPVLNPPSTPTP 405
           P P V+P  PP+ P   P+ PP P + PP  P P
Sbjct: 102 PKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPKP 135

[154][TOP]
>UniRef100_UPI0001982D3D PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001982D3D
          Length = 214

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 52/130 (40%), Positives = 63/130 (48%), Gaps = 10/130 (7%)
 Frame = +1

Query: 55  SKIHAYLFLCMLFLSSAAPIL-GCGTCGKPVPKKHKPS---KKPGKPVKP-PGIVPPIVK 219
           SK  A  F+ M+F+  A P +  CG C +P P    PS   ++P  P  P P   PP  K
Sbjct: 3   SKGTAMFFIFMIFMLMALPPMQACGYCSQPQPPYRYPSPPYRRPNTPTIPHPHPHPPSKK 62

Query: 220 -PPGIVP--PIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPV--LN 384
            PPG     PIV PP   PP   PPV  PP+T+PP    T PP  G  P         LN
Sbjct: 63  HPPGHHKERPIVSPPSNNPPGITPPVVNPPVTIPPP-SSTYPPYTGNPPSGGGGGGGGLN 121

Query: 385 PPSTPTPTTP 414
           PP + +PT P
Sbjct: 122 PPPSTSPTCP 131

[155][TOP]
>UniRef100_Q7T9Y7 Odv-e66 n=1 Tax=Adoxophyes orana granulovirus RepID=Q7T9Y7_GVAO
          Length = 747

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 32/64 (50%), Positives = 36/64 (56%)
 Frame = +1

Query: 223 PGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPT 402
           P  +PP V PP+++PP T PP   PP T  P   PT PP P  TP  PP P   P  TPT
Sbjct: 41  PTPIPP-VNPPIVIPPPTPPPTPTPPPTPTPPPTPTPPPTPPPTPTPPPTPTPPPTPTPT 99

Query: 403 PTTP 414
           PT P
Sbjct: 100 PTPP 103

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 37/81 (45%), Positives = 39/81 (48%)
 Frame = +1

Query: 172 PGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGV 351
           P  PV PP ++PP   PP   PP    P   PP   PP T PP   PP   PT PP P  
Sbjct: 43  PIPPVNPPIVIPPPTPPPTPTPPPTPTP---PPTPTPPPTPPPTPTPPPT-PTPPPTPTP 98

Query: 352 TPILPPVPVLNPPSTPTPTTP 414
           TP  PP P   P  TP PT P
Sbjct: 99  TPTPPPTP--PPTPTPPPTPP 117

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 34/76 (44%), Positives = 36/76 (47%)
 Frame = +1

Query: 178 KPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTP 357
           +P   P + PPIV PP   PP   PP   P  T PP   PP T PP   P   P P  TP
Sbjct: 40  EPTPIPPVNPPIVIPPPTPPPTPTPP---PTPTPPPTPTPPPTPPPTPTPPPTPTPPPTP 96

Query: 358 ILPPVPVLNPPSTPTP 405
              P P   PP TPTP
Sbjct: 97  TPTPTPPPTPPPTPTP 112

[156][TOP]
>UniRef100_Q9FPQ5 Gamete-specific hydroxyproline-rich glycoprotein a2 n=1
           Tax=Chlamydomonas reinhardtii RepID=Q9FPQ5_CHLRE
          Length = 386

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 36/85 (42%), Positives = 38/85 (44%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           PS  P KP  PP   PP   PP   PP   PP  LPP  VPP   PP   PP      PP
Sbjct: 132 PSPMPPKPSSPPSPTPPSPMPPSPAPPSPAPPSPLPPSPVPPSPAPPSPAPP---SPAPP 188

Query: 340 IPGVTPILPPVPVLNPPSTPTPTTP 414
            P      PP PV   P+ P+P  P
Sbjct: 189 SPAPPSPRPPSPVPPSPAPPSPLPP 213

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/96 (38%), Positives = 44/96 (45%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139 PVPKKHK--PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P+P K    PS  P  P+ PP   PP   PP  +PP   PP   PP   PP   PP   P
Sbjct: 134 PMPPKPSSPPSPTPPSPM-PPSPAPPSPAPPSPLPPSPVPPSPAPPSPAPPSPAPPSPAP 192

Query: 313 PVVKP--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  +P   +PP P     LPP P    P+ P+P  P
Sbjct: 193 PSPRPPSPVPPSPAPPSPLPPSPAPPSPAPPSPEPP 228

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/90 (41%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP  +PP  VPP   PP  LPP   PP   PP   PP   
Sbjct: 173 PSPAPPSPAPPSPA-PPSPAPPSPRPPSPVPPSPAPPSPLPPSPAPPSPAPPSPEPPSPA 231

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PPS P P +P
Sbjct: 232 PPSPEPPSPEPPSPAPPSPEPPS-PEPPSP 260

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/94 (39%), Positives = 41/94 (43%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP  +PP   PP  +PP   PP   PP   PP   PP   
Sbjct: 203 PSPAPPSPLPPSPA-PPSPAPPSPEPPSPAPPSPEPPSPEPPSPAPPSPEPPSPEPPSPA 261

Query: 325 PTLPPIPGVTPILP----PVPVLNPPSTPTPTTP 414
           P  P  P   P  P    PVP   PP +P+P TP
Sbjct: 262 PPSPAPPSPVPPSPAPPSPVPPSPPPPSPSPPTP 295

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 37/90 (41%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  PV PP   PP   PP   PP   PP   PP  VPP   PP  +PP   
Sbjct: 158 PSPAPPSPLPPSPV-PPSPAPPSPAPPSPAPPSPAPPSPRPPSPVPPSPAPPSPLPPSPA 216

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PPS P P +P
Sbjct: 217 PPSPAPPSPEPPSPAPPSPEPPS-PEPPSP 245

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 37/90 (41%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P+ PP  VPP   PP   PP   PP   PP   PP  VPP   PP   
Sbjct: 153 PSPAPPSPAPPSPL-PPSPVPPSPAPPSPAPPSPAPPSPAPPSPRPPSPVPPSPAPPSPL 211

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PPS P P +P
Sbjct: 212 PPSPAPPSPAPPSPEPPSPAPPS-PEPPSP 240

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/90 (40%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P +PP  VPP   PP  +PP   PP   PP   PP   PP   PP  +
Sbjct: 183 PSPAPPSPAPPSP-RPPSPVPPSPAPPSPLPPSPAPPSPAPPSPEPPSPAPPSPEPPSPE 241

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  P  P   P  P  P   PPS P P +P
Sbjct: 242 PPSPAPPSPEPPSPEPPSPAPPS-PAPPSP 270

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 39/92 (42%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP  +PP   PP   PP   PP   PP   PP   PP  VPP   
Sbjct: 148 PSPMPPSPAPPSPA-PPSPLPPSPVPPSPAPPSPAPPSPAPPSPAPPSPRPPSPVPPSPA 206

Query: 325 P--TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   LPP P      PP P    P+ P+P  P
Sbjct: 207 PPSPLPPSPAPPSPAPPSPEPPSPAPPSPEPP 238

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 37/92 (40%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           PVP    PS  P  P  PP   PP   PP   PP   PP   PP  +PP   PP   PP 
Sbjct: 170 PVP----PSPAPPSPA-PPSPAPPSPAPPSPRPPSPVPPSPAPPSPLPPSPAPPSPAPPS 224

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            +P  P  P   P  P  P   PPS P P +P
Sbjct: 225 PEPPSPAPPSPEPPSPEPPSPAPPS-PEPPSP 255

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 31/79 (39%), Positives = 36/79 (45%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P +PP   PP   PP   PP  +PP   PP   PP  VPP   PP   
Sbjct: 223 PSPEPPSPAPPSP-EPPSPEPPSPAPPSPEPPSPEPPSPAPPSPAPPSPVPPSPAPPSPV 281

Query: 325 PTLPPIPGVTPILPPVPVL 381
           P  PP P  +   PP P++
Sbjct: 282 PPSPPPPSPS---PPTPII 297

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 32/80 (40%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
 Frame = +1

Query: 178 KPVKPPGIVPP-IVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVT 354
           K + PP  +PP    PP   PP   PP   PP   PP  +PP  VPP   P  P  P   
Sbjct: 127 KSLSPPSPMPPKPSSPPSPTPPSPMPPSPAPPSPAPPSPLPPSPVPPSPAPPSPAPPSPA 186

Query: 355 PILPPVPVLNPPSTPTPTTP 414
           P  P  P   PPS P P +P
Sbjct: 187 PPSPAPPSPRPPS-PVPPSP 205

[157][TOP]
>UniRef100_B4FU97 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4FU97_MAIZE
          Length = 204

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 52/132 (39%), Positives = 67/132 (50%), Gaps = 11/132 (8%)
 Frame = +1

Query: 46  MESSKIHAYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPP 225
           MES+K+ A L L ML LSS+   L      K  P+ H  S + G P    G+  P+  PP
Sbjct: 1   MESTKLSALLVLAMLALSSSPLALAWE---KAEPECH--SCESGSPPSTGGV--PL--PP 51

Query: 226 GIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIP-----------GVTPILPPV 372
             +P +  PPV +P V +PPV++P + +PPV   TLPPIP           G     PP 
Sbjct: 52  VSIPSVPLPPVSIPSVPLPPVSIPSVPLPPV---TLPPIPIVGGSPSPTKKGHRKACPP- 107

Query: 373 PVLNPPSTPTPT 408
               PPS PTPT
Sbjct: 108 ----PPSPPTPT 115

[158][TOP]
>UniRef100_Q07PB7 Peptidase C14, caspase catalytic subunit p20 n=1 Tax=Rhodopseudomonas
            palustris BisA53 RepID=Q07PB7_RHOP5
          Length = 1067

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 40/110 (36%), Positives = 48/110 (43%), Gaps = 18/110 (16%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVK----------------PPVILPP 270
            P P   +P   P  P   P   PP+V+P    PP+V+                PPV+ PP
Sbjct: 934  PPPPVVRPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPVVRPP 993

Query: 271  VTVPPVTVP-PITVPPVVKPTLPPIPGVTPI-LPPVPVLNPPSTPTPTTP 414
               PP   P P   PPVV+P  PP P   P   PP PV+ PP  P P  P
Sbjct: 994  PPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPPP 1043

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 33/90 (36%), Positives = 38/90 (42%), Gaps = 1/90 (1%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVK-PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
            P P   +P   P    + PP +  P   PP   P    PPV+ PP   PP    P   PP
Sbjct: 898  PPPAAERPKPAPAAERQTPPAVTRPAAPPPAARPAPPPPPVVRPPPPPPPPAAHPAPPPP 957

Query: 316  VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            VV+P  PP P V    PP P   P   P P
Sbjct: 958  VVRPAPPPPPVVRQAPPPPPAARPAPPPPP 987

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/99 (34%), Positives = 44/99 (44%), Gaps = 10/99 (10%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
            P  ++ KP+    +   P    P   PP  +P    PP+V+PP   PP    P   PP+ 
Sbjct: 900  PAAERPKPAPAAERQTPPAVTRPAAPPPAARPAPPPPPVVRPPPPPPPPAAHPAPPPPVV 959

Query: 307  -----VPPVVKPTLPPIPGVTPI-LPPVPVLNPPSTPTP 405
                  PPVV+   PP P   P   PP PV+ PP  P P
Sbjct: 960  RPAPPPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPPPP 998

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 35/93 (37%), Positives = 43/93 (46%), Gaps = 7/93 (7%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVK------PPVILPPVTVPPVTVP- 297
            PV ++  P     +P  PP   PP+V+PP   PP  +      PPV+ PP   PP   P 
Sbjct: 967  PVVRQAPPPPPAARPAPPPP--PPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPA 1024

Query: 298  PITVPPVVKPTLPPIPGVTPILPPVPVLNPPST 396
            P   PPVV+P  PP P   P   P P    P T
Sbjct: 1025 PPPPPPVVRPPPPPPPPPPPAARPAPPAAKPCT 1057

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 39/107 (36%), Positives = 46/107 (42%), Gaps = 20/107 (18%)
 Frame = +1

Query: 145  PKKHKPSKKP--GKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV--- 309
            P   +P+  P   +P  PP   PP+V+PP   PP    P   PPV V P   PP  V   
Sbjct: 917  PAVTRPAAPPPAARPAPPP---PPVVRPPPPPPPPAAHPAPPPPV-VRPAPPPPPVVRQA 972

Query: 310  --------------PPVVKPTLPPIPGVTPI-LPPVPVLNPPSTPTP 405
                          PPVV+P  PP P   P   PP PV+ PP  P P
Sbjct: 973  PPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPP 1019

[159][TOP]
>UniRef100_Q6Q766 GASA-like protein n=1 Tax=Gerbera hybrid cultivar
           RepID=Q6Q766_GERHY
          Length = 150

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 35/91 (38%), Positives = 42/91 (46%)
 Frame = +1

Query: 67  AYLFLCMLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV 246
           ++LFL   FL +        TC   V K   P+K    P       PP+ KPP   PP+ 
Sbjct: 3   SHLFLLASFLLAT-------TCAAYVAKPPVPAKTAPPPPVLKAPPPPVAKPPTTSPPVA 55

Query: 247 KPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           KPP   PPV  PP T PP+  PP   P  PP
Sbjct: 56  KPPTTAPPVAKPPTTAPPVVKPPPATPPTPP 86

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 31/76 (40%), Positives = 36/76 (47%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           KPP  VP    PP   PP++K P   PPV  PP T PP+  PP   P +   P   P   
Sbjct: 23  KPP--VPAKTAPP---PPVLKAPP--PPVAKPPTTSPPVAKPPTTAPPVAKPPTTAP--- 72

Query: 367 PVPVLNPPSTPTPTTP 414
             PV+ PP    PT P
Sbjct: 73  --PVVKPPPATPPTPP 86

[160][TOP]
>UniRef100_A9P9Z1 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9P9Z1_POPTR
          Length = 207

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 34/92 (36%), Positives = 39/92 (42%), Gaps = 2/92 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           PV +   P+  P     PP   PP   PP   PP   PP   PP T PP T PP T PP 
Sbjct: 60  PVTQSPPPATPPPVSAPPPASPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA 119

Query: 319 VKPTLP--PIPGVTPILPPVPVLNPPSTPTPT 408
           V P  P    P + P   P P  +    P P+
Sbjct: 120 VPPPAPLASPPALVPAPAPAPSKSKLKAPAPS 151

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 39/106 (36%), Positives = 43/106 (40%), Gaps = 5/106 (4%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVK---PPGIVPPI-VKPPGIVPPIVKPPVILPP 270
           A P     T   P      P      PV    PP   PP+   PP   PP   PP   PP
Sbjct: 34  APPTATTPTTSPPPATSTPPPVSAPPPVTQSPPPATPPPVSAPPPASPPPATPPPATPPP 93

Query: 271 VTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPS-TPTP 405
            T PP T PP T PP   P   P P V P   P P+ +PP+  P P
Sbjct: 94  ATPPPATPPPATPPPATPPPATPPPAVPP---PAPLASPPALVPAP 136

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 34/108 (31%), Positives = 43/108 (39%), Gaps = 5/108 (4%)
 Frame = +1

Query: 94  LSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPV 273
           +S+  P+        P P    P   P     PP   PP   PP   PP   PP   PP 
Sbjct: 55  VSAPPPVTQSPPPATPPPVSAPPPASPPPATPPPATPPPATPPPATPPPATPPPATPPPA 114

Query: 274 TVPPVTVP--PITVPPVVKPTLPPIPGVTPILPPVP---VLNPPSTPT 402
           T PP   P  P+  PP + P   P P  + +  P P     +PP+ PT
Sbjct: 115 TPPPAVPPPAPLASPPALVPAPAPAPSKSKLKAPAPSPLASSPPAPPT 162

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 40/122 (32%), Positives = 50/122 (40%), Gaps = 12/122 (9%)
 Frame = +1

Query: 85  MLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIV---PPIVKPP 255
           ++FLS    ++G G  G+       P+  P     PP    P   PP      PP+  PP
Sbjct: 7   VIFLSLICIVIG-GVSGQA------PATSPTATPAPPTATTPTTSPPPATSTPPPVSAPP 59

Query: 256 VIL---PPVTVPPVTVPP------ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            +    PP T PPV+ PP       T PP   P   P P   P   P P   PP+TP P 
Sbjct: 60  PVTQSPPPATPPPVSAPPPASPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPA 119

Query: 409 TP 414
            P
Sbjct: 120 VP 121

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/122 (33%), Positives = 48/122 (39%), Gaps = 8/122 (6%)
 Frame = +1

Query: 64  HAYLFLCMLFL-----SSAAPILG-CGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIV--K 219
           +A +FL ++ +     S  AP      T   P       S  P     PP   PP V   
Sbjct: 5   NAVIFLSLICIVIGGVSGQAPATSPTATPAPPTATTPTTSPPPATSTPPPVSAPPPVTQS 64

Query: 220 PPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTP 399
           PP   PP V  P   PP + PP T PP T PP   P   P P   P   P P   PP+ P
Sbjct: 65  PPPATPPPVSAP---PPASPPPATPPPATPPPATPPPATPPPATPPPATPPPATPPPAVP 121

Query: 400 TP 405
            P
Sbjct: 122 PP 123

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 33/91 (36%), Positives = 38/91 (41%), Gaps = 1/91 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP-PVTVPPITVPP 315
           PV      ++ P     PP   PP   PP   PP   PP   PP   P P T PP T PP
Sbjct: 54  PVSAPPPVTQSPPPATPPPVSAPPPASPPPATPPPATPPPATPPPATPPPATPPPATPPP 113

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
              P  P +P   P+  P P L P   P P+
Sbjct: 114 ATPP--PAVPPPAPLASP-PALVPAPAPAPS 141

[161][TOP]
>UniRef100_Q5CT04 Putative uncharacterized protein n=1 Tax=Cryptosporidium parvum Iowa
            II RepID=Q5CT04_CRYPV
          Length = 2527

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 42/83 (50%), Positives = 47/83 (56%)
 Frame = +1

Query: 166  KKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIP 345
            K P  P  PP  +PP  K P I PP + P  I  P T+PP T+PP T+PP   PTLPP  
Sbjct: 2379 KLPPLPPLPP--LPPTPKAPTIPPPTLPPTPISTP-TIPPPTLPPPTLPP---PTLPP-- 2430

Query: 346  GVTPILPPVPVLNPPSTPTPTTP 414
               P LPP P L P  TPTP TP
Sbjct: 2431 ---PTLPP-PTLPPTPTPTPPTP 2449

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/87 (42%), Positives = 44/87 (50%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P P   K    P  P  PP    P + PP + P  +  P I PP T+PP T+PP T+PP 
Sbjct: 2373 PSPTLPKLPPLPPLPPLPPTPKAPTIPPPTLPPTPISTPTIPPP-TLPPPTLPPPTLPP- 2430

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTP 399
              PTLPP     P LPP P   PP+ P
Sbjct: 2431 --PTLPP-----PTLPPTPTPTPPTPP 2450

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 11/108 (10%)
 Frame = +1

Query: 124  GTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVP--PIVKPPVILPPV----TVPP 285
            GT   P P        P  P  PP    P   P   +P  P + P   LPP     T+PP
Sbjct: 2341 GTPPAPTPISTPTISTPTLPTLPPTPPSPSSPPSPTLPKLPPLPPLPPLPPTPKAPTIPP 2400

Query: 286  VTVP--PITVPPVVKPTLPPIPGVTPILPPVPVLNPPS---TPTPTTP 414
             T+P  PI+ P +  PTLPP     P LPP P L PP+   TPTPT P
Sbjct: 2401 PTLPPTPISTPTIPPPTLPPPTLPPPTLPP-PTLPPPTLPPTPTPTPP 2447

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 30/73 (41%), Positives = 36/73 (49%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P+P        P  P  PP  +PP       +PP   PP  LPP T+PP T+PP T+PP 
Sbjct: 2382 PLPPLPPLPPTPKAPTIPPPTLPPTPISTPTIPPPTLPPPTLPPPTLPPPTLPPPTLPPT 2441

Query: 319  VKPTLPPIPGVTP 357
              PT PP P   P
Sbjct: 2442 PTPT-PPTPPQAP 2453

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 33/94 (35%), Positives = 45/94 (47%)
 Frame = +1

Query: 133  GKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            G+  P    P+     P  PP   PP+  PP   PP+   P+   P+  PP +  PI   
Sbjct: 2163 GRSPPSSPIPTPPSFSPPPPPVPAPPLFPPPS--PPMPGYPLPSSPIPTPP-SSSPIPPK 2219

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P  +P  PPIP ++P  P  P+   PS+P PT P
Sbjct: 2220 PEYQPPPPPIPTLSPSPPAPPMPAFPSSPPPTAP 2253

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 39/116 (33%), Positives = 48/116 (41%), Gaps = 14/116 (12%)
 Frame = +1

Query: 103  AAPILGCGTCGKPVPKKHKPSKKPGKPVK-PPGIVPPIVKPPGIVPPIVKPPVILPP-VT 276
            A+P       G P+P        P  P   PP   PP    PG  PP    P+  PP  +
Sbjct: 2121 ASPAEVSPIAGTPIPTPPFSPPPPSVPAPAPPSFPPPSPPMPGRSPP--SSPIPTPPSFS 2178

Query: 277  VPPVTVPPITVPPVVKPTLPPIPGV----TPI--------LPPVPVLNPPSTPTPT 408
             PP   PP+  PP+  P  PP+PG     +PI        +PP P   PP  P PT
Sbjct: 2179 PPP---PPVPAPPLFPPPSPPMPGYPLPSSPIPTPPSSSPIPPKPEYQPPPPPIPT 2231

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 29/72 (40%), Positives = 36/72 (50%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
            P+P   K    P   + P  I  P + PP + PP + PP  LPP T+PP T+PP   P  
Sbjct: 2388 PLPPTPKAPTIPPPTLPPTPISTPTIPPPTLPPPTLPPPT-LPPPTLPPPTLPPTPTP-- 2444

Query: 319  VKPTLPPIPGVT 354
              PT P  PG T
Sbjct: 2445 TPPTPPQAPGQT 2456

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 37/112 (33%), Positives = 46/112 (41%), Gaps = 20/112 (17%)
 Frame = +1

Query: 139  PVPKKHKPSKKP-GKPVK-PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P P    P + P   P+  PP   PP   PP   PP+  PP   PP+   P+   PI  P
Sbjct: 2155 PPPSPPMPGRSPPSSPIPTPPSFSPP--PPPVPAPPLFPPPS--PPMPGYPLPSSPIPTP 2210

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNP------------------PSTPTPTTP 414
            P   P +PP P   P  PP+P L+P                  P  P+PT P
Sbjct: 2211 PSSSP-IPPKPEYQPPPPPIPTLSPSPPAPPMPAFPSSPPPTAPGVPSPTLP 2261

[162][TOP]
>UniRef100_B4I114 GM12332 n=1 Tax=Drosophila sechellia RepID=B4I114_DROSE
          Length = 1214

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 32/88 (36%), Positives = 41/88 (46%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P  + P       V+PP   PP V+PP + PP  +PP + PP   PP   PP   PP V+
Sbjct: 1083 PPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQPPTVQPPTVQ 1142

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            P     P V P     P  +PP+   PT
Sbjct: 1143 PPTNQPPTVQPPTVQPPTHHPPTNEPPT 1170

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 33/87 (37%), Positives = 41/87 (47%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P  H+P       V+PP   PP V+PP + PP  +PP + PP   PP   PP   PP V+
Sbjct: 1098 PPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQPPTVQPPTVQPPTNQPPTVQPPTVQ 1157

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTP 405
            P     P   P     P   PPS P+P
Sbjct: 1158 PPTHHPPTNEPPTNRSPTKRPPS-PSP 1183

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 34/92 (36%), Positives = 44/92 (47%), Gaps = 5/92 (5%)
 Frame = +1

Query: 148  KKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKP 327
            K   P  +P  P +PP   PP  +PP + PP  +PP + PP   PP   PP   PP V+P
Sbjct: 1071 KTTTPPTQP--PTEPPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQP 1128

Query: 328  TLPPIPGVTP--ILPPV---PVLNPPSTPTPT 408
                 P V P  + PP    P + PP+   PT
Sbjct: 1129 PTNQPPTVQPPTVQPPTNQPPTVQPPTVQPPT 1160

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 32/88 (36%), Positives = 42/88 (47%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
            P    P+ +P    +PP + PP V+PP   PP V+PP + PP   PP   PP   PP  +
Sbjct: 1089 PTNEPPTVQPPTH-QPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQPPTVQPPTVQPPTNQ 1147

Query: 325  PTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            P     P V P     P   PP+  +PT
Sbjct: 1148 PPTVQPPTVQPPTHHPPTNEPPTNRSPT 1175

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 32/83 (38%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = +1

Query: 163  SKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK-PTLPP 339
            S K   P   P   PP   PP   PP V+PP   PP   PP   PP   PP V+ PT+ P
Sbjct: 1069 SGKTTTPPTQPPTEPPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQP 1128

Query: 340  IPGVTPILPPVPVLNPPSTPTPT 408
                 P + P P + PP+   PT
Sbjct: 1129 PTNQPPTVQP-PTVQPPTNQPPT 1150

[163][TOP]
>UniRef100_B3P5V6 GG11582 n=1 Tax=Drosophila erecta RepID=B3P5V6_DROER
          Length = 1098

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 36/90 (40%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           VP+  +    P     PP   PPIV+PP   PP V+PP +  P   P +  PP   PP V
Sbjct: 347 VPESVQVPAPPKTEPPPPPPAPPIVEPPPPAPPTVEPPPVPQPPASPNIDPPPPPAPPTV 406

Query: 322 KPTLPPI-PGVTPILPPVPV-LNPPSTPTP 405
           +P  PP  P V P  PP P  ++PP  P P
Sbjct: 407 EPPPPPAPPAVEPPPPPAPAEVDPPPPPAP 436

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 39/106 (36%), Positives = 44/106 (41%), Gaps = 14/106 (13%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKP--VKPPGIVPPIVKPPGIVPPIVKPPVILPP------VTVPPVTV 294
           P P K +P   P  P  V+PP   PP V+PP +  P   P +  PP      V  PP   
Sbjct: 354 PAPPKTEPPPPPPAPPIVEPPPPAPPTVEPPPVPQPPASPNIDPPPPPAPPTVEPPPPPA 413

Query: 295 PPITVPP------VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   PP       V P  PP P     LPP P   PP    P TP
Sbjct: 414 PPAVEPPPPPAPAEVDPPPPPAPPQVE-LPPPPA--PPKNDPPLTP 456

[164][TOP]
>UniRef100_P89459 Large tegument protein UL36 n=1 Tax=Human herpesvirus 2 strain HG52
            RepID=DUB_HHV2H
          Length = 3122

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 41/117 (35%), Positives = 58/117 (49%), Gaps = 10/117 (8%)
 Frame = +1

Query: 94   LSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGI------VPPIVKPPGIVPPIVKPP 255
            ++ + P+ G    G PV ++  P     KP     I       PP+ +PP   PP+ +PP
Sbjct: 2850 VAPSEPLCGWVVPGGPVARRPPPQSPATKPAARTRIRARSVPQPPLPQPPLPQPPLPQPP 2909

Query: 256  VILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVP-VLNP---PSTPTPTTP 414
            +  PP+  PP+  PP+  PP+ +P LP  P   P LPPV   L P    S PTP +P
Sbjct: 2910 LPQPPLPQPPLPQPPLPQPPLPQPPLPQPPLPQPPLPPVTRTLTPQSRDSVPTPESP 2966

[165][TOP]
>UniRef100_Q0RKM5 Putative uncharacterized protein n=1 Tax=Frankia alni ACN14a
           RepID=Q0RKM5_FRAAA
          Length = 525

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 42/84 (50%), Positives = 46/84 (54%), Gaps = 3/84 (3%)
 Frame = -3

Query: 413 GVVGVGVLGGFSTGTGGRMGVTPGIGGRVGFTTGGTVIGGTVTGGTVTGGNITGGFTIGG 234
           GV G GV GG + G G   G TPG G   G T GG V GG V GG   GG + GG   GG
Sbjct: 304 GVPGGGVPGGGTPGGGVPGGGTPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGG 363

Query: 233 TMPGGFTIGGTMPGGFT---GLPG 171
             PGG   GG +PGG T   G+PG
Sbjct: 364 GTPGGGVPGGGVPGGGTPGGGVPG 387

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 41/81 (50%), Positives = 44/81 (54%)
 Frame = -3

Query: 413 GVVGVGVLGGFSTGTGGRMGVTPGIGGRVGFTTGGTVIGGTVTGGTVTGGNITGGFTIGG 234
           GV G G  GG   G G   G TPG G   G T GG V GG   GG V GG + GG T GG
Sbjct: 294 GVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGTPGGGVPGGGTPGGGVPGGGVPGGGTPGG 353

Query: 233 TMPGGFTIGGTMPGGFTGLPG 171
            +PGG   GG  PGG  G+PG
Sbjct: 354 GVPGGGVPGGGTPGG--GVPG 372

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 41/84 (48%), Positives = 45/84 (53%), Gaps = 3/84 (3%)
 Frame = -3

Query: 413 GVVGVGVLGGFSTGTGGRMGVTPGIGGRVGFTTGGTVIGGTVTGGTVTGGNITGGFTIGG 234
           G  G GV GG + G G   G  PG G   G   GG V GG   GG V GG + GG T GG
Sbjct: 324 GTPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGG 383

Query: 233 TMPGGFTIGGTMPGGFT---GLPG 171
            +PGG T GG +PGG T   G PG
Sbjct: 384 GVPGGGTPGGGVPGGGTPGGGTPG 407

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 42/84 (50%), Positives = 44/84 (52%), Gaps = 3/84 (3%)
 Frame = -3

Query: 413 GVVGVGVLGGFSTGTGGRMGVTPGIGGRVGFTTGGTVIGGTVTGGTVTGGNITGGFTIGG 234
           G  G GV GG   G G   G  PG G   G T GG V GG V GG   GG + GG T GG
Sbjct: 334 GTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGTPGG 393

Query: 233 TMPGGFTIGGTMPGGFT---GLPG 171
            +PGG T GG  PGG T   G PG
Sbjct: 394 GVPGGGTPGGGTPGGGTPGGGTPG 417

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 41/84 (48%), Positives = 45/84 (53%), Gaps = 3/84 (3%)
 Frame = -3

Query: 413 GVVGVGVLGGFSTGTGGRMGVTPGIGGRVGFTTGGTVIGGTVTGGTVTGGNITGGFTIGG 234
           G  G GV GG + G G   G TPG G   G   GG   GG V GG V GG   GG   GG
Sbjct: 314 GTPGGGVPGGGTPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGG 373

Query: 233 TMPGGFTIGGTMPGGFT---GLPG 171
            +PGG T GG +PGG T   G+PG
Sbjct: 374 GVPGGGTPGGGVPGGGTPGGGVPG 397

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 40/81 (49%), Positives = 41/81 (50%)
 Frame = -3

Query: 413 GVVGVGVLGGFSTGTGGRMGVTPGIGGRVGFTTGGTVIGGTVTGGTVTGGNITGGFTIGG 234
           GV G G  GG   G G   G TPG G   G   GG   GG V GG   GG + GG T GG
Sbjct: 344 GVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPGGGTPGGGVPGGGTPGG 403

Query: 233 TMPGGFTIGGTMPGGFTGLPG 171
             PGG T GG  PGG  G PG
Sbjct: 404 GTPGGGTPGGGTPGG--GTPG 422

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 41/97 (42%), Positives = 48/97 (49%), Gaps = 16/97 (16%)
 Frame = -3

Query: 413 GVVGVGVLGGFS-------TGTGGRMGVTPGIGGRVGF-TTGGTVIGGTVTGGTVTGGNI 258
           GV GV  +GG         T     +   PG+GG  G  T GG V GG V GG   GG +
Sbjct: 261 GVGGVPGVGGVPCVTDKPVTDKPNGIPCVPGVGGVPGGGTPGGGVPGGGVPGGGTPGGGV 320

Query: 257 TGGFTIGGTMPGGFTI-----GGTMPGGFT---GLPG 171
            GG T GG +PGG T      GG +PGG T   G+PG
Sbjct: 321 PGGGTPGGGVPGGGTPGGGVPGGGVPGGGTPGGGVPG 357

[166][TOP]
>UniRef100_A6LW67 Cytochrome b5 n=1 Tax=Clostridium beijerinckii NCIMB 8052
           RepID=A6LW67_CLOB8
          Length = 325

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 41/80 (51%), Positives = 43/80 (53%), Gaps = 2/80 (2%)
 Frame = -3

Query: 413 GVVGVGVLGGFSTGTGGRMGVTPGIGGRVG--FTTGGTVIGGTVTGGTVTGGNITGGFTI 240
           G +G G   G   GTGG  G   G GG  G    TGGT  GG  TGGT +GG  TGG T 
Sbjct: 224 GGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTS 283

Query: 239 GGTMPGGFTIGGTMPGGFTG 180
           GG   GG T GGT  GG TG
Sbjct: 284 GGMGTGGTTGGGTGTGGTTG 303

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 42/91 (46%), Positives = 45/91 (49%), Gaps = 2/91 (2%)
 Frame = -3

Query: 413 GVVGVGVLGGFSTGTGGRMGVTPGIGGRVG--FTTGGTVIGGTVTGGTVTGGNITGGFTI 240
           G +G G   G   GTGG  G   G GG  G    TGGT  GG  TGGT +GG  TGG T 
Sbjct: 234 GGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTG 293

Query: 239 GGTMPGGFTIGGTMPGGFTGLPGFLLGLCFF 147
           GGT  GG T GG   GG T     +    FF
Sbjct: 294 GGTGTGGTTGGGMGTGGTTRGESIVRNRLFF 324

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 41/74 (55%), Positives = 43/74 (58%), Gaps = 2/74 (2%)
 Frame = -3

Query: 395 VLGGFSTG--TGGRMGVTPGIGGRVGFTTGGTVIGGTVTGGTVTGGNITGGFTIGGTMPG 222
           +LGG STG  TGG MG     GG +G  TGGT  GG  TGGT  GG  TGG T GG   G
Sbjct: 192 LLGGPSTGGTTGGGMGTGGTTGGGMG--TGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTG 249

Query: 221 GFTIGGTMPGGFTG 180
           G T GG   GG TG
Sbjct: 250 GTTGGGMGTGGTTG 263

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 38/79 (48%), Positives = 39/79 (49%), Gaps = 2/79 (2%)
 Frame = -3

Query: 413 GVVGVGVLGGFSTGTGGRMGVTPGIGGRVG--FTTGGTVIGGTVTGGTVTGGNITGGFTI 240
           G +G G   G   GTGG      G GG  G    TGGT  GG  TGGT  GG  TGG T 
Sbjct: 204 GGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGTGGTTG 263

Query: 239 GGTMPGGFTIGGTMPGGFT 183
           GG   GG T GG   GG T
Sbjct: 264 GGMGTGGTTSGGMGTGGTT 282

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 36/76 (47%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = -3

Query: 413 GVVGVGVLGGFSTGTG-GRMGVTPGIGGRVGFTTGGTVIGGTVTGGTVTGGNITGGFTIG 237
           G  G G+  G +TG G G  G T G  G  G T GG   GGT  GG  TGG   GG   G
Sbjct: 200 GTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGTG 259

Query: 236 GTMPGGFTIGGTMPGG 189
           GT  GG   GGT  GG
Sbjct: 260 GTTGGGMGTGGTTSGG 275

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 35/76 (46%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = -3

Query: 413 GVVGVGV-LGGFSTGTGGRMGVTPGIGGRVGFTTGGTVIGGTVTGGTVTGGNITGGFTIG 237
           G  G G+  GG ++G  G  G T G  G  G T GG   GGT  GG  TGG   GG   G
Sbjct: 210 GTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGTG 269

Query: 236 GTMPGGFTIGGTMPGG 189
           GT  GG   GGT  GG
Sbjct: 270 GTTSGGMGTGGTTSGG 285

[167][TOP]
>UniRef100_Q9SBM1 Hydroxyproline-rich glycoprotein DZ-HRGP n=1 Tax=Volvox carteri f.
           nagariensis RepID=Q9SBM1_VOLCA
          Length = 409

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 38/88 (43%), Positives = 42/88 (47%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P +  PS  P  P +PP   PP  +PP   PP   PP   PP   PP   PP   PP   
Sbjct: 205 PPRPPPSPNPPSP-RPPSPSPPSPRPPPRRPPF-PPPSPPPPRPPPPAPPPPRPPPPSPP 262

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           P LPP P   P LPP P   PPS P P+
Sbjct: 263 PPLPPPPSPPPPLPPPPSPPPPSPPPPS 290

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 37/97 (38%), Positives = 44/97 (45%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P+   P+  P +P  PP   PP+  PP   PP+  PP   PP   PP  +PP   PP 
Sbjct: 242 PPPRPPPPAPPPPRP-PPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPK 300

Query: 319 VKP-----TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P       PP P   P  PP P  NPP  P P+ P
Sbjct: 301 PSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPP 337

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 41/111 (36%), Positives = 49/111 (44%), Gaps = 1/111 (0%)
 Frame = +1

Query: 85  MLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPP-GIVPPIVKPPGIVPPIVKPPVI 261
           +L L+S+   LG     KP P++         P  PP G  PP   PPG+ PP    P  
Sbjct: 7   LLLLASSPHALGA-PARKPPPRRSPVVALVETPAAPPPGSPPPGTPPPGVPPPTPSGPEH 65

Query: 262 LPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   PP   P   +PP   P  PP P V P  PP P   PP +P P  P
Sbjct: 66  PPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPP 116

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 43/113 (38%), Positives = 46/113 (40%), Gaps = 9/113 (7%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVP---------KKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPP 255
           AAP  G    G P P          +H P   P  P  P   +PP   PP   PP V PP
Sbjct: 39  AAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPP 98

Query: 256 VILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              PP   PP + PP   PP   P  PP P   P  PP P  NPP  P P  P
Sbjct: 99  PPPPPPPPPPPSPPP---PPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPP 148

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 37/90 (41%), Positives = 38/90 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 189 PPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFP-PPSPPPPRPP 247

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P+  PPS P P  P
Sbjct: 248 PPAPPPPRPPPPSPPPPLPPPPSPPPPLPP 277

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 37/92 (40%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P +P  PP   PP  +PP   PP  +PP   PP   PP   PP   PP 
Sbjct: 194 PSPPPSPPPSPPPRP--PPSPNPPSPRPPSPSPPSPRPPPRRPPFP-PPSPPPPRPPPPA 250

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P LPP P   PP  P P+ P
Sbjct: 251 PPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPP 282

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 37/94 (39%), Positives = 41/94 (43%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP-- 312
           P+P    P   P  PV PP   PP   PP   PP   PP   PP   PP   PP   P  
Sbjct: 80  PLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNP 139

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P  PP P   P  PP P  +PP +P P+ P
Sbjct: 140 PPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPP 173

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 34/90 (37%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P ++P  P  PP   PP   PP   PP   PP   PP+  PP   PP+  PP   
Sbjct: 225 PSPRPPPRRP--PFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPP 282

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  P  P  +PP+ P P  P
Sbjct: 283 PPSPPPPSPLPPSPRPPKPSPPNNPFPRPP 312

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P +P  PP   PP   PP + PP   PP   PP + PP   PP   PP   
Sbjct: 67  PPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPP 126

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PPS   P +P
Sbjct: 127 PPPPPPPPPPPNPPPPPPPPPPSPSPPPSP 156

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 35/92 (38%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           PVP    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP +  P 
Sbjct: 94  PVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPP 153

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P   P P   P  PP P  +PP +P P+ P
Sbjct: 154 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 185

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 35/92 (38%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P +      P  P  PP  VPP   PP   PP   PP   PP   PP + PP   PP 
Sbjct: 74  PPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPP 133

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P   P P  +PP +P P+ P
Sbjct: 134 PPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPP 165

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/92 (39%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 91  PPPPVPPPPPPPPPPPPPPSPPPPPPPPP---PPPPSPPPPPPPPPPPPPNPPPPPPPPP 147

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P  +PP +P P+ P
Sbjct: 148 PSPSPPPSPPPSP--PPSPPPSPPPSPPPSPP 177

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 35/92 (38%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP +  P   PP + PP 
Sbjct: 104 PPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPS 163

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P  +PP  P P+ P
Sbjct: 164 PPPSPPPSPPPSP--PPSPPPSPPPRPPPSPP 193

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P+ PP   PP   PP    P   PP   PP   PP   PP   PP 
Sbjct: 277 PPPSPPPPSPPPPSPL-PPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPS 335

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P  +PP  P P +P
Sbjct: 336 PPPPRPPPPSPNPPRPPPPSPSPPKPPPPPSP 367

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 34/93 (36%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT-VPP 315
           P P    P  +P  P  PP   PP   PP + PP   PP + PP + PP + PP + +PP
Sbjct: 235 PFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPP 294

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             +P  P  P   P   P P   PP  P P +P
Sbjct: 295 SPRPPKPSPPN-NPFPRPPPPNPPPPRPPPPSP 326

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/92 (38%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   P    PP   PP   PP + PP 
Sbjct: 100 PPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPS 159

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P  +PP +P P  P
Sbjct: 160 PPPSPPPSPPPSP--PPSPPPSPPPSPPPRPP 189

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 37/95 (38%), Positives = 40/95 (42%), Gaps = 5/95 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV--- 309
           P P+   PS  P  P  PP   PP+  PP   PP   PP  LPP   PP   PP      
Sbjct: 252 PPPRPPPPSPPPPLP-PPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPR 310

Query: 310 --PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             PP   P  PP P   P  PP P   PP  P P+
Sbjct: 311 PPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPS 345

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 37/95 (38%), Positives = 40/95 (42%), Gaps = 5/95 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV-----PPVTVPPI 303
           P P    PS  P  P  PP   PP   PP  +PP  +PP   PP        PP   PP 
Sbjct: 262 PPPLPPPPSPPPPLP-PPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPR 320

Query: 304 TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             PP   P  PP P   P  PP P  NPP  P P+
Sbjct: 321 PPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPS 355

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/95 (36%), Positives = 41/95 (43%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P+   P      P  PP + PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 75  PPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPP 134

Query: 319 VKPT---LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P     PP P  +P  PP P  +PP +P P+ P
Sbjct: 135 PPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPP 169

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/91 (39%), Positives = 39/91 (42%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKP-PGIVPPIVKPPVILPPVTVPPVTVPPITVPPVV 321
           P    PS  P  P +PP   PP   P P   PP   PP   PP   PP   PP   PP  
Sbjct: 173 PPSPPPSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPR 232

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           +P  PP P   P  PP P   PP  P P+ P
Sbjct: 233 RPPFPP-PSPPPPRPPPPAPPPPRPPPPSPP 262

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/92 (38%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP    P   PP + PP + PP 
Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPP-SPPPS 167

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P   PP +P P+ P
Sbjct: 168 PPPSPPPSPPPSP--PPSPPPRPPPSPPPSPP 197

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 181 PPSPPPRPPPSPPPSPPPSPPP--SPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPP 238

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P+ PP P   P  PP P   PPS P P  P
Sbjct: 239 PS-PPPPRPPPPAPPPPRPPPPSPPPPLPP 267

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/87 (40%), Positives = 37/87 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS +P KP  PP    P   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 287 PPPSPLPPSPRPPKP-SPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPS 345

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTP 399
             P  PP P  +P  PP P   PP  P
Sbjct: 346 PNPPRPPPPSPSPPKPPPPPSPPPRPP 372

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/93 (37%), Positives = 40/93 (43%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P + P  P   P   PP   PP   PP   PP   PP   PP   PP + PP 
Sbjct: 69  PPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPP 128

Query: 319 VKPTLPPIPGVTPILPPVPVL-NPPSTPTPTTP 414
             P  PP P   P  PP P   +PP +P P+ P
Sbjct: 129 PPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPP 161

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 35/92 (38%), Positives = 42/92 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP    P   PP + PP   PP + PP 
Sbjct: 114 PPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPS--PPPSPPPS 171

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P  +PP +P P+ P
Sbjct: 172 PPPSPPPSPPPSP--PPRPPPSPPPSPPPSPP 201

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/93 (38%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP-PVTVPPITVPP 315
           P P    P   P  P  PP   PP   PP   PP   PP   PP   P P   PP + PP
Sbjct: 118 PPPPPPSPPPPPPPPPPPPPNPPPPPPPP---PPSPSPPPSPPPSPPPSPPPSPPPSPPP 174

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P+ PP P   P  PP P  +PP +P P+ P
Sbjct: 175 SPPPSPPPSPPPRP--PPSPPPSPPPSPPPSPP 205

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 35/93 (37%), Positives = 40/93 (43%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP-PVTVPPITVPP 315
           P P    P   P  P  PP   PP   PP    P   PP   PP   P P   PP + PP
Sbjct: 119 PPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 178

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P+ PP P  +P  PP P  +PP +P P  P
Sbjct: 179 SPPPSPPPRPPPSP--PPSPPPSPPPSPPPRPP 209

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P K  P   P     PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 296 PRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNPPRPPPPS 355

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP     PP  P PT P
Sbjct: 356 PSPPKPPPPPSPPPRPPRRPPRPPRRP-PTAP 386

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 34/92 (36%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P+  P  P  PP   PP   PP   P     P   PP + PP   PP + PP 
Sbjct: 130 PPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPS--PPPSPPPR 187

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P   PP +P P +P
Sbjct: 188 PPPSPPPSPPPSP--PPSPPPRPPPSPNPPSP 217

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 34/89 (38%), Positives = 37/89 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P+ P    PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 66  PPPPPPPPPPPPQPPLPPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPP--PPPP 123

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
             P  PP P   P  PP P   PP +P+P
Sbjct: 124 SPPPPPPPPPPPPPNPPPPPPPPPPSPSP 152

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 37/92 (40%), Positives = 39/92 (42%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGI--VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P    PS  P  P  PP     PP   PP   PP   PP   PP + PP   PP + P  
Sbjct: 215 PSPRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPPAPPPPRPPPPSPPPPLPPPPSPP-- 272

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P LPP P   P  PP P   PPS P P  P
Sbjct: 273 --PPLPPPPSPPPPSPPPPSPLPPS-PRPPKP 301

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 37/93 (39%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP-PVTVPPITVPP 315
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   P P   PP + PP
Sbjct: 143 PPPPPPSPSPPPSPPPSPPPSPPP--SPPPSPPP--SPPPSPPPSPPPRPPPSPPPSPPP 198

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P+ PP P  +P  PP P    PS P+P  P
Sbjct: 199 SPPPSPPPRPPPSP-NPPSPRPPSPSPPSPRPP 230

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 36/92 (39%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   P    PP + PP   PP   PP 
Sbjct: 139 PPPPPPPPPPSPSPPPSPPPSPPP--SPPPSPPPSPPPS---PPPSPPP--SPPPRPPPS 191

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P   P P  NPPS P P +P
Sbjct: 192 PPPSPPPSPPPSPPPRPPPSPNPPS-PRPPSP 222

[168][TOP]
>UniRef100_B8CCT2 Predicted protein n=1 Tax=Thalassiosira pseudonana CCMP1335
           RepID=B8CCT2_THAPS
          Length = 937

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 36/93 (38%), Positives = 38/93 (40%)
 Frame = +1

Query: 127 TCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
           T GKP P    P+ KP  P KPP   PP  KPP   PP  KPP   P    PP    P  
Sbjct: 584 TAGKP-PAGKPPAAKP-PPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAKLPAA 641

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            PP  KP     P   P     P   PP+   P
Sbjct: 642 KPPAAKPPAAKPPAAKPPTAKPPTAKPPTAKPP 674

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 35/92 (38%), Positives = 37/92 (40%)
 Frame = +1

Query: 133 GKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           GKP   K  P+K P    KPP   PP  KPP   PP  KP    PP    P   PP   P
Sbjct: 591 GKPPAAKPPPAKPPA--AKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAKLPAAKPPAAKP 648

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           P  KP     P   P     P   PP+   PT
Sbjct: 649 PAAKPPAAKPPTAKPPTAKPPTAKPPAAKPPT 680

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/105 (36%), Positives = 42/105 (40%), Gaps = 3/105 (2%)
 Frame = +1

Query: 100 SAAPILGCGTCGKPVPKKHKPSKKPGKPV---KPPGIVPPIVKPPGIVPPIVKPPVILPP 270
           +A P        KP P K   +K P   +   KPP   PP  KPP   PP  KPP   PP
Sbjct: 610 TAKPPTAKPPAAKPPPAKPSTAKPPAAKLPAAKPPAAKPPAAKPPAAKPPTAKPPTAKPP 669

Query: 271 VTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              PP   PP   PP VKPT    P        V V +   T  P
Sbjct: 670 TAKPPAAKPPTVKPPTVKPTAAVKPHAPIQTATVAVASGDQTQQP 714

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 29/74 (39%), Positives = 31/74 (41%)
 Frame = +1

Query: 187 KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           KPP   PP  KPP   PP  KPP   PP   PP   PP   P   KP    +P   P   
Sbjct: 587 KPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAKLPAAKPPAA 646

Query: 367 PVPVLNPPSTPTPT 408
             P   PP+   PT
Sbjct: 647 KPPAAKPPAAKPPT 660

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 33/92 (35%), Positives = 36/92 (39%), Gaps = 2/92 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKP--VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P+ K+       GKP   KPP   PP  KPP   PP  KPP   PP   P    PP    
Sbjct: 579 PIQKQTAGKPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAKL 638

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
           P  KP     P   P     P   PP+   PT
Sbjct: 639 PAAKPPAAKPPAAKPPAAKPPTAKPPTAKPPT 670

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 40/119 (33%), Positives = 45/119 (37%), Gaps = 13/119 (10%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVPKKHKPSKKP-GKP--VKPPGIVPPIVKP----------PGIVP 237
           ++  P  G     KP P K   +K P  KP   KPP   PP  KP          P   P
Sbjct: 584 TAGKPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAKLPAAKP 643

Query: 238 PIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  KPP   PP   PP   PP   PP  KP     P V P     P + P +   P  P
Sbjct: 644 PAAKPPAAKPPAAKPPTAKPPTAKPPTAKPPAAKPPTVKP-----PTVKPTAAVKPHAP 697

[169][TOP]
>UniRef100_B3M6C2 GF24314 n=1 Tax=Drosophila ananassae RepID=B3M6C2_DROAN
          Length = 860

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/99 (43%), Positives = 48/99 (48%), Gaps = 8/99 (8%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV------PPVTVP 297
           +P  +  +P   P +P  PP   PP  +PP   PP   PP  LPPVTV      PP T P
Sbjct: 412 RPPVRTTRPPPPPTRPPTPPPTRPP-TRPP--TPPPTPPPTYLPPVTVRTTRPPPPPTRP 468

Query: 298 PITVPPVVKPTLPPIPGVT--PILPPVPVLNPPSTPTPT 408
           P T PP   PT PP P  T  P  PP P     STP PT
Sbjct: 469 P-TPPPTRPPTRPPTPPPTRPPTRPPTPPPTRASTPAPT 506

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 45/115 (39%), Positives = 51/115 (44%), Gaps = 9/115 (7%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVPKKHKP----SKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVIL 264
           S+ AP     T   P P   +P    ++ P  P +PP   PP  +PP    P   PP  L
Sbjct: 501 STPAPTYLPPTNKPPPPATTRPPVRTTRPPPPPTRPP--TPPPTRPP--TRPPTPPPTYL 556

Query: 265 PPVTV-----PPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PPVTV     PP    P T PP   PT PP P  T  LPPV V      P PT P
Sbjct: 557 PPVTVRTTRPPPPPTKPRTPPPTRPPTRPPTPPPT-YLPPVTVRTTRPPPPPTRP 610

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 44/115 (38%), Positives = 48/115 (41%), Gaps = 25/115 (21%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIV--------------KPPGIVPPI---VKPPVILP 267
           P P   +P  +P  P  PP  +PP+                PP   PP      PP  LP
Sbjct: 537 PTPPPTRPPTRP--PTPPPTYLPPVTVRTTRPPPPPTKPRTPPPTRPPTRPPTPPPTYLP 594

Query: 268 PVTV------PPVTVPPITVPPVVKPTLPPIPGVT--PILPPVPVLNPPSTPTPT 408
           PVTV      PP T PP T PP   PT PP P  T  P  PP P     STP PT
Sbjct: 595 PVTVRTTRPPPPPTRPP-TPPPTRPPTRPPTPPPTRPPTRPPTPPPTRASTPAPT 648

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 40/99 (40%), Positives = 45/99 (45%), Gaps = 9/99 (9%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGI-VPPIVKPPVILPPVT--VPPVTVPPITVPP 315
           P    P++ P  P   P   PP  +PP   +PP  KPP   PP T  VPP   PP T PP
Sbjct: 106 PPTRPPTRPPTPPPTRPPTRPPTTRPPATYLPPTNKPP---PPATTRVPPPPPPPRTPPP 162

Query: 316 VVKPTLPPI--PGVTPI----LPPVPVLNPPSTPTPTTP 414
              PT PP   P  T +     PP PV     TP PT P
Sbjct: 163 TRPPTRPPTTRPPATYLPPTNKPPAPVTTRRPTPPPTRP 201

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 43/114 (37%), Positives = 50/114 (43%), Gaps = 8/114 (7%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVPKKHKP----SKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVIL 264
           S+ AP     T   P P   +P    ++ P  P +PP   PP  +PP    P   PP  L
Sbjct: 643 STPAPTYLPPTNKPPPPATTRPPVRTTRPPPPPTRPP--TPPPTRPP--TRPPTPPPTYL 698

Query: 265 PPVTV----PPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PPVTV    PP   PP T PP   PT PP    TP    +P  N P  P  T P
Sbjct: 699 PPVTVRTTRPP---PPPTRPPTRPPTRPPTRATTPAPTYLPPTNKPPPPATTRP 749

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 42/105 (40%), Positives = 50/105 (47%), Gaps = 14/105 (13%)
 Frame = +1

Query: 142 VPKKHKP-----SKKPGKPVKPPGIVPPIVKPPGI-VPPIVKPPVILPPVT--VPPVTVP 297
           +P  +KP     +++P  P   P   PP  +PP   +PP  KPP   PPVT  VPP   P
Sbjct: 179 LPPTNKPPAPVTTRRPTPPPTRPPTRPPTTRPPATYLPPTNKPP---PPVTTRVPPPPPP 235

Query: 298 PITVPPVVKPTLPPI--PGVTPI----LPPVPVLNPPSTPTPTTP 414
           P T PP   PT PP   P  T +     PP PV     TP PT P
Sbjct: 236 PRTPPPTRPPTRPPTTRPPATYLPPTNKPPAPVTTRRPTPPPTRP 280

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 37/98 (37%), Positives = 42/98 (42%), Gaps = 8/98 (8%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIV------PPIVKPPVILPPVTVPPVT--VPP 300
           P    P++ P +P  PP   PP   PP  V      PP  +PP   PP T PP     PP
Sbjct: 427 PPTPPPTRPPTRPPTPPPTPPPTYLPPVTVRTTRPPPPPTRPPT--PPPTRPPTRPPTPP 484

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            T PP   PT PP    TP    +P  N P  P  T P
Sbjct: 485 PTRPPTRPPTPPPTRASTPAPTYLPPTNKPPPPATTRP 522

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 39/95 (41%), Positives = 46/95 (48%), Gaps = 3/95 (3%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKP--VKPPGI-VPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P P+   P++ P +P   +PP   +PP  KPP  V      P    P T PP T PP T 
Sbjct: 155 PPPRTPPPTRPPTRPPTTRPPATYLPPTNKPPAPVTTRRPTPPPTRPPTRPPTTRPPATY 214

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   PT  P P VT  +PP P   PP TP PT P
Sbjct: 215 LP---PTNKPPPPVTTRVPPPP--PPPRTPPPTRP 244

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 40/103 (38%), Positives = 44/103 (42%), Gaps = 13/103 (12%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGI--VPPIVKPPV---ILPPVTVPPVTV--- 294
           P P    P+ KP  P       PP  +PP     PP  +PP      PP  +PPVTV   
Sbjct: 295 PAPTYLPPTNKPPPPATTRRPTPPPTRPPTRPPTPPPTRPPTRPPTPPPTYLPPVTVRTT 354

Query: 295 ---PPITVPPVVKPTLPPIPGVT--PILPPVPVLNPPSTPTPT 408
              PP T PP   PT PP    T  P  PP P     STP PT
Sbjct: 355 RPPPPPTRPPTPPPTRPPTRPSTPPPTRPPTPPPTRASTPAPT 397

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 41/109 (37%), Positives = 46/109 (42%), Gaps = 15/109 (13%)
 Frame = +1

Query: 127 TCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIV----PPIVKPPVILPPV---TVPP 285
           T  +P P   +P  +P     P   +PP  KPP  V    PP   PP   PP    T PP
Sbjct: 190 TTRRPTPPPTRPPTRPPTTRPPATYLPPTNKPPPPVTTRVPPPPPPPRTPPPTRPPTRPP 249

Query: 286 VTVPPIT-VPPVVKPTLP-------PIPGVTPILPPVPVLNPPSTPTPT 408
            T PP T +PP  KP  P       P P   P  PP P     STP PT
Sbjct: 250 TTRPPATYLPPTNKPPAPVTTRRPTPPPTRPPTRPPTPPPTRASTPAPT 298

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 38/101 (37%), Positives = 42/101 (41%), Gaps = 11/101 (10%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKP-------PGIVPPIVKPPVILPPVTVPPVTV--- 294
           P    P++ P +P  PP   PP   P       P  +PP  KPP   P  T PPV     
Sbjct: 363 PPTPPPTRPPTRPSTPPPTRPPTPPPTRASTPAPTYLPPTNKPPP--PATTRPPVRTTRP 420

Query: 295 -PPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP T PP   PT PP    TP   P P   PP T   T P
Sbjct: 421 PPPPTRPPTPPPTRPPTRPPTPPPTPPPTYLPPVTVRTTRP 461

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 36/97 (37%), Positives = 45/97 (46%), Gaps = 7/97 (7%)
 Frame = +1

Query: 145 PKKHKPSKKPGKP-VKPPGIVPPIV----KPPGIVPPIVKPPVILPPVTVPPVT--VPPI 303
           P+   P++ P +P   PP  +PP+     +PP   PP  +PP   PP T PP     PP 
Sbjct: 573 PRTPPPTRPPTRPPTPPPTYLPPVTVRTTRPP---PPPTRPPT--PPPTRPPTRPPTPPP 627

Query: 304 TVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           T PP   PT PP    TP    +P  N P  P  T P
Sbjct: 628 TRPPTRPPTPPPTRASTPAPTYLPPTNKPPPPATTRP 664

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 44/106 (41%), Positives = 49/106 (46%), Gaps = 14/106 (13%)
 Frame = +1

Query: 139  PVPKKHKP----SKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV------PPV 288
            P P   +P    ++ P  P +PP   PP  +PP    P   PP  LPPVTV      PP 
Sbjct: 742  PPPATTRPPVRTTRPPPPPTRPP--TPPPTRPP--TRPPTPPPTYLPPVTVRTTRPPPPP 797

Query: 289  TVPPITVPPVVKPTLPPIPGVT--PILPPVPVLNPPST--PTPTTP 414
            T PP T PP   PT PP P  T  P  PP   L PP T   TP  P
Sbjct: 798  TRPP-TPPPTRPPTRPPTPPPTRPPTRPPTTYL-PPVTRRTTPYVP 841

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 38/109 (34%), Positives = 46/109 (42%), Gaps = 13/109 (11%)
 Frame = +1

Query: 127 TCGKPVPKKHKPSKKPGKPVKPPGIVPPI---VKPPGIVPPI----VKPPVILPPVTVPP 285
           T  +P P    P++ P +P  PP   PP      PP  +PP+     +PP   PP T PP
Sbjct: 311 TTRRPTPP---PTRPPTRPPTPPPTRPPTRPPTPPPTYLPPVTVRTTRPP---PPPTRPP 364

Query: 286 VTVP------PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P      P T PP   PT PP    TP    +P  N P  P  T P
Sbjct: 365 TPPPTRPPTRPSTPPPTRPPTPPPTRASTPAPTYLPPTNKPPPPATTRP 413

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/98 (40%), Positives = 45/98 (45%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPV---TVPPITV 309
            P P    P+ KP     PP    P V+     PP  +PP   PP T PP    T PP  +
Sbjct: 730  PAPTYLPPTNKP----PPPATTRPPVRTTRPPPPPTRPPT--PPPTRPPTRPPTPPPTYL 783

Query: 310  PPV-VKPTLPPIPGVTPILPPVPVLNP--PSTPTPTTP 414
            PPV V+ T PP P   P  PP P   P  P TP PT P
Sbjct: 784  PPVTVRTTRPPPPPTRPPTPP-PTRPPTRPPTPPPTRP 820

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 36/94 (38%), Positives = 42/94 (44%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP----PVILPPVTVPPVTVPPITVP 312
           P    P++ P +P  PP   PP  +PP   PP  +     P  LPP   PP   PP T  
Sbjct: 468 PPTPPPTRPPTRPPTPPPTRPP-TRPP--TPPPTRASTPAPTYLPPTNKPP---PPATTR 521

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P V+ T PP P   P  PP P    P T  PT P
Sbjct: 522 PPVRTTRPPPP---PTRPPTPPPTRPPTRPPTPP 552

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 36/94 (38%), Positives = 42/94 (44%), Gaps = 4/94 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP----PVILPPVTVPPVTVPPITVP 312
           P    P++ P +P  PP   PP  +PP   PP  +     P  LPP   PP   PP T  
Sbjct: 610 PPTPPPTRPPTRPPTPPPTRPP-TRPP--TPPPTRASTPAPTYLPPTNKPP---PPATTR 663

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P V+ T PP P   P  PP P    P T  PT P
Sbjct: 664 PPVRTTRPPPP---PTRPPTPPPTRPPTRPPTPP 694

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 38/109 (34%), Positives = 43/109 (39%), Gaps = 17/109 (15%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIV------KPPGIVPPIVKP-----------PVILP 267
           P P   +P  +P  P  PP  +PP+        PP   PP   P           P  LP
Sbjct: 679 PTPPPTRPPTRP--PTPPPTYLPPVTVRTTRPPPPPTRPPTRPPTRPPTRATTPAPTYLP 736

Query: 268 PVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   PP   PP T  P V+ T PP P   P  PP P    P T  PT P
Sbjct: 737 PTNKPP---PPATTRPPVRTTRPPPP---PTRPPTPPPTRPPTRPPTPP 779

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 38/100 (38%), Positives = 43/100 (43%), Gaps = 8/100 (8%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGI----VPPIVKPPVILPPV---TVPPVTVP 297
           P P   +P  +P     P   +PP  KPP      VPP   PP   PP    T PP T P
Sbjct: 115 PTPPPTRPPTRPPTTRPPATYLPPTNKPPPPATTRVPPPPPPPRTPPPTRPPTRPPTTRP 174

Query: 298 PIT-VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P T +PP  KP  P    VT   P  P   PP+ P  T P
Sbjct: 175 PATYLPPTNKPPAP----VTTRRPTPPPTRPPTRPPTTRP 210

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 41/111 (36%), Positives = 48/111 (43%), Gaps = 19/111 (17%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIV----KPPGIVPPIVKPPVILPPVTVPPV--TVPP 300
           P P   +P  +P  P  PP  +PP+     +PP   PP  +PP   PP T PP   + PP
Sbjct: 327 PTPPPTRPPTRP--PTPPPTYLPPVTVRTTRPP---PPPTRPPT--PPPTRPPTRPSTPP 379

Query: 301 ITVPPVVKPT---------LPPI---PGVTPILPPVPVLNPPSTPT-PTTP 414
            T PP   PT         LPP    P      PPV    PP  PT P TP
Sbjct: 380 PTRPPTPPPTRASTPAPTYLPPTNKPPPPATTRPPVRTTRPPPPPTRPPTP 430

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 36/109 (33%), Positives = 41/109 (37%), Gaps = 13/109 (11%)
 Frame = +1

Query: 127 TCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIV------PPIVKPPVILPPVTVP-- 282
           T   P P    P+  P +P   P   PP   PP  V      PP  +PP   PP   P  
Sbjct: 668 TTRPPPPPTRPPTPPPTRPPTRPPTPPPTYLPPVTVRTTRPPPPPTRPPT-RPPTRPPTR 726

Query: 283 -----PVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                P  +PP   PP    T PP+    P  PP     PP T  PT P
Sbjct: 727 ATTPAPTYLPPTNKPPPPATTRPPVRTTRPPPPPTRPPTPPPTRPPTRP 775

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 36/94 (38%), Positives = 38/94 (40%)
 Frame = +1

Query: 127  TCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
            T   P P    P+  P +P   P   PP   PP  V     PP    P T PP T PP T
Sbjct: 753  TTRPPPPPTRPPTPPPTRPPTRPPTPPPTYLPPVTVRTTRPPPPPTRPPT-PPPTRPP-T 810

Query: 307  VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
             PP   PT PP    T  LPPV     P  P  T
Sbjct: 811  RPPTPPPTRPPTRPPTTYLPPVTRRTTPYVPVTT 844

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 43/119 (36%), Positives = 47/119 (39%), Gaps = 34/119 (28%)
 Frame = +1

Query: 160 PSKKPGKPVK-------PPGIVPPIVKPPGIVPPIVKPPVI-LPPVTVPPVTV------P 297
           P+ KP  PV        PP   PP  +PP   PP  +PP   LPP   PP  V      P
Sbjct: 217 PTNKPPPPVTTRVPPPPPPPRTPPPTRPP-TRPPTTRPPATYLPPTNKPPAPVTTRRPTP 275

Query: 298 PITVPPVVKPTLPPIPGVTPI---LPPV--------------PVLNPPS---TPTPTTP 414
           P T PP   PT PP    TP    LPP               P   PP+   TP PT P
Sbjct: 276 PPTRPPTRPPTPPPTRASTPAPTYLPPTNKPPPPATTRRPTPPPTRPPTRPPTPPPTRP 334

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 41/108 (37%), Positives = 47/108 (43%), Gaps = 12/108 (11%)
 Frame = +1

Query: 127 TCGKPVPKKHKPSKKPGKP------VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPV 288
           T  +P P   +P  +P  P         P  +PP  KPP   P   + P   PP T PP 
Sbjct: 269 TTRRPTPPPTRPPTRPPTPPPTRASTPAPTYLPPTNKPPP--PATTRRPT--PPPTRPPT 324

Query: 289 T--VPPITVPPVVKPTLPP--IPGVT--PILPPVPVLNPPSTPTPTTP 414
               PP T PP   PT PP  +P VT     PP P   PP TP PT P
Sbjct: 325 RPPTPPPTRPPTRPPTPPPTYLPPVTVRTTRPPPPPTRPP-TPPPTRP 371

[170][TOP]
>UniRef100_UPI0001925A99 PREDICTED: hypothetical protein, partial n=1 Tax=Hydra
           magnipapillata RepID=UPI0001925A99
          Length = 373

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/108 (35%), Positives = 43/108 (39%), Gaps = 2/108 (1%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT 276
           S AAP     +   P P    P+  P    KP    P  + PP   PP+  PP   P   
Sbjct: 195 SPAAPPSAAPSPAAPSPAAPPPAAPPPAAPKPTPPSPVALIPPAAPPPVTPPPAAPPSPA 254

Query: 277 VPPVTVPPITVPPVVKPTLPPIPGV--TPILPPVPVLNPPSTPTPTTP 414
           VPP    P T      P  PP P    TP  PP P   PP+ P P TP
Sbjct: 255 VPPTPAAPPTPAAPPTPAAPPTPAAPPTPAAPPPPAKPPPAKPPPATP 302

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 33/100 (33%), Positives = 44/100 (44%), Gaps = 9/100 (9%)
 Frame = +1

Query: 142 VPKKHKPSKKPGKPVK--PPGIVPPIVKPPGIVPP---IVKPPVILPPVTVPPVTVPPIT 306
           +P    PS     P+   PP   PP   PP +  P   ++  PV+ PP   PP  + P T
Sbjct: 20  LPSSVAPSLPAASPLATPPPAAPPPPAAPPPVTLPSPLVLSLPVVPPPAKPPPAALTPPT 79

Query: 307 VPPVV----KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP       P +PP P   P++ P P   PP+ P P  P
Sbjct: 80  APPSPAAPPSPAVPPSPAAPPLIEPPPATLPPAIPPPAAP 119

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 36/116 (31%), Positives = 44/116 (37%), Gaps = 23/116 (19%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPG-------IVPPIVKPP-GIVPPIVKPPVIL------PPV 273
           KP P    P   P  P  PP          PP+++PP   +PP + PP         PP 
Sbjct: 69  KPPPAALTPPTAPPSPAAPPSPAVPPSPAAPPLIEPPPATLPPAIPPPAAPCSLAAPPPA 128

Query: 274 TVPPVTV---------PPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           T+PP            PP   PP   P   P P   P   P P   P + P+PT P
Sbjct: 129 TLPPAAPSPAAPPPAPPPTVTPPAASPPAAPSPAAPPPAAPSPAAPPLAAPSPTAP 184

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 38/110 (34%), Positives = 43/110 (39%), Gaps = 6/110 (5%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKP----PGIVPPIVKPPGIVPPIVKPPVILPP 270
           AAP     +   P+P    P+  P     P    P   PP   PP    P    PV L P
Sbjct: 177 AAPSPTAPSPAAPLPAAPSPAAPPSAAPSPAAPSPAAPPPAAPPPAAPKPTPPSPVALIP 236

Query: 271 VTVPPVTVPPITVPPVVKPTLPPIPGV--TPILPPVPVLNPPSTPTPTTP 414
              PP   PP   PP   P +PP P    TP  PP P   PP+   P TP
Sbjct: 237 PAAPPPVTPPPAAPP--SPAVPPTPAAPPTPAAPPTPAA-PPTPAAPPTP 283

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 36/113 (31%), Positives = 47/113 (41%), Gaps = 6/113 (5%)
 Frame = +1

Query: 94  LSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPP--GIVPPIVKP-PVIL 264
           L +A+P+        P P    P   P   V    +VPP  KPP   + PP   P P   
Sbjct: 28  LPAASPLATPPPAAPPPPAAPPPVTLPSPLVLSLPVVPPPAKPPPAALTPPTAPPSPAAP 87

Query: 265 PPVTVPP-VTVPPITVPP--VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   VPP    PP+  PP   + P +PP      +  P P   PP+ P+P  P
Sbjct: 88  PSPAVPPSPAAPPLIEPPPATLPPAIPPPAAPCSLAAPPPATLPPAAPSPAAP 140

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 30/95 (31%), Positives = 34/95 (35%), Gaps = 10/95 (10%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVK------PPGIVPPIVK----PPVILPPVTVPPVTVPPITV 309
           P  +P     PP I PP         PP  +PP       PP   PP   PP   PP   
Sbjct: 100 PLIEPPPATLPPAIPPPAAPCSLAAPPPATLPPAAPSPAAPPPAPPPTVTPPAASPPAAP 159

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P   P P   P+  P P    P+ P P  P
Sbjct: 160 SPAAPPPAAPSPAAPPLAAPSPTAPSPAAPLPAAP 194

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 30/95 (31%), Positives = 34/95 (35%), Gaps = 10/95 (10%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPV----ILPPVTVPPVTVP------PITV 309
           PS     P  PP + PP   PP    P   PP       PP+  P  T P      P   
Sbjct: 135 PSPAAPPPAPPPTVTPPAASPPAAPSPAAPPPAAPSPAAPPLAAPSPTAPSPAAPLPAAP 194

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P+  P P       P P   PP+ P PT P
Sbjct: 195 SPAAPPSAAPSPAAPSPAAPPPAAPPPAAPKPTPP 229

[171][TOP]
>UniRef100_UPI000175F23A PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI000175F23A
          Length = 661

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 34/84 (40%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIV--PPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTL 333
           P + P  P  PP  V  PP+   P  +PP+   PV LPPV   PV +PP+   PV  P +
Sbjct: 457 PVQLPPLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPV 516

Query: 334 PPIPGVTPILPPVPVLNPPSTPTP 405
           PP P     +PP P   PP++P P
Sbjct: 517 PPAPAQLLPVPPAPAQLPPASPVP 540

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 35/90 (38%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PVP    P+     PV P P  +PP+   P  +PP+   PV LPPV   PV +PP+   P
Sbjct: 465 PVP----PAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAP 520

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
                +PP P   P   PVP   PP  P P
Sbjct: 521 AQLLPVPPAPAQLPPASPVPAQLPPVPPAP 550

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 33/90 (36%), Positives = 42/90 (46%), Gaps = 1/90 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PVP    P+     PV P P  +PP+   P  +PP+   PV LPPV   P  + P+   P
Sbjct: 475 PVP----PAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPAP 530

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              P   P+P   P +PP P   PP  P P
Sbjct: 531 AQLPPASPVPAQLPPVPPAPAQLPPVPPAP 560

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 33/90 (36%), Positives = 42/90 (46%), Gaps = 1/90 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PVP    P+     PV P P  +PP+   P  +PP+   P  L PV   P  +PP +  P
Sbjct: 485 PVP----PAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPAPAQLPPASPVP 540

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              P +PP P   P +PP P   PP  P P
Sbjct: 541 AQLPPVPPAPAQLPPVPPAPAQLPPVPPAP 570

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 32/78 (41%), Positives = 40/78 (51%)
 Frame = +1

Query: 181 PVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPI 360
           PV+ P + PP+   P  +PP+   PV LPPV   PV +PP+   PV    LPP+P     
Sbjct: 457 PVQLPPL-PPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPV---QLPPVPPAPVQ 512

Query: 361 LPPVPVLNPPSTPTPTTP 414
           LPPVP       P P  P
Sbjct: 513 LPPVPPAPAQLLPVPPAP 530

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 30/84 (35%), Positives = 40/84 (47%), Gaps = 1/84 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PVP    P+     PV P P  +PP+   P  + P+   P  LPP +  P  +PP+   P
Sbjct: 495 PVP----PAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPAPAQLPPASPVPAQLPPVPPAP 550

Query: 316 VVKPTLPPIPGVTPILPPVPVLNP 387
              P +PP P   P +PP PV  P
Sbjct: 551 AQLPPVPPAPAQLPPVPPAPVQLP 574

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 33/96 (34%), Positives = 39/96 (40%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P      P +PP   P   +PP   P   +PPV  P    PPV+ P    PPV  
Sbjct: 200 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 259

Query: 325 PT--LPPIPGVTPILPPV----PVLNPPSTPTPTTP 414
           P    PP+    P  PPV    P   P S P P  P
Sbjct: 260 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERP 295

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 33/96 (34%), Positives = 39/96 (40%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P      P +PP   P   +PP   P   +PPV  P    PPV+ P    PPV  
Sbjct: 210 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 269

Query: 325 PT--LPPIPGVTPILPPV----PVLNPPSTPTPTTP 414
           P    PP+    P  PPV    P   P S P P  P
Sbjct: 270 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERP 305

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 33/96 (34%), Positives = 39/96 (40%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P      P +PP   P   +PP   P   +PPV  P    PPV+ P    PPV  
Sbjct: 220 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 279

Query: 325 PT--LPPIPGVTPILPPV----PVLNPPSTPTPTTP 414
           P    PP+    P  PPV    P   P S P P  P
Sbjct: 280 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERP 315

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 33/96 (34%), Positives = 39/96 (40%), Gaps = 6/96 (6%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P   +P      P +PP   P   +PP   P   +PPV  P    PPV+ P    PPV  
Sbjct: 230 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 289

Query: 325 PT--LPPIPGVTPILPPV----PVLNPPSTPTPTTP 414
           P    PP+    P  PPV    P   P S P P  P
Sbjct: 290 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERP 325

[172][TOP]
>UniRef100_Q9M7P1 Proline-rich protein 1 n=1 Tax=Arabidopsis thaliana
           RepID=Q9M7P1_ARATH
          Length = 335

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/91 (41%), Positives = 46/91 (50%), Gaps = 3/91 (3%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP+  P  PV  P +  P + PP    P + PP   PPV   P    P+  PPV K
Sbjct: 49  PPVHKPTLPP--PVYTPPVHKPTLSPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVYK 106

Query: 325 PTL-PPIPGVTPILPPV--PVLNPPSTPTPT 408
           PTL PP+     +LPPV  P L+PP    PT
Sbjct: 107 PTLSPPVYTKPTLLPPVFKPTLSPPVYTKPT 137

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 37/95 (38%), Positives = 47/95 (49%), Gaps = 7/95 (7%)
 Frame = +1

Query: 145 PKKHKPSKKPG---KP-VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P  HKP+  P    KP + PP   PP+   P +  P+  PPV  P ++ PPV   P  +P
Sbjct: 63  PPVHKPTLSPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVYKPTLS-PPVYTKPTLLP 121

Query: 313 PVVKPTLPPIPGVTPILPPV---PVLNPPSTPTPT 408
           PV KPTL P     P L P    P L+PP    P+
Sbjct: 122 PVFKPTLSPPVYTKPTLSPTVYKPTLSPPVNNKPS 156

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 40/117 (34%), Positives = 52/117 (44%), Gaps = 16/117 (13%)
 Frame = +1

Query: 109 PILGCGTCGKPV--PKKHKPSKKPGKPVKPPGIVPPIVKP-------------PGIVPPI 243
           P+    T   PV  P  +KP+  P    KP  ++PP+ KP             P +  P 
Sbjct: 88  PVYNKPTLPAPVYTPPVYKPTLSPPVYTKPT-LLPPVFKPTLSPPVYTKPTLSPTVYKPT 146

Query: 244 VKPPVILPPVTVPPVTVPPITVPPVVKPTL-PPIPGVTPILPPVPVLNPPSTPTPTT 411
           + PPV   P   PPV  P ++ P   KPTL PP+   +PI  P P   P  T TP T
Sbjct: 147 LSPPVNNKPSLSPPVYKPTLSPPVYTKPTLPPPVYKKSPIYSPPPPFAPKPTYTPPT 203

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 34/79 (43%), Positives = 40/79 (50%), Gaps = 4/79 (5%)
 Frame = +1

Query: 181 PVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPI 360
           P  PP    P+ KP  + PP+  PPV  P  T+PP    P+  PPV KPTL P     P 
Sbjct: 27  PSSPPVYTSPVNKPT-LPPPVYTPPVHKP--TLPP----PVYTPPVHKPTLSPPVYTKPT 79

Query: 361 LPP----VPVLNPPSTPTP 405
           LPP     PV N P+ P P
Sbjct: 80  LPPPAYTPPVYNKPTLPAP 98

[173][TOP]
>UniRef100_Q9LZJ7 Proline-rich protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9LZJ7_ARATH
          Length = 313

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 41/99 (41%), Positives = 46/99 (46%), Gaps = 7/99 (7%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI----LPPVTVPPVTVPPIT 306
           P  K   PS     PV  P + PP+   P I PP+  PPV      PPV   P   PP+ 
Sbjct: 36  PEHKPTLPSPVYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVY 95

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPP---STPTPTTP 414
            PPV KPTL P     P +PP PV  PP    TP  T P
Sbjct: 96  TPPVYKPTLSPPVYTKPTIPP-PVYTPPVYKPTPVYTKP 133

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/91 (38%), Positives = 44/91 (48%), Gaps = 4/91 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIV----PPIVKPPVILPPVTVPPVTVPPITVP 312
           P  +KP+  P    KP  I PP+  PP       PP+   P I PPV  PPV  P ++ P
Sbjct: 49  PPVYKPTLSPPVYTKPT-IPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTLSPP 107

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              KPT+PP     P+  P PV   P+ P P
Sbjct: 108 VYTKPTIPPPVYTPPVYKPTPVYTKPTIPPP 138

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 36/81 (44%), Positives = 43/81 (53%), Gaps = 4/81 (4%)
 Frame = +1

Query: 181 PVKPPGIVPPIVKPPGIVPPIVKPPVILP-PVTVPPVTVPPITVPPVVKPT-LPPIPGVT 354
           PV  P + PP+   P I PP+  PPV  P PV   P   PP+  PPV KPT  PP+   +
Sbjct: 98  PVYKPTLSPPVYTKPTIPPPVYTPPVYKPTPVYTKPTIPPPVYTPPVYKPTPSPPVYKKS 157

Query: 355 PIL--PPVPVLNPPSTPTPTT 411
           P    PP P + P  T TPTT
Sbjct: 158 PSYSSPPPPYV-PKPTYTPTT 177

[174][TOP]
>UniRef100_Q9FZ35 Proline-rich protein 1 n=1 Tax=Arabidopsis thaliana
           RepID=Q9FZ35_ARATH
          Length = 335

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/91 (41%), Positives = 46/91 (50%), Gaps = 3/91 (3%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  HKP+  P  PV  P +  P + PP    P + PP   PPV   P    P+  PPV K
Sbjct: 49  PPVHKPTLPP--PVYTPPVHKPTLSPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVYK 106

Query: 325 PTL-PPIPGVTPILPPV--PVLNPPSTPTPT 408
           PTL PP+     +LPPV  P L+PP    PT
Sbjct: 107 PTLSPPVYTKPTLLPPVFKPTLSPPVYTKPT 137

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 37/95 (38%), Positives = 47/95 (49%), Gaps = 7/95 (7%)
 Frame = +1

Query: 145 PKKHKPSKKPG---KP-VKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P  HKP+  P    KP + PP   PP+   P +  P+  PPV  P ++ PPV   P  +P
Sbjct: 63  PPVHKPTLSPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVYKPTLS-PPVYTKPTLLP 121

Query: 313 PVVKPTLPPIPGVTPILPPV---PVLNPPSTPTPT 408
           PV KPTL P     P L P    P L+PP    P+
Sbjct: 122 PVFKPTLSPPVYTKPTLSPTVYKPTLSPPVNNKPS 156

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 34/79 (43%), Positives = 40/79 (50%), Gaps = 4/79 (5%)
 Frame = +1

Query: 181 PVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPI 360
           P  PP    P+ KP  + PP+  PPV  P  T+PP    P+  PPV KPTL P     P 
Sbjct: 27  PSSPPVYTSPVNKPT-LPPPVYTPPVHKP--TLPP----PVYTPPVHKPTLSPPVYTKPT 79

Query: 361 LPP----VPVLNPPSTPTP 405
           LPP     PV N P+ P P
Sbjct: 80  LPPPAYTPPVYNKPTLPAP 98

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 39/117 (33%), Positives = 51/117 (43%), Gaps = 16/117 (13%)
 Frame = +1

Query: 109 PILGCGTCGKPV--PKKHKPSKKPGKPVKPPGIVPPIVKP-------------PGIVPPI 243
           P+    T   PV  P  +KP+  P    KP  ++PP+ KP             P +  P 
Sbjct: 88  PVYNKPTLPAPVYTPPVYKPTLSPPVYTKPT-LLPPVFKPTLSPPVYTKPTLSPTVYKPT 146

Query: 244 VKPPVILPPVTVPPVTVPPITVPPVVKPTL-PPIPGVTPILPPVPVLNPPSTPTPTT 411
           + PPV   P   PPV  P ++ P   KPTL PP+   +P   P P   P  T TP T
Sbjct: 147 LSPPVNNKPSLSPPVYKPTLSPPVYTKPTLPPPVYKKSPSYSPPPPFAPKPTYTPPT 203

[175][TOP]
>UniRef100_B9FXX1 Putative uncharacterized protein n=1 Tax=Oryza sativa Japonica
           Group RepID=B9FXX1_ORYSJ
          Length = 309

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 45/115 (39%), Positives = 53/115 (46%), Gaps = 6/115 (5%)
 Frame = +1

Query: 88  LFLSSAAPILGCGTCGKPVPKKHKPSKKP-GKPVKPPGIVPPIVKPPGIVPPIVKPPVIL 264
           +F      ILG    GK  P    P   P   P KPP I+ P  KPP  + P  KPP+  
Sbjct: 11  MFFMIVLLILGSTVLGKEPPN---PCLAPVPTPAKPPSIITP-AKPPSTIAP-TKPPIKS 65

Query: 265 PPVTVPPVTVPPITVPPVVKPTLPPI---PGVTPILPPVPVL--NPPSTPTPTTP 414
           PP   P   +PP T+ P   PT PP+   P   P  PP P+    PPST TP  P
Sbjct: 66  PPTIGP--AIPPSTIAPAKPPTKPPLTITPAKPPTKPPPPIAPAKPPSTITPAKP 118

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/89 (40%), Positives = 45/89 (50%), Gaps = 5/89 (5%)
 Frame = +1

Query: 157 KPSKKPGKPV---KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKP 327
           KP  KP  P+   KPP  + P  KPP  + P  KPP+  PP   P   +PP T+ P   P
Sbjct: 95  KPPTKPPPPIAPAKPPSTITP-AKPPSTIAP-TKPPIKSPPTIAP--AIPPSTIAPAKPP 150

Query: 328 TLPPIPGVTPILPP--VPVLNPPSTPTPT 408
           T PP P + P  PP  +    PP+ P PT
Sbjct: 151 TKPP-PTIAPAKPPSTIAPAKPPTKPPPT 178

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 41/97 (42%), Positives = 46/97 (47%), Gaps = 7/97 (7%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP--PVTVPPITVPPV 318
           P    P+K P KP  PP I P   KPP  + P  KPP   PP   P  P T PP T+ P 
Sbjct: 141 PSTIAPAKPPTKP--PPTIAP--AKPPSTIAP-AKPPTKPPPTIAPAKPPTKPPPTIAPA 195

Query: 319 VKPTLPPIPGVTPILPP----VPVLNPPS-TPTPTTP 414
            KP   P P +TP  PP     P +NPP   P P  P
Sbjct: 196 -KPPTKPSPTITPASPPPSSLPPSVNPPKPKPLPKCP 231

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 48/150 (32%), Positives = 63/150 (42%), Gaps = 38/150 (25%)
 Frame = +1

Query: 73  LFLCMLFLSSAAPILGC---GTCGKPVPKKHKPSKKPG--KPVKPPGIV----PPIVKPP 225
           +F  ++ L   + +LG      C  PVP    P+K P    P KPP  +    PPI  PP
Sbjct: 11  MFFMIVLLILGSTVLGKEPPNPCLAPVPT---PAKPPSIITPAKPPSTIAPTKPPIKSPP 67

Query: 226 GIVPPI-------VKPPVILPPVTV-----------------PPVTVPPITVPPVVKPTL 333
            I P I        KPP   PP+T+                 PP T+ P   P  + PT 
Sbjct: 68  TIGPAIPPSTIAPAKPPT-KPPLTITPAKPPTKPPPPIAPAKPPSTITPAKPPSTIAPTK 126

Query: 334 PPI---PGVTPILPP--VPVLNPPSTPTPT 408
           PPI   P + P +PP  +    PP+ P PT
Sbjct: 127 PPIKSPPTIAPAIPPSTIAPAKPPTKPPPT 156

[176][TOP]
>UniRef100_UPI0001982D5B PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
            RepID=UPI0001982D5B
          Length = 1269

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 41/114 (35%), Positives = 47/114 (41%), Gaps = 5/114 (4%)
 Frame = +1

Query: 88   LFLSSAAPILGCGTCGKPVPKKHKP----SKKPGKPVKPPGIVPPIVKPPGIVPPIVKPP 255
            +F SS++      + G P P    P    + KP     PP   PP  KPPG  PP   PP
Sbjct: 672  MFSSSSSTSRSSSSHGVPPPHPPPPPPSLAPKPPSAPPPPPPPPPAPKPPGAPPPPPPPP 731

Query: 256  VILPPVTVPPVTVPPITVPPVVKPT-LPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                P+   P   PP   PP  KP   PP P   P  PP P   PP  P P  P
Sbjct: 732  PTTKPLGAHPPPPPPPPPPPAPKPPGAPPPPPKPPSAPPPPPPKPPGAPPPPPP 785

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 35/89 (39%), Positives = 36/89 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P+ KP     PP   PP  KP G  PP   PP   PP   PP   PP   PP 
Sbjct: 709 PPPPPPPPAPKPPGAPPPPPPPPPTTKPLGAHPP-PPPPPPPPPAPKPPGAPPPPPKPPS 767

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
             P  PP P   P  PP P    P  P P
Sbjct: 768 APPPPPPKP---PGAPPPPPPKLPGAPAP 793

[177][TOP]
>UniRef100_UPI0000F20739 PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI0000F20739
          Length = 511

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 36/90 (40%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PVP    P++ P  PV P P  +PP+   P  +PP+   P  LPPV   P  +PP+   P
Sbjct: 340 PVPPA--PAQLP--PVPPAPAQLPPVPPAPAQLPPVPPAPAQLPPVPPAPAQLPPVPPAP 395

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              P +PP P   P +PP PV  PP  P P
Sbjct: 396 AQLPPVPPAPVQLPPVPPAPVQLPPVPPAP 425

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 34/100 (34%), Positives = 46/100 (46%), Gaps = 11/100 (11%)
 Frame = +1

Query: 139 PVPKK----HKPSKKPGKPVKPPGI-------VPPIVKPPGIVPPIVKPPVILPPVTVPP 285
           PVP +      PS++   P  P G+       +PP+   P  +PP+   P  LPPV   P
Sbjct: 306 PVPARLLALPTPSRRLALPAPPRGLALPAPVQLPPVPPAPAQLPPVPPAPAQLPPVPPAP 365

Query: 286 VTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
             +PP+   P   P +PP P   P +PP P   PP  P P
Sbjct: 366 AQLPPVPPAPAQLPPVPPAPAQLPPVPPAPAQLPPVPPAP 405

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/84 (40%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PVP    P++ P  PV P P  +PP+   P  +PP+   P  LPPV   P  +PP+   P
Sbjct: 350 PVPPA--PAQLP--PVPPAPAQLPPVPPAPAQLPPVPPAPAQLPPVPPAPAQLPPVPPAP 405

Query: 316 VVKPTLPPIPGVTPILPPVPVLNP 387
           V  P +PP P   P +PP PV  P
Sbjct: 406 VQLPPVPPAPVQLPPVPPAPVQLP 429

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 31/76 (40%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP-PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           PVP    P++ P  PV P P  +PP+   P  +PP+   P  LPPV   PV +PP+   P
Sbjct: 360 PVPPA--PAQLP--PVPPAPAQLPPVPPAPAQLPPVPPAPAQLPPVPPAPVQLPPVPPAP 415

Query: 316 VVKPTLPPIPGVTPIL 363
           V  P +PP P   P+L
Sbjct: 416 VQLPPVPPAPVQLPLL 431

[178][TOP]
>UniRef100_UPI0000E1257F Os05g0516400 n=1 Tax=Oryza sativa Japonica Group
           RepID=UPI0000E1257F
          Length = 827

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 41/107 (38%), Positives = 54/107 (50%), Gaps = 3/107 (2%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSK--KPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT 276
           A P+    T   P P    PSK  KP  P  PP   PP+++PP   PP++ PP   PP  
Sbjct: 60  APPVAPRPTPSPPPPPPVMPSKPVKPVPPSSPPP--PPVMQPPSPSPPLIPPPP--PPTP 115

Query: 277 VPPVTVPPITVPPVVKPTLP-PIPGVTPILPPVPVLNPPSTPTPTTP 414
           V PV  P  + P  V P  P P P  +P+ P  P+ +PPS  +P +P
Sbjct: 116 VMPVLPPTPSPPSPVNPPPPSPSPPPSPVNPLPPITSPPSPVSPPSP 162

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 37/103 (35%), Positives = 45/103 (43%), Gaps = 10/103 (9%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV----------PP 285
           +P P    PS     P  PP   PP+   P   PP   PP ++P   V          PP
Sbjct: 40  RPPPAAPPPSPPAASPPPPPA--PPVAPRPTPSPP--PPPPVMPSKPVKPVPPSSPPPPP 95

Query: 286 VTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           V  PP   PP++ P  PP P V P+LPP P    P  P P +P
Sbjct: 96  VMQPPSPSPPLIPPPPPPTP-VMPVLPPTPSPPSPVNPPPPSP 137

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 34/92 (36%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS+ P  P  PP   P    PP   PP+   P   PP   PP  +P   V PV
Sbjct: 31  PPPPPVMPSRPP--PAAPPPSPPAASPPPPPAPPVAPRPTPSPPP--PPPVMPSKPVKPV 86

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              + PP P + P  P  P++ PP  PTP  P
Sbjct: 87  PPSSPPPPPVMQPPSPSPPLIPPPPPPTPVMP 118

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 34/97 (35%), Positives = 41/97 (42%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P        P  P  PP ++P   +PP   PP   P    PP   PPV   P   PP 
Sbjct: 16  PAPPLPPSLGAPDPPPPPPPVMPS--RPPPAAPPPSPPAASPPPPPAPPVAPRPTPSPPP 73

Query: 319 VKPTLP-----PIPGVTPILPPVPVLNPPSTPTPTTP 414
             P +P     P+P  +P  PP PV+ PPS   P  P
Sbjct: 74  PPPVMPSKPVKPVPPSSP--PPPPVMQPPSPSPPLIP 108

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 36/104 (34%), Positives = 40/104 (38%), Gaps = 15/104 (14%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV--------PPVTV 294
           P    + P   P  P  P   +PPI  PP  V P   P   LPP T         PP T 
Sbjct: 126 PPSPVNPPPPSPSPPPSPVNPLPPITSPPSPVSP-PSPANPLPPATSPPSPANPLPPATS 184

Query: 295 PPITVPPVVKPTLPPIPGVTPILP-------PVPVLNPPSTPTP 405
           PP    P+   T PP P   P +P       P P   PP TP P
Sbjct: 185 PPSPANPLPPTTSPPSPAPPPTVPSQPPEAAPAPTTKPPPTPLP 228

 Score = 53.5 bits (127), Expect(2) = 1e-06
 Identities = 34/93 (36%), Positives = 39/93 (41%), Gaps = 9/93 (9%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGI---VPPIVKPPGI---VPPIVKPPVI---LPPVTVPPVTVPPITVP 312
           P   P  PV PP     +PP   PP     +PP   PP     LPP T PP   PP TVP
Sbjct: 149 PITSPPSPVSPPSPANPLPPATSPPSPANPLPPATSPPSPANPLPPTTSPPSPAPPPTVP 208

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
               P   P P   P   P+P    P  P+P +
Sbjct: 209 S-QPPEAAPAPTTKPPPTPLPPARSPPAPSPAS 240

 Score = 22.3 bits (46), Expect(2) = 1e-06
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +2

Query: 101 LPPPFSVAAPAVSPSQRNTSPAKSPASP 184
           LPP  S  +P V+P   + SP  SP +P
Sbjct: 120 LPPTPSPPSP-VNPPPPSPSPPPSPVNP 146

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 44/129 (34%), Positives = 54/129 (41%), Gaps = 36/129 (27%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPV-KPPGIVPPIVKPPG-------IVPPIVKPPVI---------- 261
           KPVP    PS  P  PV +PP   PP++ PP        ++PP   PP            
Sbjct: 84  KPVP----PSSPPPPPVMQPPSPSPPLIPPPPPPTPVMPVLPPTPSPPSPVNPPPPSPSP 139

Query: 262 -------LPPVTVPPVTVPPIT----VPPVVKPTLP--PIPGVT----PILPPVPVLNPP 390
                  LPP+T PP  V P +    +PP   P  P  P+P  T    P  P  P  +PP
Sbjct: 140 PPSPVNPLPPITSPPSPVSPPSPANPLPPATSPPSPANPLPPATSPPSPANPLPPTTSPP 199

Query: 391 S-TPTPTTP 414
           S  P PT P
Sbjct: 200 SPAPPPTVP 208

[179][TOP]
>UniRef100_Q9M7N9 Proline-rich protein 3 n=1 Tax=Arabidopsis thaliana
           RepID=Q9M7N9_ARATH
          Length = 313

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 40/94 (42%), Positives = 45/94 (47%), Gaps = 5/94 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI----LPPVTVPPVTVPPIT 306
           P  K   PS     PV  P + PP+   P I PP+  PPV      PPV   P   PP+ 
Sbjct: 36  PEHKPTLPSPVYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVY 95

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPP-STPTP 405
            PPV KPTL P     P +PP PV  PP   PTP
Sbjct: 96  TPPVYKPTLSPPVYTKPTIPP-PVYTPPVYKPTP 128

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 34/91 (37%), Positives = 43/91 (47%), Gaps = 4/91 (4%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIV----PPIVKPPVILPPVTVPPVTVPPITVP 312
           P  +KP+  P    KP  I PP+  PP       PP+   P I PPV  PPV  P ++ P
Sbjct: 49  PPVYKPTLSPPVYTKPT-IPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTLSPP 107

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
              KPT+PP     P+  P P    P+ P P
Sbjct: 108 VYTKPTIPPPVYTPPVYKPTPDYTKPTIPPP 138

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 39/98 (39%), Positives = 47/98 (47%), Gaps = 9/98 (9%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP------PVTVPPIT 306
           P   KP+  P  PV  P +  P + PP    P + PPV  PPV  P      P   PP+ 
Sbjct: 83  PVYTKPTIPP--PVYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKPTPDYTKPTIPPPVY 140

Query: 307 VPPVVKPT-LPPIPGVTPIL--PPVPVLNPPSTPTPTT 411
            PPV KPT  PP+   +P    PP P + P  T TPTT
Sbjct: 141 TPPVYKPTPSPPVYKKSPSYSSPPPPYV-PKPTYTPTT 177

[180][TOP]
>UniRef100_C7J265 Os05g0516400 protein (Fragment) n=1 Tax=Oryza sativa Japonica Group
           RepID=C7J265_ORYSJ
          Length = 868

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 41/107 (38%), Positives = 54/107 (50%), Gaps = 3/107 (2%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSK--KPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT 276
           A P+    T   P P    PSK  KP  P  PP   PP+++PP   PP++ PP   PP  
Sbjct: 101 APPVAPRPTPSPPPPPPVMPSKPVKPVPPSSPPP--PPVMQPPSPSPPLIPPPP--PPTP 156

Query: 277 VPPVTVPPITVPPVVKPTLP-PIPGVTPILPPVPVLNPPSTPTPTTP 414
           V PV  P  + P  V P  P P P  +P+ P  P+ +PPS  +P +P
Sbjct: 157 VMPVLPPTPSPPSPVNPPPPSPSPPPSPVNPLPPITSPPSPVSPPSP 203

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 37/103 (35%), Positives = 45/103 (43%), Gaps = 10/103 (9%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV----------PP 285
           +P P    PS     P  PP   PP+   P   PP   PP ++P   V          PP
Sbjct: 81  RPPPAAPPPSPPAASPPPPPA--PPVAPRPTPSPP--PPPPVMPSKPVKPVPPSSPPPPP 136

Query: 286 VTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           V  PP   PP++ P  PP P V P+LPP P    P  P P +P
Sbjct: 137 VMQPPSPSPPLIPPPPPPTP-VMPVLPPTPSPPSPVNPPPPSP 178

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 34/92 (36%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS+ P  P  PP   P    PP   PP+   P   PP   PP  +P   V PV
Sbjct: 72  PPPPPVMPSRPP--PAAPPPSPPAASPPPPPAPPVAPRPTPSPPP--PPPVMPSKPVKPV 127

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              + PP P + P  P  P++ PP  PTP  P
Sbjct: 128 PPSSPPPPPVMQPPSPSPPLIPPPPPPTPVMP 159

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 34/97 (35%), Positives = 41/97 (42%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P        P  P  PP ++P   +PP   PP   P    PP   PPV   P   PP 
Sbjct: 57  PAPPLPPSLGAPDPPPPPPPVMPS--RPPPAAPPPSPPAASPPPPPAPPVAPRPTPSPPP 114

Query: 319 VKPTLP-----PIPGVTPILPPVPVLNPPSTPTPTTP 414
             P +P     P+P  +P  PP PV+ PPS   P  P
Sbjct: 115 PPPVMPSKPVKPVPPSSP--PPPPVMQPPSPSPPLIP 149

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 36/104 (34%), Positives = 40/104 (38%), Gaps = 15/104 (14%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV--------PPVTV 294
           P    + P   P  P  P   +PPI  PP  V P   P   LPP T         PP T 
Sbjct: 167 PPSPVNPPPPSPSPPPSPVNPLPPITSPPSPVSP-PSPANPLPPATSPPSPANPLPPATS 225

Query: 295 PPITVPPVVKPTLPPIPGVTPILP-------PVPVLNPPSTPTP 405
           PP    P+   T PP P   P +P       P P   PP TP P
Sbjct: 226 PPSPANPLPPTTSPPSPAPPPTVPSQPPEAAPAPTTKPPPTPLP 269

 Score = 53.5 bits (127), Expect(2) = 1e-06
 Identities = 34/93 (36%), Positives = 39/93 (41%), Gaps = 9/93 (9%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGI---VPPIVKPPGI---VPPIVKPPVI---LPPVTVPPVTVPPITVP 312
           P   P  PV PP     +PP   PP     +PP   PP     LPP T PP   PP TVP
Sbjct: 190 PITSPPSPVSPPSPANPLPPATSPPSPANPLPPATSPPSPANPLPPTTSPPSPAPPPTVP 249

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
               P   P P   P   P+P    P  P+P +
Sbjct: 250 S-QPPEAAPAPTTKPPPTPLPPARSPPAPSPAS 281

 Score = 22.3 bits (46), Expect(2) = 1e-06
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +2

Query: 101 LPPPFSVAAPAVSPSQRNTSPAKSPASP 184
           LPP  S  +P V+P   + SP  SP +P
Sbjct: 161 LPPTPSPPSP-VNPPPPSPSPPPSPVNP 187

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 44/129 (34%), Positives = 54/129 (41%), Gaps = 36/129 (27%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPV-KPPGIVPPIVKPPG-------IVPPIVKPPVI---------- 261
           KPVP    PS  P  PV +PP   PP++ PP        ++PP   PP            
Sbjct: 125 KPVP----PSSPPPPPVMQPPSPSPPLIPPPPPPTPVMPVLPPTPSPPSPVNPPPPSPSP 180

Query: 262 -------LPPVTVPPVTVPPIT----VPPVVKPTLP--PIPGVT----PILPPVPVLNPP 390
                  LPP+T PP  V P +    +PP   P  P  P+P  T    P  P  P  +PP
Sbjct: 181 PPSPVNPLPPITSPPSPVSPPSPANPLPPATSPPSPANPLPPATSPPSPANPLPPTTSPP 240

Query: 391 S-TPTPTTP 414
           S  P PT P
Sbjct: 241 SPAPPPTVP 249

[181][TOP]
>UniRef100_C6T318 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6T318_SOYBN
          Length = 191

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 40/84 (47%), Positives = 45/84 (53%), Gaps = 3/84 (3%)
 Frame = +1

Query: 172 PGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGV 351
           P  PVK P   PP+  P    PP    PV  P V  PPV VPP    PVVKP  P +P  
Sbjct: 33  PAPPVKAPTPAPPVKSPS--YPP---GPVTTPTVPTPPVKVPPPPQSPVVKPPTPTVPPP 87

Query: 352 TPILPP---VPVLNPPSTPTPTTP 414
           T  +PP    PV+ PP TPTPT+P
Sbjct: 88  TVKVPPPPQSPVVKPP-TPTPTSP 110

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 37/89 (41%), Positives = 42/89 (47%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  PG    P    PP+  PP    P+VKPP   P V  P V VPP    PV
Sbjct: 42  PAPPVKSPSYPPGPVTTPTVPTPPVKVPPPPQSPVVKPPT--PTVPPPTVKVPPPPQSPV 99

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           VKP  P     +P++ P PV   PS P P
Sbjct: 100 VKPPTP--TPTSPVVYPPPV--APSPPAP 124

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 38/97 (39%), Positives = 43/97 (44%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVP-PIVKPPGIVPPIVKPPVILPPVTVPPV-TVPPITV- 309
           P P     +  P  PVK P   P P+  P    PP+  PP    PV  PP  TVPP TV 
Sbjct: 31  PAPAPPVKAPTPAPPVKSPSYPPGPVTTPTVPTPPVKVPPPPQSPVVKPPTPTVPPPTVK 90

Query: 310 --PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP   P + P P  TP  P   V  PP  P+P  P
Sbjct: 91  VPPPPQSPVVKP-PTPTPTSP--VVYPPPVAPSPPAP 124

[182][TOP]
>UniRef100_A8N4C9 Putative uncharacterized protein n=1 Tax=Coprinopsis cinerea
           okayama7#130 RepID=A8N4C9_COPC7
          Length = 432

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 44/110 (40%), Positives = 50/110 (45%), Gaps = 11/110 (10%)
 Frame = +1

Query: 109 PILGCGTC---GKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKP-PVILPPVT 276
           P +G G     G P P    P   P  P   PG VPP + PPG  PP   P P   PP  
Sbjct: 183 PPVGMGVTPPPGVPPPGFAPPGFAPPFPPPFPGAVPPGMPPPGFQPPFPPPVPGQAPPFP 242

Query: 277 VPPVTVPP--ITVPPVVKPTLPPIPGVTPILPP-----VPVLNPPSTPTP 405
            PP  VPP  ++ PP V+P  PP  GV P +PP      P   PP  P P
Sbjct: 243 PPPGVVPPPGVSPPPGVRPPFPP--GVPPFMPPPGMPGAPPFLPPGVPPP 290

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 43/122 (35%), Positives = 49/122 (40%), Gaps = 16/122 (13%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVPKKHKPSKKPGKPV-----KPPGIVPPIVKPPGIVPPIVKP-PV 258
           ++AA + G    G P      P      PV      PPG+ PP   PPG  PP   P P 
Sbjct: 156 AAAAGVPGQAVYGAPAQAYSVPPPGVTPPVGMGVTPPPGVPPPGFAPPGFAPPFPPPFPG 215

Query: 259 ILPPVTVPPVTVPPITVP-PVVKPTLPPIPGVTP---------ILPPVPVLNPPSTPTPT 408
            +PP   PP   PP   P P   P  PP PGV P         + PP P   PP  P P 
Sbjct: 216 AVPPGMPPPGFQPPFPPPVPGQAPPFPPPPGVVPPPGVSPPPGVRPPFPPGVPPFMPPPG 275

Query: 409 TP 414
            P
Sbjct: 276 MP 277

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 41/93 (44%), Positives = 45/93 (48%), Gaps = 4/93 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKP-PGIVPPIVKPP-VILPPVTVPPVTVPPITVP 312
           P P     +  PG P  PPG  PP   P PG  PP   PP V+ PP   PP  V P   P
Sbjct: 208 PFPPPFPGAVPPGMP--PPGFQPPFPPPVPGQAPPFPPPPGVVPPPGVSPPPGVRP-PFP 264

Query: 313 PVVKPTLPP--IPGVTPILPPVPVLNPPSTPTP 405
           P V P +PP  +PG  P LPP  V  PP  P P
Sbjct: 265 PGVPPFMPPPGMPGAPPFLPP-GVPPPPGMPLP 296

[183][TOP]
>UniRef100_Q6CW84 KLLA0B06039p n=1 Tax=Kluyveromyces lactis RepID=Q6CW84_KLULA
          Length = 589

 Score = 62.4 bits (150), Expect(2) = 1e-09
 Identities = 34/85 (40%), Positives = 38/85 (44%), Gaps = 3/85 (3%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPP-GIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLP 336
           P   P  P  PP  VPP   PP  + PP +  P   PP   PP   PP + PP   P  P
Sbjct: 209 PVTLPPAPPAPPIAVPPAPAPPVPLAPPTISTPPAAPPA--PPTPAPPTSAPPAPAPPAP 266

Query: 337 PIPGVTPILPPVP--VLNPPSTPTP 405
           PI    P  PP P  +  P STP P
Sbjct: 267 PIISTPPAAPPAPPSISFPTSTPQP 291

 Score = 23.9 bits (50), Expect(2) = 1e-09
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 3/47 (6%)
 Frame = +2

Query: 53  PQRSMLTSS---SACSSSPLPPPFSVAAPAVSPSQRNTSPAKSPASP 184
           PQR     S   S+ ++ P PPP  +AAPA+  S        +P  P
Sbjct: 144 PQRKKTLRSEGDSSVAAPPAPPP--MAAPAIPTSPPPVPMMNTPPVP 188

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 37/111 (33%), Positives = 48/111 (43%), Gaps = 7/111 (6%)
 Frame = +1

Query: 103 AAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI-LPPVTV 279
           AAP +   T   PVP  + P      P +     PP+   P   PP+  PP    PP+ V
Sbjct: 168 AAPAIP--TSPPPVPMMNTPPVPKHPPARQRTEAPPVQAQPA--PPVTLPPAPPAPPIAV 223

Query: 280 PPVTVPPITV-PPVVK-----PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   PP+ + PP +      P  PP P      PP P   PP+ P  +TP
Sbjct: 224 PPAPAPPVPLAPPTISTPPAAPPAPPTPAPPTSAPPAPA--PPAPPIISTP 272

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 37/107 (34%), Positives = 44/107 (41%), Gaps = 10/107 (9%)
 Frame = +1

Query: 124 GTCGKPVPKKHKPSKKPGKPVKPPGI----VPPIVKPPGI-----VPPIVKPPVILPPVT 276
           G      P    P   P  P  PP +     PP+ K P        PP+   P   PPVT
Sbjct: 154 GDSSVAAPPAPPPMAAPAIPTSPPPVPMMNTPPVPKHPPARQRTEAPPVQAQPA--PPVT 211

Query: 277 VPPVT-VPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           +PP    PPI VPP      PP+P   P +   P   PP+ PTP  P
Sbjct: 212 LPPAPPAPPIAVPPA---PAPPVPLAPPTISTPPAA-PPAPPTPAPP 254

[184][TOP]
>UniRef100_UPI00015B4CAB PREDICTED: hypothetical protein n=1 Tax=Nasonia vitripennis
            RepID=UPI00015B4CAB
          Length = 972

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 40/92 (43%), Positives = 45/92 (48%), Gaps = 2/92 (2%)
 Frame = +1

Query: 139  PVPKKHKPSKKPGKPVKPPGIVPPIVKP--PGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
            P P  + P   P +P +PP   PP   P  P   PP   PP   PP T PPVT  P T P
Sbjct: 826  PQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPP---PPPTRPPVTQKPYTRP 882

Query: 313  PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
            P   PT PP+   TP  PP     PPS+P PT
Sbjct: 883  PPPPPTFPPVAPSTPRPPP---YLPPSSPRPT 911

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 36/90 (40%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P +P  PP   PP+ + P   PP   PP   PP   PP    P T  P   
Sbjct: 516 PVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPP---PPPTRPPTRPPPPPTQPSTYLPPAP 572

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PT PP P VT   PP P   PP  P PT P
Sbjct: 573 PTRPPQPPVTRPPPPPPTRPPP--PPPTRP 600

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 36/89 (40%), Positives = 42/89 (47%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P      P +PP   PP+ +PP   PP  +PP   PP T PPVT  P T PP 
Sbjct: 745 PAPPTRPPPPPTRPPTRPPQ--PPVTRPPP--PPPTRPPP--PPPTRPPVTQTPYTRPPP 798

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
             PT PP+       PP P   PP+ P P
Sbjct: 799 -PPTRPPVTQTPYTRPPPPPTRPPTRPPP 826

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 38/92 (41%), Positives = 41/92 (44%), Gaps = 2/92 (2%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P  + P   P +P +PP   PP   PP   PP   PP   PPVT  P T PP   PP   
Sbjct: 500 PSTYLPPAPPTRPPQPPVTRPP--PPPPTRPP--PPPPTRPPVTQTPYTRPP--PPPTRP 553

Query: 325 PTLPPIPGVTP--ILPPVPVLNPPSTPTPTTP 414
           PT PP P   P   LPP P   PP  P    P
Sbjct: 554 PTRPPPPPTQPSTYLPPAPPTRPPQPPVTRPP 585

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 41/98 (41%), Positives = 44/98 (44%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPP------ 300
           P P  + P   P +P +PP   PP   PP   PP   PP   PPVT  P T PP      
Sbjct: 623 PQPSTYLPPAPPTRPPQPPVTRPP--PPPPTRPP--PPPPTRPPVTQTPYTRPPPPPTRP 678

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            T  P   PT PP P VT   PP P   PP  P PT P
Sbjct: 679 STYLPPAPPTRPPKPPVTRPPPPPPTRPPP--PPPTRP 714

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 38/99 (38%), Positives = 42/99 (42%), Gaps = 9/99 (9%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV-------PPVTVPPI 303
            P    P   P +P  PP   PP+ + P   PP   PP   PPVT        PP T PP 
Sbjct: 766  PVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPP---PPPTRPPVTQTPYTRPPPPPTRPPT 822

Query: 304  TVPPVVKPTLPPIPGVTPILPPV--PVLNPPSTPTPTTP 414
              PP     LPP P   P  PPV  P   PP+ P P  P
Sbjct: 823  RPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPP 861

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 41/108 (37%), Positives = 48/108 (44%), Gaps = 15/108 (13%)
 Frame = +1

Query: 136 KPVPKKHKPSK--KPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           +P P    PS    P  P +PP   PP+ +PP   PP  +PP   PP T PPVT  P T 
Sbjct: 492 RPPPPPTAPSTYLPPAPPTRPPQ--PPVTRPPP--PPPTRPPP--PPPTRPPVTQTPYTR 545

Query: 310 PPVVKPTLPP-------------IPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   PT PP             +P   P  PP P +  P  P PT P
Sbjct: 546 PPP-PPTRPPTRPPPPPTQPSTYLPPAPPTRPPQPPVTRPPPPPPTRP 592

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/94 (38%), Positives = 40/94 (42%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P     +P  PP   PP   PP   PP+ + P   PP   PP T PP   PP 
Sbjct: 570 PAPPTRPPQPPVTRPPPPPPTRPP--PPPPTRPPVTQTPYTRPP---PPPTRPPTRPPPQ 624

Query: 319 VKPTLPPIPGVTPILPPV--PVLNPPSTPTPTTP 414
               LPP P   P  PPV  P   PP+ P P  P
Sbjct: 625 PSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPP 658

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 36/91 (39%), Positives = 41/91 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P++ P +P       PP   PP    P  +PP   PPVT PP   PP T PP 
Sbjct: 725 PPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTRPPTRPPQ--PPVTRPPP--PPPTRPPP 780

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
             PT PP+       PP P   PP T TP T
Sbjct: 781 PPPTRPPVTQTPYTRPPPPPTRPPVTQTPYT 811

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 38/111 (34%), Positives = 49/111 (44%), Gaps = 18/111 (16%)
 Frame = +1

Query: 136  KPVPKKHKPSKKPGKP--VKPPGIVPPIVKPPGIVPPIVKPPVILPPVT--VPPVTVPPI 303
            +P P   +P  +P +P   +PP   PP  +PP   PP  +PPV   P T   PP T PP+
Sbjct: 750  RPPPPPTRPPTRPPQPPVTRPP--PPPPTRPP--PPPPTRPPVTQTPYTRPPPPPTRPPV 805

Query: 304  TVPPVVKPTLPP--------------IPGVTPILPPVPVLNPPSTPTPTTP 414
            T  P  +P  PP              +P   P  PP P +  P  P PT P
Sbjct: 806  TQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRP 856

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 42/115 (36%), Positives = 50/115 (43%), Gaps = 22/115 (19%)
 Frame = +1

Query: 136 KPVPKKHKPSK--KPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT- 306
           +P P   +PS    P  P +PP   PP+ +PP   PP  +PP   PP T PPVT  P T 
Sbjct: 670 RPPPPPTRPSTYLPPAPPTRPPK--PPVTRPPP--PPPTRPPP--PPPTRPPVTQTPYTR 723

Query: 307 --VPPVVKPTLPP------IPGVTPILPPVPVLNPPSTP-----------TPTTP 414
              PP   PT PP      +P   P  PP P   PP+ P            PT P
Sbjct: 724 PPPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTRPPTRPPQPPVTRPPPPPPTRP 778

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 36/110 (32%), Positives = 47/110 (42%), Gaps = 18/110 (16%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPI--VKPPGIVPPIVKPPVILPPV--TVPPVTVPPIT 306
           P P    P++ P  P +P   +PP    +PP   PP+ +PP   PP     PP T PP+T
Sbjct: 547 PPPPTRPPTRPPPPPTQPSTYLPPAPPTRPPQ--PPVTRPPPP-PPTRPPPPPPTRPPVT 603

Query: 307 VPPVVKPTLPP--------------IPGVTPILPPVPVLNPPSTPTPTTP 414
             P  +P  PP              +P   P  PP P +  P  P PT P
Sbjct: 604 QTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRP 653

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 37/106 (34%), Positives = 42/106 (39%), Gaps = 16/106 (15%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKP----------------PGIVPPIVKPPGIVPPIVKPPVILPPVT 276
           P   +P  +P  PV P                P  +PP  + P   PP  +PP   PP  
Sbjct: 435 PVTQRPVTRPPPPVTPKPQSPFQGYTYPKPDTPFTLPPATRTPP--PPPTRPPTRPPPTR 492

Query: 277 VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP    P T  P   PT PP P VT   PP P   PP  P PT P
Sbjct: 493 PPPPPTAPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPP--PPPTRP 536

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 39/94 (41%), Positives = 42/94 (44%), Gaps = 9/94 (9%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVP------PVTVP---PITVP 312
           P++ P  PV  P   PP   PP   PP  +PPV   P T P      P T P   P T  
Sbjct: 573 PTRPPQPPVTRPPPPPPTRPPP---PPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYL 629

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   PT PP P VT   PP P   PP  P PT P
Sbjct: 630 PPAPPTRPPQPPVTRPPPPPPTRPPP--PPPTRP 661

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 38/103 (36%), Positives = 43/103 (41%), Gaps = 14/103 (13%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVK-------PPGIVPPIVKPP---VILPPVTVPPVTV 294
           P    P   P +P  PP   PP+ +       PP   PP   PP     LPP        
Sbjct: 580 PVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQ 639

Query: 295 PPITVPPVVKPTLPPIPGVTPILPPV---PVLNPPSTPT-PTT 411
           PP+T PP   PT PP P   P  PPV   P   PP  PT P+T
Sbjct: 640 PPVTRPPPPPPTRPPPP--PPTRPPVTQTPYTRPPPPPTRPST 680

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 36/105 (34%), Positives = 46/105 (43%), Gaps = 12/105 (11%)
 Frame = +1

Query: 136 KPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPP------VTVPPVTVP 297
           +P P   +P  +P  P +P   +PP    P   PP  +PPV  PP         PP T P
Sbjct: 609 RPPPPPTRPPTRP--PPQPSTYLPPA---PPTRPP--QPPVTRPPPPPPTRPPPPPPTRP 661

Query: 298 PITVPPVVKPTLPP------IPGVTPILPPVPVLNPPSTPTPTTP 414
           P+T  P  +P  PP      +P   P  PP P +  P  P PT P
Sbjct: 662 PVTQTPYTRPPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPPTRP 706

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 39/122 (31%), Positives = 45/122 (36%), Gaps = 32/122 (26%)
 Frame = +1

Query: 145  PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV-----------------KPPVILPP- 270
            P    P   P +P  PP   PP+ + P   PP                   KPPV  PP 
Sbjct: 641  PVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPSTYLPPAPPTRPPKPPVTRPPP 700

Query: 271  -----VTVPPVTVPPITVPPVVKPTLPPI-------PGVTPILPPVPVLNPPSTPT--PT 408
                    PP T PP+T  P  +P  PP        P  +  LPP P   PP  PT  PT
Sbjct: 701  PPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTRPPT 760

Query: 409  TP 414
             P
Sbjct: 761  RP 762

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 37/100 (37%), Positives = 42/100 (42%), Gaps = 8/100 (8%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV-----PPVT---V 294
           P P   +P   P  P +PP    P  +PP   PP  +P   LPP        PPVT    
Sbjct: 646 PPPPPTRPPPPP--PTRPPVTQTPYTRPP---PPPTRPSTYLPPAPPTRPPKPPVTRPPP 700

Query: 295 PPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP T PP   PT PP+       PP P   PP T  P  P
Sbjct: 701 PPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPP-TRPPPQP 739

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 34/86 (39%), Positives = 38/86 (44%), Gaps = 8/86 (9%)
 Frame = +1

Query: 172 PGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTV-----PPVTVP---PITVPPVVKP 327
           P  P +PP   PP  +PP   PP   P   LPP        PPVT P   P T PP   P
Sbjct: 478 PPPPTRPPTRPPP-TRPP---PPPTAPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPP 533

Query: 328 TLPPIPGVTPILPPVPVLNPPSTPTP 405
           T PP+       PP P   PP+ P P
Sbjct: 534 TRPPVTQTPYTRPPPPPTRPPTRPPP 559

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 34/91 (37%), Positives = 41/91 (45%), Gaps = 8/91 (8%)
 Frame = +1

Query: 163  SKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPP---VTVPPVTV-----PPITVPPV 318
            ++ P  P +PP    P  +PP   PP  +PP   PP     +PP        PP+T PP 
Sbjct: 794  TRPPPPPTRPPVTQTPYTRPP---PPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPP 850

Query: 319  VKPTLPPIPGVTPILPPVPVLNPPSTPTPTT 411
              PT PP P  T   PP P   PP T  P T
Sbjct: 851  PPPTRPPPPPPTR-PPPPPPTRPPVTQKPYT 880

[185][TOP]
>UniRef100_A6W4W0 Peptidase S8 and S53 subtilisin kexin sedolisin n=1 Tax=Kineococcus
           radiotolerans SRS30216 RepID=A6W4W0_KINRD
          Length = 846

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 32/75 (42%), Positives = 38/75 (50%)
 Frame = +1

Query: 190 PPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILPP 369
           PP +V P+  PP +V P   PPV  PP   P    PP+  PPV  P  P  P V P   P
Sbjct: 533 PPVVVQPLPAPPVVVAPPAAPPVAAPPAPAPLAPAPPVVTPPVAVPPAPTPPVVVPTPAP 592

Query: 370 VPVLNPPSTPTPTTP 414
            PV   P+TP+P  P
Sbjct: 593 SPV--KPATPSPGRP 605

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 27/64 (42%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
 Frame = +1

Query: 157 KPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP-PVVKPTL 333
           +P   P   V PP   PP+  PP   P    PPV+ PPV VPP   PP+ VP P   P  
Sbjct: 538 QPLPAPPVVVAPPA-APPVAAPPAPAPLAPAPPVVTPPVAVPPAPTPPVVVPTPAPSPVK 596

Query: 334 PPIP 345
           P  P
Sbjct: 597 PATP 600

[186][TOP]
>UniRef100_Q3HTK6 Pherophorin-C1 protein n=1 Tax=Chlamydomonas reinhardtii
           RepID=Q3HTK6_CHLRE
          Length = 738

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 38/106 (35%), Positives = 41/106 (38%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVT 276
           +   P+        P P    PS  P  P  PP   PP   PP   PP   PP   PP  
Sbjct: 177 NDCCPLSQANVPSPPPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 235

Query: 277 VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   PP   PP   P  PP P   P  PP P   PP +P P  P
Sbjct: 236 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 281

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 35/90 (38%), Positives = 41/90 (45%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP   
Sbjct: 206 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 265

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P+ PP P  +P  PP P   PP  P+P  P
Sbjct: 266 PSPPPPPPPSPPPPPPPRPPPPPPPSPPPP 295

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/92 (40%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 303 PPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPS-PPPPPPPRPPPPSPPPPS 361

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P +P
Sbjct: 362 PPPPSPPPPSPPPPPPPSPPPPPPPRPPPPSP 393

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/92 (40%), Positives = 43/92 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P+   PS  P  P  PP   PP    P   PP   PP   PP + PP + PP + PP 
Sbjct: 316 PPPRPPPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPP 375

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P   P  PP P   PPS P P+ P
Sbjct: 376 PPPSPPPPP---PPRPPPPSPPPPSPPPPSPP 404

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 38/92 (41%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP + PP 
Sbjct: 216 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP---PPPSPPPP 271

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P   P  PP P   PPS P P+ P
Sbjct: 272 PPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPP 303

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 37/94 (39%), Positives = 39/94 (41%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P +P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 270 PPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPS 329

Query: 319 VKPTLPPIPGVTPILPPVPVLN--PPSTPTPTTP 414
             P  PP P   P  PP P     PPS P P+ P
Sbjct: 330 PPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPP 363

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 37/92 (40%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP   PP   PP 
Sbjct: 298 PPPSPPPPSPPPPSPPPPP---PPRPPPPSPPPPSPPPP---PPPSPPPPPSPPPPPPPR 351

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P+P  P
Sbjct: 352 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 383

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 37/92 (40%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP    P   PP   PP   PP   PP + PP + PP   PP 
Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPP---PPP 377

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P  P
Sbjct: 378 PSPPPPPPPRPPPPSPPPPSPPPPSPPPPPPP 409

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 34/90 (37%), Positives = 38/90 (42%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP   
Sbjct: 196 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 255

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P P   P  PP P  +PP  P P  P
Sbjct: 256 PPPSPPPPPPPSPPPPPPPSPPPPPPPRPP 285

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 35/90 (38%), Positives = 39/90 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P   P  P  PP   PP   PP   PP   PP   PP + PP + PP   PP   
Sbjct: 211 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PPPPS 267

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PP +P P +P
Sbjct: 268 PPPPPPPSPPPPPPPRPPPPPPPSPPPPSP 297

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 37/92 (40%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP    P   PP + PP   PP 
Sbjct: 226 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP---PPP 281

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            +P  PP P   P  PP P   PPS P P+ P
Sbjct: 282 PRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 313

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 37/92 (40%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP  +PP   PP   PP   PP + PP 
Sbjct: 286 PPPPPSPPPPSPPPPSPPPPSPPPPSPPP---PPPPRPPPPSPPPPSPPPPPPP-SPPPP 341

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 342 PSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPP 373

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 37/94 (39%), Positives = 37/94 (39%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPV--KPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVP 312
           P P    PS  P  P    PP   PP   PP   PP   PP   PP   PP   PP   P
Sbjct: 196 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 255

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P  PP P   P  PP P   PP  P P  P
Sbjct: 256 PPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPP 289

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 35/85 (41%), Positives = 37/85 (43%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVKPTLPP 339
           PS  P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP   P  PP
Sbjct: 342 PSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPP--PPPPSPPPPPPPRPPPPSPPPPSPP 399

Query: 340 IPGVTPILPPVPVLNPPSTPTPTTP 414
            P   P  PP P   PP  P P +P
Sbjct: 400 PPSPPPPPPPSPPPPPPPRPPPPSP 424

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 37/92 (40%), Positives = 43/92 (46%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P+   PS  P  P  PP   PP   PP    P   PP   PP + PP + PP + PP 
Sbjct: 348 PPPRPPPPSPPPPSP-PPPSPPPPSPPPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPP 406

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P   P  PP P   PPS P P+ P
Sbjct: 407 PPPSPPPPP---PPRPPPPSPPPPSPPPPSPP 435

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 40/92 (43%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP    P   PP   PP + PP + PP + PP 
Sbjct: 251 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPP 310

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P+P  P
Sbjct: 311 SPPPPPP-PRPPPPSPPPPSPPPPPPPSPPPP 341

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   P    PP   PP   PP   PP   PP   PP 
Sbjct: 255 PPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 314

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P +P
Sbjct: 315 PPPPRPPPPSPPPPSPPPP--PPPSPPPPPSP 344

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 38/93 (40%), Positives = 39/93 (41%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIV-KPPVILPPVTVPPVTVPPITVPP 315
           P P    PS  P  P  PP   PP   PP   PP   +PP   PP   PP   PP   PP
Sbjct: 246 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPP 305

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              P  PP P   P  PP P   PPS P P  P
Sbjct: 306 SPPPPSPPPP--PPPRPPPPSPPPPSPPPPPPP 336

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 35/90 (38%), Positives = 40/90 (44%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP + PP   
Sbjct: 261 PPPPPPSPPPPPPPSPPPPPPPRPPPP---PPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 317

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP     P  PP P  +PP  P+P  P
Sbjct: 318 PRPPPPSPPPPSPPPPPPPSPPPPPSPPPP 347

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 38/92 (41%), Positives = 41/92 (44%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP + PP + PP   PP 
Sbjct: 358 PPPSPPPPSPPPPSPPPPP---PPSPPPP---PPPRPPPPSPPPPSPPPPSPPP---PPP 408

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P+ P
Sbjct: 409 PSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPP 440

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/92 (38%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  P    PP  +PP   PP   PP   PP   PP   PP   PP 
Sbjct: 325 PPPPSPPPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP- 383

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P+P  P
Sbjct: 384 -PPPRPPPPSPPPPSPPPPSPPPPPPPSPPPP 414

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/92 (39%), Positives = 42/92 (45%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P   +P      P  PP   PP   PP   PP   PP   PP   PP + PP + PP 
Sbjct: 345 PPPPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP---PPPRPPPPSPPPPSPPP- 400

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P+ PP P  +P  PP P   PPS P P+ P
Sbjct: 401 --PSPPPPPPPSPPPPPPPRPPPPSPPPPSPP 430

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 37/92 (40%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 331 PPPPPPSPPPPPSPPPPPPPRPPPPSPPPPSPPPPSPPPPSPPP---PPPPSPPPPPPPR 387

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P  P
Sbjct: 388 PPPPSPPPPSPPPPSPPPPP--PPSPPPPPPP 417

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 37/92 (40%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   P    PP   PP 
Sbjct: 231 PPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPP---PPPSPPPPPPPSPPPPPPPRPPP 286

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P  P
Sbjct: 287 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 318

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 37/92 (40%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 263 PPPPSPPPPPPPSPPPPPPPRPPP---PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPR 319

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P  P
Sbjct: 320 PPPPSPPPPSPPPPPPPSPP-PPPSPPPPPPP 350

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  P    P    PP   PP   PP   PP   PP   PP + PP 
Sbjct: 288 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPPPPPPPSPPPPPS-PPP 346

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P  P
Sbjct: 347 PPPPRPPPPSPPPPSPPPPSPPPPSPPPPPPP 378

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 35/92 (38%), Positives = 39/92 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  P    PP   PP   PP   PP    P   PP + PP + PP 
Sbjct: 241 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPRPPPPPPPSPPPPS-PPP 299

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  P  P  +P  PP P   PPS P P+ P
Sbjct: 300 PSPPPPSPPPPSPPPPPPPRPPPPSPPPPSPP 331

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 35/90 (38%), Positives = 36/90 (40%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P +PP   PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 269 PPPPPPSPPPPPPPRPPPPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPPPPRPPPPSPP 326

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PP  P    P
Sbjct: 327 PPSPPPP--PPPSPPPPPSPPPPPPPRPPP 354

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   P    PP   PP   PP 
Sbjct: 236 PPPSPPPPSPPPPSP-PPPSPPPPSPPPP---PPPSPPPPPPPSPPPPPPPRPPPPPPPS 291

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P  +PP  P P  P
Sbjct: 292 PPPPSPPPPSPPPPSPPPP--SPPPPPPPRPP 321

[187][TOP]
>UniRef100_B7ZXW4 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B7ZXW4_MAIZE
          Length = 358

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 30/82 (36%), Positives = 43/82 (52%), Gaps = 4/82 (4%)
 Frame = +1

Query: 181 PVKPPG---IVPPIVKPPGIVPPIVKPPVILP-PVTVPPVTVPPITVPPVVKPTLPPIPG 348
           P+ PP      PP + PP + PP + PP + P P+  PP+  PP+  PP+  P + P+P 
Sbjct: 136 PIGPPPTGYFAPPPMAPPPMAPPPMAPPPMAPLPMAPPPMAPPPMAPPPMAPPPMAPLPM 195

Query: 349 VTPILPPVPVLNPPSTPTPTTP 414
             P + P P+  PP  P P  P
Sbjct: 196 APPPMAPPPMAPPPMAPPPMAP 217

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 31/92 (33%), Positives = 44/92 (47%), Gaps = 1/92 (1%)
 Frame = +1

Query: 133 GKPVPKKHKPSKKPGKPVKPPGIVPPIVKP-PGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           G P      P      P+ PP + PP + P P   PP+  PP+  PP+  PP+   P+  
Sbjct: 138 GPPPTGYFAPPPMAPPPMAPPPMAPPPMAPLPMAPPPMAPPPMAPPPMAPPPMAPLPMAP 197

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PP+  P + P P   P + P+P+  PP  P P
Sbjct: 198 PPMAPPPMAPPPMAPPPMAPLPMAPPPMAPPP 229

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 30/84 (35%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP-PVTVPPVTVPPITVPP 315
           P P    P   P  P+ P  + PP + PP + PP + PP + P P+  PP+  PP+  PP
Sbjct: 152 PPPMAPPPMAPP--PMAPLPMAPPPMAPPPMAPPPMAPPPMAPLPMAPPPMAPPPMAPPP 209

Query: 316 VVKPTLPPIPGVTPILPPVPVLNP 387
           +  P + P+P   P + P P+ NP
Sbjct: 210 MAPPPMAPLPMAPPPMAPPPMANP 233

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +1

Query: 190 PPGIVPPIVKPPGIVPPIVKP-PVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           PP + PP + PP + PP + P P+  PP+  PP+  PP+  PP+    + P P   P + 
Sbjct: 147 PPPMAPPPMAPPPMAPPPMAPLPMAPPPMAPPPMAPPPMAPPPMAPLPMAPPPMAPPPMA 206

Query: 367 PVPVLNPPSTPTPTTP 414
           P P+  PP  P P  P
Sbjct: 207 PPPMAPPPMAPLPMAP 222

[188][TOP]
>UniRef100_B4FEY0 Putative uncharacterized protein n=2 Tax=Zea mays
           RepID=B4FEY0_MAIZE
          Length = 328

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 30/82 (36%), Positives = 43/82 (52%), Gaps = 4/82 (4%)
 Frame = +1

Query: 181 PVKPPG---IVPPIVKPPGIVPPIVKPPVILP-PVTVPPVTVPPITVPPVVKPTLPPIPG 348
           P+ PP      PP + PP + PP + PP + P P+  PP+  PP+  PP+  P + P+P 
Sbjct: 106 PIGPPPTGYFAPPPMAPPPMAPPPMAPPPMAPLPMAPPPMAPPPMAPPPMAPPPMAPLPM 165

Query: 349 VTPILPPVPVLNPPSTPTPTTP 414
             P + P P+  PP  P P  P
Sbjct: 166 APPPMAPPPMAPPPMAPPPMAP 187

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 31/92 (33%), Positives = 44/92 (47%), Gaps = 1/92 (1%)
 Frame = +1

Query: 133 GKPVPKKHKPSKKPGKPVKPPGIVPPIVKP-PGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           G P      P      P+ PP + PP + P P   PP+  PP+  PP+  PP+   P+  
Sbjct: 108 GPPPTGYFAPPPMAPPPMAPPPMAPPPMAPLPMAPPPMAPPPMAPPPMAPPPMAPLPMAP 167

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PP+  P + P P   P + P+P+  PP  P P
Sbjct: 168 PPMAPPPMAPPPMAPPPMAPLPMAPPPMAPPP 199

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 30/84 (35%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP-PVTVPPVTVPPITVPP 315
           P P    P   P  P+ P  + PP + PP + PP + PP + P P+  PP+  PP+  PP
Sbjct: 122 PPPMAPPPMAPP--PMAPLPMAPPPMAPPPMAPPPMAPPPMAPLPMAPPPMAPPPMAPPP 179

Query: 316 VVKPTLPPIPGVTPILPPVPVLNP 387
           +  P + P+P   P + P P+ NP
Sbjct: 180 MAPPPMAPLPMAPPPMAPPPMANP 203

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +1

Query: 190 PPGIVPPIVKPPGIVPPIVKP-PVILPPVTVPPVTVPPITVPPVVKPTLPPIPGVTPILP 366
           PP + PP + PP + PP + P P+  PP+  PP+  PP+  PP+    + P P   P + 
Sbjct: 117 PPPMAPPPMAPPPMAPPPMAPLPMAPPPMAPPPMAPPPMAPPPMAPLPMAPPPMAPPPMA 176

Query: 367 PVPVLNPPSTPTPTTP 414
           P P+  PP  P P  P
Sbjct: 177 PPPMAPPPMAPLPMAP 192

[189][TOP]
>UniRef100_A9NZN2 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NZN2_PICSI
          Length = 220

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 40/115 (34%), Positives = 51/115 (44%), Gaps = 3/115 (2%)
 Frame = +1

Query: 43  SMESSKIHAYLFLC-MLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVK 219
           +ME S+  A +FL  M+ +++  P +GC  C K  P +  P+        PP   PP   
Sbjct: 23  NMELSRTLAAIFLIVMVQMAAMVPAMGCLYCPKTPPYQSPPTTPVPSTPAPPTPAPPTPA 82

Query: 220 PPGI-VPPIVKPPVILPPVT-VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPV 378
           PP    PP   PP   PP T  PP   PP   PP   P  P  P VTP     P+
Sbjct: 83  PPTTPAPPTPAPPTPAPPTTPAPPTPAPPTPAPPTPAPPTPAPPAVTPSSNTCPI 137

[190][TOP]
>UniRef100_A8J1N3 Cell wall protein pherophorin-C10 (Fragment) n=1 Tax=Chlamydomonas
           reinhardtii RepID=A8J1N3_CHLRE
          Length = 527

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 41/111 (36%), Positives = 44/111 (39%), Gaps = 5/111 (4%)
 Frame = +1

Query: 97  SSAAPILGCGTCGKPVP---KKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP 267
           +   P +  GT   P P       PS KP  P  PPG  PP   PP   PP   PP   P
Sbjct: 183 NGCCPQVQAGTPSPPSPLPPSPRPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPPPPSPQP 242

Query: 268 PVTVPPVTVPPITVPP--VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PV   P    P   PP     P  PP P   P  P  P   PPS P P +P
Sbjct: 243 PVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPSP 293

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 37/96 (38%), Positives = 40/96 (41%)
 Frame = +1

Query: 127 TCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT 306
           TC    P    PS  P  P  P    PP   PP   PP+  PP   PP   PP   PP  
Sbjct: 363 TCAFLPPSPLPPSPAPPSPQPPLPPPPPSPYPPSPAPPV--PPSPPPPSPYPPSPAPP-- 418

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   P  PP P   P  PP P   PP +P P +P
Sbjct: 419 APPSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSP 454

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 35/89 (39%), Positives = 38/89 (42%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS KP  P  P    PP  +PP   PP  +PP   PP+  P    PP   PP 
Sbjct: 268 PPPSPAPPSPKPPSPEPPSPPPPPSPEPPSPKPPSPEPPSPQPPLPPP----PPSPYPPS 323

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
             P  PP P   P  P  P   PPS P P
Sbjct: 324 PSPPSPPPPSPPPPSPAPPSPAPPSPPPP 352

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 38/90 (42%), Positives = 42/90 (46%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP   PP  KPP   PP   P    PP   PP   PP   PP  +
Sbjct: 254 PGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPP----PPSPEPPSPKPPSPEPPSPQ 309

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P LPP P  +P  PP P  +PPS P P+ P
Sbjct: 310 PPLPP-PPPSP-YPPSP--SPPSPPPPSPP 335

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 36/96 (37%), Positives = 39/96 (40%), Gaps = 4/96 (4%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVK----PPVILPPVTVPPVTVPPIT 306
           P P  + PS  P  P  PP   PP   PP   PP       PP   PP   PP   PP  
Sbjct: 388 PPPSPYPPSPAPPVPPSPP---PPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPFPPFP 444

Query: 307 VPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            PP   P  P  P   P  PP P   PP +P P +P
Sbjct: 445 PPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSP 480

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 38/98 (38%), Positives = 41/98 (41%), Gaps = 6/98 (6%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P  + PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 406 PPPSPYPPSPAPPAPPSPPPPPPPPPPPPPPPPPF--PPFPPPPSPPPPSPGPPSPAPPS 463

Query: 319 VKPTLPPIP------GVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P         P LPP P   PP +P P +P
Sbjct: 464 PPPPPPPPPPSPYPPSPAPPLPPSP---PPPSPYPPSP 498

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 34/91 (37%), Positives = 37/91 (40%), Gaps = 1/91 (1%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPIT-VPPVV 321
           P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP +  PP  
Sbjct: 421 PSPPPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSP 480

Query: 322 KPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
            P LPP P      PP P    P +P P +P
Sbjct: 481 APPLPPSPPPPSPYPPSPAPPVPPSPAPPSP 511

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  P    PP   PP   PP   PP  LPP   PP   PP   PPV
Sbjct: 445 PPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPP--LPPSPPPPSPYPPSPAPPV 502

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
                PP P      PP P   PPS P P +P
Sbjct: 503 PPSPAPPSPE-----PPSPA--PPSPPPPPSP 527

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/94 (38%), Positives = 40/94 (42%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPG-IVPPIVKPPVILPPVTVPPVTVPPIT-VP 312
           P P    P      P  PPG  PP   PP    PP   PP   PP   PP   PP +  P
Sbjct: 236 PPPSPQPPVPPSPAPPTPPGPPPPSPAPPNPPPPPSPAPPSPKPPSPEPPSPPPPPSPEP 295

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  KP  P  P   P LPP P    P +P+P +P
Sbjct: 296 PSPKPPSPEPPSPQPPLPPPPPSPYPPSPSPPSP 329

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 35/97 (36%), Positives = 41/97 (42%), Gaps = 5/97 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPI-VKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPP 315
           P P    PS KP  P +PP   PP+   PP   PP   PP   PP   PP   PP   PP
Sbjct: 289 PPPSPEPPSPKPPSP-EPPSPQPPLPPPPPSPYPPSPSPPSPPPPSPPPPSPAPPSPAPP 347

Query: 316 VVKPTLPPIPG----VTPILPPVPVLNPPSTPTPTTP 414
              P    + G        LPP P+   P+ P+P  P
Sbjct: 348 SPPPPCECLAGERELTCAFLPPSPLPPSPAPPSPQPP 384

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 34/93 (36%), Positives = 38/93 (40%), Gaps = 1/93 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVT-VPPITVPP 315
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP +  PP   PP
Sbjct: 424 PPPPPPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPP 483

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           +     PP P      PPVP    P +P P +P
Sbjct: 484 LPPSPPPPSPYPPSPAPPVPPSPAPPSPEPPSP 516

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 42/105 (40%), Positives = 44/105 (41%), Gaps = 6/105 (5%)
 Frame = +1

Query: 118 GCGTC-----GKPVPKKHKPSKKPGKPVKPPGIVPPI-VKPPGIVPPIVKPPVILPPVTV 279
           G G C     G P P    PS  P  P +PP   PP    PPG  PP   PP   PP   
Sbjct: 182 GNGCCPQVQAGTPSP----PSPLPPSP-RPPSPKPPSPPPPPGPPPPSPAPPSPSPPSPP 236

Query: 280 PPVTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           PP   PP  VPP   P  PP P      PP    NPP  P+P  P
Sbjct: 237 PPSPQPP--VPPSPAPPTPPGPPPPSPAPP----NPPPPPSPAPP 275

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 34/94 (36%), Positives = 38/94 (40%), Gaps = 2/94 (2%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPP-GIVPPIVKPPGIVPPIVKPPVILPPVT-VPPVTVPPITVP 312
           P P    P   P  P  PP    PP   PP   PP   PP   PP +  PP   PP+  P
Sbjct: 428 PPPPPPPPPPPPFPPFPPPPSPPPPSPGPPSPAPPSPPPPPPPPPPSPYPPSPAPPL--P 485

Query: 313 PVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P   P  P  P   P +PP P    P  P+P  P
Sbjct: 486 PSPPPPSPYPPSPAPPVPPSPAPPSPEPPSPAPP 519

[191][TOP]
>UniRef100_Q657S4 Os01g0110200 protein n=2 Tax=Oryza sativa RepID=Q657S4_ORYSJ
          Length = 240

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 40/100 (40%), Positives = 48/100 (48%), Gaps = 11/100 (11%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP---PGIVP---PIVKPPGIV-----PPIVKPPVILPPVTVPP 285
           P P    P+  P  PV P   P + P   P+  PP        PP+  PPV  PPVT PP
Sbjct: 50  PAPATPAPTATPTPPVAPAKAPPVAPAVAPVTPPPPTPKKAPPPPVTPPPVTPPPVTPPP 109

Query: 286 VTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           V+ PP T PP + P+ PP P   P   P   L P +TP P
Sbjct: 110 VSPPPATPPPALPPSTPP-PVAAPAEAPA-ALPPATTPPP 147

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 35/99 (35%), Positives = 41/99 (41%)
 Frame = +1

Query: 106 APILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPP 285
           AP +   T   P PKK            PP + PP V PP + PP V PP   PP  +PP
Sbjct: 74  APAVAPVTPPPPTPKK----------APPPPVTPPPVTPPPVTPPPVSPPPATPPPALPP 123

Query: 286 VTVPPITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPT 402
            T PP+  P      LPP     P+      L P   PT
Sbjct: 124 STPPPVAAPAEAPAALPPATTPPPVAEAPAELPPAEAPT 162

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/92 (38%), Positives = 40/92 (43%), Gaps = 5/92 (5%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVP-----PIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P K  P      PV PP   P     P V PP + PP V PP + PP   PP  +PP T 
Sbjct: 67  PAKAPPVAPAVAPVTPPPPTPKKAPPPPVTPPPVTPPPVTPPPVSPPPATPPPALPPSTP 126

Query: 310 PPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PPV  P   P   + P   P PV   P+   P
Sbjct: 127 PPVAAPAEAP-AALPPATTPPPVAEAPAELPP 157

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 39/96 (40%), Positives = 43/96 (44%), Gaps = 7/96 (7%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVI--LPPVTVPPVTV-----P 297
           P P    P+K P  P  P     P   P   V P   PPV   + PVT PP T      P
Sbjct: 38  PTPVPTAPAKSPPAPATPA----PTATPTPPVAPAKAPPVAPAVAPVTPPPPTPKKAPPP 93

Query: 298 PITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
           P+T PPV  P + P P   P   P P L PPSTP P
Sbjct: 94  PVTPPPVTPPPVTPPPVSPPPATPPPAL-PPSTPPP 128

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 31/89 (34%), Positives = 37/89 (41%), Gaps = 4/89 (4%)
 Frame = +1

Query: 160 PSKKPGKPVKPPGIVPPIVKPPGIVPPI--VKPPVILPPVTVPPVT--VPPITVPPVVKP 327
           P+  P +P   P    P   PP    P     P   + P   PPV   V P+T PP    
Sbjct: 29  PAAAPAQPTPTPVPTAPAKSPPAPATPAPTATPTPPVAPAKAPPVAPAVAPVTPPPPTPK 88

Query: 328 TLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             PP P   P + P PV  PP +P P TP
Sbjct: 89  KAPPPPVTPPPVTPPPVTPPPVSPPPATP 117

[192][TOP]
>UniRef100_Q9DVW0 PxORF73 peptide n=1 Tax=Plutella xylostella granulovirus
           RepID=Q9DVW0_9BBAC
          Length = 158

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 38/98 (38%), Positives = 39/98 (39%), Gaps = 8/98 (8%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKP-----PGIVPPIVKPPVILPPVTVP---PVTVPP 300
           P    P   P  P  PP   PP   P     P   PP   PP   PP  +P   P T PP
Sbjct: 35  PPPTPPPTPPTSPATPPPTFPPTPPPTPPPTPPPTPPPTPPPTPPPPPIIPAPSPPTAPP 94

Query: 301 ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
              PP   P  PP P   P  PP P   PP TP PT P
Sbjct: 95  QPPPPPPPPPPPPPPPPPPTPPPTPPPTPPPTPPPTPP 132

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 36/87 (41%), Positives = 38/87 (43%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    P+  P  P  PP   PP   PP I+P     P   PP   PP   PP   PP   
Sbjct: 55  PPTPPPTPPPTPPPTPPPTPPPTPPPPPIIP--APSPPTAPPQPPPPPPPPPPPPPPPPP 112

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTP 405
           PT PP P  TP  PP P   PP TP P
Sbjct: 113 PTPPPTPPPTP--PPTPPPTPPPTPNP 137

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 38/92 (41%), Positives = 42/92 (45%), Gaps = 5/92 (5%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKP---PGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITV 309
           P P    P   P  P+ P   P   PP   PP   PP   PP   PP   PP T PP T 
Sbjct: 68  PTPPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPPPPPPP---PPPPTPPPTPPP-TP 123

Query: 310 PPVVKPTLPPIPGVTPILPPV--PVLNPPSTP 399
           PP   PT PP P    ++PP+  P L PPS P
Sbjct: 124 PPTPPPTPPPTPNPDAVIPPITRPPLRPPSLP 155

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 38/91 (41%), Positives = 40/91 (43%), Gaps = 3/91 (3%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP---PVTVPPVTVPPITVPP 315
           P    P+  P  P  PP   PP   PP   PP   PP I+P   P T PP   PP   PP
Sbjct: 47  PATPPPTFPPTPPPTPPPTPPPT--PPPTPPPTPPPPPIIPAPSPPTAPPQPPPPPPPPP 104

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTPT 408
              P  PP P   P  PP P   PP TP PT
Sbjct: 105 PPPPPPPP-PTPPPTPPPTPPPTPPPTPPPT 134

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 41/103 (39%), Positives = 42/103 (40%), Gaps = 2/103 (1%)
 Frame = +1

Query: 112 ILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKP-PGIVPPIVKPPVILPPVTVPPV 288
           IL   T   P P    P   P  P   P   PP   P P   PP   PP   PP T PP 
Sbjct: 20  ILKPKTIHTPSPPLPPPPTPPPTPPTSPATPPPTFPPTPPPTPPPTPPPT--PPPTPPPT 77

Query: 289 TVPPITVPPVVKPTLPP-IPGVTPILPPVPVLNPPSTPTPTTP 414
             PP  +P    PT PP  P   P  PP P   PP TP PT P
Sbjct: 78  PPPPPIIPAPSPPTAPPQPPPPPPPPPPPPPPPPPPTPPPTPP 120

[193][TOP]
>UniRef100_A9NTT1 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NTT1_PICSI
          Length = 197

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 40/114 (35%), Positives = 50/114 (43%), Gaps = 3/114 (2%)
 Frame = +1

Query: 46  MESSKIHAYLFLC-MLFLSSAAPILGCGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKP 222
           ME S+  A +FL  M+ +++  P +GC  C K  P +  P+        PP   PP   P
Sbjct: 1   MELSRTLAAIFLIVMVQMAAMVPAMGCLYCPKTPPYQSPPTTPVPSTPAPPTPAPPTPAP 60

Query: 223 PGI-VPPIVKPPVILPPVT-VPPVTVPPITVPPVVKPTLPPIPGVTPILPPVPV 378
           P    PP   PP   PP T  PP   PP   PP   P  P  P VTP     P+
Sbjct: 61  PTTPAPPTPAPPTPAPPTTPAPPTPAPPTPAPPTPAPPTPAPPAVTPSSNTCPI 114

[194][TOP]
>UniRef100_A8J9H7 Mastigoneme-like flagellar protein n=1 Tax=Chlamydomonas reinhardtii
            RepID=A8J9H7_CHLRE
          Length = 1987

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/93 (38%), Positives = 42/93 (45%)
 Frame = +1

Query: 121  CGTCGKPVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPP 300
            C    KP   + + S  P  P  PP   PP  +PP   PP  +PP   PP   PP T PP
Sbjct: 1840 CSLLSKPKTARTEQSPPPPSPSPPPP-PPPSPRPPSPNPPSPRPPSPAPPSPNPPPTSPP 1898

Query: 301  ITVPPVVKPTLPPIPGVTPILPPVPVLNPPSTP 399
             + PP   P  PP P   P  PP P  +PP  P
Sbjct: 1899 PSPPPSPPPPRPPPPPPPPPSPPPPNRSPPPPP 1931

[195][TOP]
>UniRef100_C3Z6S3 Putative uncharacterized protein n=1 Tax=Branchiostoma floridae
           RepID=C3Z6S3_BRAFL
          Length = 192

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 40/109 (36%), Positives = 49/109 (44%), Gaps = 17/109 (15%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGI--VPPIVKPPGIV---PPIVKPPVILPPVTV---PPVTV 294
           P P    P   P  P+ PP +   PPI  PP  +   PPI  PP I PP  +   PP+  
Sbjct: 6   PAPTAPPPPIAPPPPIAPPPMDPPPPIAPPPPPIAPPPPIAPPPPIAPPPPMDPPPPMAP 65

Query: 295 PPITVPPVVKPTLPPI---------PGVTPILPPVPVLNPPSTPTPTTP 414
           PP   PP   P  PP+         P +TP+ PP P + PP  P P  P
Sbjct: 66  PPPPPPPPAAPA-PPVPAPVPTPAPPSITPVPPPPPPVAPPPLPPPLMP 113

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/90 (38%), Positives = 41/90 (45%), Gaps = 1/90 (1%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVP-PITVPP 315
           P P    P   P  P+ PP   PP+  PP + PP   PP   P    PPV  P P   PP
Sbjct: 36  PPPIAPPPPIAPPPPIAPP---PPMDPPPPMAPPPPPPPP--PAAPAPPVPAPVPTPAPP 90

Query: 316 VVKPTLPPIPGVTPILPPVPVLNPPSTPTP 405
            + P  PP P V P   P P++ PP  P P
Sbjct: 91  SITPVPPPPPPVAPPPLPPPLMPPPLPPAP 120

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 39/105 (37%), Positives = 44/105 (41%), Gaps = 13/105 (12%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILP-PVTVPPVTVPPITVPP 315
           P P    P   P  P+ PP   PP   PP    P V  PV  P P ++ PV  PP   PP
Sbjct: 48  PPPIAPPPPMDPPPPMAPP---PPPPPPPAAPAPPVPAPVPTPAPPSITPVPPPP---PP 101

Query: 316 VVKPTLPPIPGVTPILPPVPVLN------------PPSTPTPTTP 414
           V  P LPP P + P LPP P  +            PP  P P  P
Sbjct: 102 VAPPPLPP-PLMPPPLPPAPNQDSRKGKPSPVPAPPPDPPAPAPP 145

[196][TOP]
>UniRef100_Q8L685 Pherophorin-dz1 protein n=1 Tax=Volvox carteri f. nagariensis
           RepID=Q8L685_VOLCA
          Length = 1009

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 37/92 (40%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP + PP   PP   PP   PP   PP   PP   PP 
Sbjct: 215 PPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P+P    P   P  P  PP  +PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 219 PLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 37/92 (40%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P LPP P   P  PP P   PP  P P  P
Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/92 (40%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P LPP P   PP  P P  P
Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 36/90 (40%), Positives = 37/90 (41%)
 Frame = +1

Query: 145 PKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPVVK 324
           P    PS  P  P  PP + PP   PP   PP   PP   PP   PP   PP   PP   
Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281

Query: 325 PTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
           P  PP P   P  PP P   PP  P P  P
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P+ PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP+P   P  PP P   PP  P P  P
Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 36/92 (39%), Positives = 38/92 (41%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP  +PP 
Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPS 678

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P+ P
Sbjct: 679 PPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPP 710

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 37/92 (40%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    PS  P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 37/92 (40%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PPS P P  P
Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP+P   PP  P P  P
Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P + P  PP P   PP  P P  P
Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P+P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P +P
Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 37/92 (40%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P+P  P
Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575

Query: 319 VKPTLPPIPGVTPILPPVPVLNPPSTPTPTTP 414
             P  PP P   P  PP P   PP  P P  P
Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/92 (39%), Positives = 36/92 (39%)
 Frame = +1

Query: 139 PVPKKHKPSKKPGKPVKPPGIVPPIVKPPGIVPPIVKPPVILPPVTVPPVTVPPITVPPV 318
           P P    P   P  P  PP   PP   PP   PP   PP   PP   PP   PP   PP 
Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576

Qu