AV418797 ( MWM161e08_r )

[UP]


[1][TOP]
>UniRef100_A5B1D3 Chromosome chr12 scaffold_18, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A5B1D3_VITVI
          Length = 259

 Score =  169 bits (429), Expect = 7e-41
 Identities = 82/106 (77%), Positives = 98/106 (92%), Gaps = 1/106 (0%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVVSIKPNQIVCRAQKQQ-DVEDVSPVSRRLALTLLI 281
           MAST CFLHHHAL+TPTR SSQRQ+ S++P+Q+VCRAQKQ  + +D + VSRRLALT+LI
Sbjct: 1   MASTACFLHHHALSTPTRVSSQRQLPSLRPSQLVCRAQKQAANEDDGAAVSRRLALTVLI 60

Query: 282 GAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           GAAA+G+KV+PADAAYGEAANVFGKPK+NTDFLPYNG+GFKLSIP+
Sbjct: 61  GAAAIGTKVNPADAAYGEAANVFGKPKTNTDFLPYNGEGFKLSIPS 106

[2][TOP]
>UniRef100_C6TL82 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TL82_SOYBN
          Length = 264

 Score =  169 bits (427), Expect = 1e-40
 Identities = 86/110 (78%), Positives = 97/110 (88%), Gaps = 5/110 (4%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPT--RTSSQRQVVSIKPNQIVCRAQKQQDVE---DVSPVSRRLAL 269
           MASTQCFLHHHALT+P   R+ S R +VS KPNQ+VC+AQKQQ  +   DVSP+SRRLAL
Sbjct: 1   MASTQCFLHHHALTSPASARSPSLRILVSTKPNQLVCKAQKQQTPQEDIDVSPISRRLAL 60

Query: 270 TLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           T+LIGAAAVGSKV PADAAYGEAANVFGKPK++TDFLPYNGDGFKLSIP+
Sbjct: 61  TVLIGAAAVGSKVQPADAAYGEAANVFGKPKTDTDFLPYNGDGFKLSIPS 110

[3][TOP]
>UniRef100_A9PGP9 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PGP9_POPTR
          Length = 262

 Score =  168 bits (425), Expect = 2e-40
 Identities = 85/108 (78%), Positives = 96/108 (88%), Gaps = 3/108 (2%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRT--SSQRQVVSIKPNQIVCRAQKQQ-DVEDVSPVSRRLALTL 275
           MAST CFLHHHALTTP R+  SSQRQVV++KP Q+VCRAQKQ    ED   VSRRLALT+
Sbjct: 1   MASTACFLHHHALTTPARSTSSSQRQVVNLKPAQLVCRAQKQAVQEEDDGVVSRRLALTV 60

Query: 276 LIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           LIGAAA+GSKV+PADAAYGE+AN+FGKPK+NTDFLPYNGDGFKLS+PA
Sbjct: 61  LIGAAALGSKVAPADAAYGESANIFGKPKTNTDFLPYNGDGFKLSVPA 108

[4][TOP]
>UniRef100_P16059 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Pisum
           sativum RepID=PSBP_PEA
          Length = 259

 Score =  168 bits (425), Expect = 2e-40
 Identities = 86/106 (81%), Positives = 96/106 (90%), Gaps = 1/106 (0%)
 Frame = +3

Query: 105 MASTQCFLHH-HALTTPTRTSSQRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLALTLLI 281
           MASTQCFLHH +A+TTPTRT SQRQVV+ KPN IVC+AQKQ DV D + VSRRLAL++LI
Sbjct: 1   MASTQCFLHHQYAITTPTRTLSQRQVVTTKPNHIVCKAQKQDDVVD-AVVSRRLALSVLI 59

Query: 282 GAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           GAAAVGSKVSPADAAYGEAANVFGK K+NTD+LPYNGDGFKL +PA
Sbjct: 60  GAAAVGSKVSPADAAYGEAANVFGKAKTNTDYLPYNGDGFKLLVPA 105

[5][TOP]
>UniRef100_A9PHM0 Putative uncharacterized protein n=1 Tax=Populus trichocarpa
           RepID=A9PHM0_POPTR
          Length = 262

 Score =  163 bits (413), Expect = 5e-39
 Identities = 81/108 (75%), Positives = 94/108 (87%), Gaps = 3/108 (2%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRT--SSQRQVVSIKPNQIVCRAQKQQ-DVEDVSPVSRRLALTL 275
           MAST CFLHHHALTTP R+  SSQRQV ++KP Q+ CRAQKQ    ED   VSRRLALT+
Sbjct: 1   MASTSCFLHHHALTTPARSTPSSQRQVANLKPTQLACRAQKQAVQEEDNGAVSRRLALTV 60

Query: 276 LIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           LIGAAA+GSKV+PADAAYGE+AN+FGKPK++TDFLPYNGDGFKLS+P+
Sbjct: 61  LIGAAALGSKVAPADAAYGESANIFGKPKTDTDFLPYNGDGFKLSVPS 108

[6][TOP]
>UniRef100_B7FJ16 Putative uncharacterized protein n=1 Tax=Medicago truncatula
           RepID=B7FJ16_MEDTR
          Length = 261

 Score =  162 bits (410), Expect = 1e-38
 Identities = 86/108 (79%), Positives = 97/108 (89%), Gaps = 3/108 (2%)
 Frame = +3

Query: 105 MASTQCFLH-HHALTTPTRTSSQRQVVSIKPNQIVCRAQKQQDVEDV--SPVSRRLALTL 275
           MASTQCFLH  +ALTTP+R+ SQRQ+V+ KPN IVC+AQKQ DVEDV  S VSRRLAL++
Sbjct: 1   MASTQCFLHPQYALTTPSRSLSQRQIVTNKPNHIVCKAQKQ-DVEDVAVSVVSRRLALSV 59

Query: 276 LIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           L+GAAAVGSKVSPADAAYGEAANVFGK K+NTDFLPYNGDGFKL +PA
Sbjct: 60  LLGAAAVGSKVSPADAAYGEAANVFGKAKTNTDFLPYNGDGFKLLVPA 107

[7][TOP]
>UniRef100_C6T8W8 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6T8W8_SOYBN
          Length = 265

 Score =  160 bits (405), Expect = 4e-38
 Identities = 86/111 (77%), Positives = 95/111 (85%), Gaps = 6/111 (5%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVVSIKPNQIVCRA-QKQ---QDVEDVSP--VSRRLA 266
           MASTQCFLHHHALTTP R S+QR VVS KPN IVC+A QKQ   Q+ ED +   VSRRLA
Sbjct: 1   MASTQCFLHHHALTTPARASTQRLVVSTKPNHIVCKAVQKQVTVQEGEDTTTGLVSRRLA 60

Query: 267 LTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           LT+LIGAAAVGSKV+PADAAYGEAANVFGKPK+NTDFL YNG+GFK SIP+
Sbjct: 61  LTVLIGAAAVGSKVAPADAAYGEAANVFGKPKTNTDFLSYNGNGFKPSIPS 111

[8][TOP]
>UniRef100_Q2PET1 Putative PSII-P protein (Fragment) n=1 Tax=Trifolium pratense
           RepID=Q2PET1_TRIPR
          Length = 261

 Score =  158 bits (399), Expect = 2e-37
 Identities = 81/104 (77%), Positives = 92/104 (88%), Gaps = 3/104 (2%)
 Frame = +3

Query: 117 QCFLHH-HALTTPTRTSSQRQVVSIKPNQIVCRAQKQQD--VEDVSPVSRRLALTLLIGA 287
           QCFLHH +ALTTP+R+ SQRQ+VS KPN IVC+AQKQ D  V  VS VSRRLAL++++GA
Sbjct: 4   QCFLHHQYALTTPSRSLSQRQIVSTKPNHIVCKAQKQDDDDVAAVSFVSRRLALSVILGA 63

Query: 288 AAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           AAVGSKVSPADAAYGEAANVFGK K+NTDFLPYNGDGFKL +PA
Sbjct: 64  AAVGSKVSPADAAYGEAANVFGKAKTNTDFLPYNGDGFKLLVPA 107

[9][TOP]
>UniRef100_Q40457 23 kDa polypeptide of water-oxidizing complex of photosystem II n=1
           Tax=Nicotiana tabacum RepID=Q40457_TOBAC
          Length = 268

 Score =  154 bits (389), Expect = 3e-36
 Identities = 82/114 (71%), Positives = 91/114 (79%), Gaps = 9/114 (7%)
 Frame = +3

Query: 105 MASTQCFLHHHALT-----TPTRTSSQRQVVSIKPNQIVCRAQKQ----QDVEDVSPVSR 257
           MASTQCFLH HAL+     T +  SSQR V S+KPNQ+VCRAQKQ    +D  +   VSR
Sbjct: 1   MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSPQEDDGNSVVVSR 60

Query: 258 RLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           RLALT+LIGAAA+GSKVSPADAAYGEAANVFGKPK NTDFL YNGDGFKL +PA
Sbjct: 61  RLALTVLIGAAAIGSKVSPADAAYGEAANVFGKPKKNTDFLAYNGDGFKLQVPA 114

[10][TOP]
>UniRef100_Q7DM39 Oxygen-evolving enhancer protein 2-1, chloroplastic n=1
           Tax=Nicotiana tabacum RepID=PSBP1_TOBAC
          Length = 268

 Score =  154 bits (389), Expect = 3e-36
 Identities = 82/114 (71%), Positives = 91/114 (79%), Gaps = 9/114 (7%)
 Frame = +3

Query: 105 MASTQCFLHHHALT-----TPTRTSSQRQVVSIKPNQIVCRAQKQ----QDVEDVSPVSR 257
           MASTQCFLH HAL+     T +  SSQR V S+KPNQ+VCRAQKQ    +D  +   VSR
Sbjct: 1   MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSPQEDDGNSVVVSR 60

Query: 258 RLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           RLALT+LIGAAA+GSKVSPADAAYGEAANVFGKPK NTDFL YNGDGFKL +PA
Sbjct: 61  RLALTVLIGAAAIGSKVSPADAAYGEAANVFGKPKENTDFLAYNGDGFKLQVPA 114

[11][TOP]
>UniRef100_P93566 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Solanum
           tuberosum RepID=PSBP_SOLTU
          Length = 260

 Score =  153 bits (386), Expect = 6e-36
 Identities = 83/107 (77%), Positives = 90/107 (84%), Gaps = 3/107 (2%)
 Frame = +3

Query: 108 ASTQCFLH-HHAL-TTPTRTSSQRQVVSIKPNQIVCRAQKQQDVEDVS-PVSRRLALTLL 278
           ASTQCFLH +HAL ++P RTSS   V S KPNQ++CRAQKQ D  + S  VSRRLALTLL
Sbjct: 3   ASTQCFLHQYHALRSSPARTSS---VPSPKPNQLICRAQKQDDANNTSNAVSRRLALTLL 59

Query: 279 IGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           IG AA+GSKVSPADAAYGEAANVFGKPK NTDFLPYNGDGFKL IPA
Sbjct: 60  IGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQIPA 106

[12][TOP]
>UniRef100_P18212 Oxygen-evolving enhancer protein 2-2, chloroplastic n=1
           Tax=Nicotiana tabacum RepID=PSBP2_TOBAC
          Length = 265

 Score =  153 bits (386), Expect = 6e-36
 Identities = 84/112 (75%), Positives = 93/112 (83%), Gaps = 7/112 (6%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVV-SIKPNQI-VCRAQKQQ-----DVEDVSPVSRRL 263
           MASTQCFLHHHAL+TP RT   R +V S+KPNQ+ VCRAQKQ      +V  VS VSRRL
Sbjct: 1   MASTQCFLHHHALSTPARTPLVRSIVPSLKPNQLLVCRAQKQSAPQEDNVNSVS-VSRRL 59

Query: 264 ALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           ALT+LIGAAAVGSKVSPADAAYGEAANVFGKPK++TDF  YNGDGFKL IP+
Sbjct: 60  ALTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPS 111

[13][TOP]
>UniRef100_Q04126 23-kDa ploypeptide of photosystem II oxygen-evolving complex n=1
           Tax=Nicotiana tabacum RepID=Q04126_TOBAC
          Length = 266

 Score =  152 bits (383), Expect = 1e-35
 Identities = 80/112 (71%), Positives = 88/112 (78%), Gaps = 9/112 (8%)
 Frame = +3

Query: 111 STQCFLHHHALT-----TPTRTSSQRQVVSIKPNQIVCRAQKQQDVEDVS----PVSRRL 263
           STQCFLH HAL+     T +  SSQR V S+KPNQ+VCRAQKQ   ++       VSRRL
Sbjct: 1   STQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSAQEDDGNSVAVSRRL 60

Query: 264 ALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           ALT+LIGAAAVGSKVSPADAAYGEAANVFGKPK NTDFL YNGDGFKL +PA
Sbjct: 61  ALTVLIGAAAVGSKVSPADAAYGEAANVFGKPKQNTDFLAYNGDGFKLQVPA 112

[14][TOP]
>UniRef100_Q04125 23-dDa polypeptide of Photosystem II oxygen-evolving complex
           (Fragment) n=1 Tax=Nicotiana tabacum RepID=Q04125_TOBAC
          Length = 166

 Score =  152 bits (383), Expect = 1e-35
 Identities = 81/114 (71%), Positives = 89/114 (78%), Gaps = 9/114 (7%)
 Frame = +3

Query: 105 MASTQCFLHHHALT-----TPTRTSSQRQVVSIKPNQIVCRAQKQQDVEDVS----PVSR 257
           MASTQCFLH HAL+     T +  SSQR V S+KPNQ+VCRAQKQ   ++       VSR
Sbjct: 1   MASTQCFLHQHALSSSAARTTSSVSSQRYVSSLKPNQLVCRAQKQSSAQEDDGNSVAVSR 60

Query: 258 RLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           RLALT+LIGAAAV SKVSPADAAYGEAANVFGKPK NTDFL YNGDGFKL +PA
Sbjct: 61  RLALTVLIGAAAVVSKVSPADAAYGEAANVFGKPKQNTDFLAYNGDGFKLQVPA 114

[15][TOP]
>UniRef100_P29795 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Solanum
           lycopersicum RepID=PSBP_SOLLC
          Length = 258

 Score =  152 bits (383), Expect = 1e-35
 Identities = 81/106 (76%), Positives = 90/106 (84%), Gaps = 2/106 (1%)
 Frame = +3

Query: 108 ASTQCFLH-HHAL-TTPTRTSSQRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLALTLLI 281
           ASTQCFLH +HAL ++P RTSS   V S KPNQ++CRAQKQ D  + + VSRRLALTLLI
Sbjct: 3   ASTQCFLHQYHALRSSPARTSS---VSSPKPNQLICRAQKQDDASNAA-VSRRLALTLLI 58

Query: 282 GAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           G AA+GSKVSPADAAYGEAANVFGKPK NTDFLPYNGDGFKL +PA
Sbjct: 59  GTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQVPA 104

[16][TOP]
>UniRef100_A9XNJ1 23kDa polypeptide of the oxygen evolving complex of photosystem II
           (Fragment) n=1 Tax=Sonneratia caseolaris
           RepID=A9XNJ1_9MYRT
          Length = 233

 Score =  151 bits (381), Expect = 2e-35
 Identities = 78/99 (78%), Positives = 86/99 (86%), Gaps = 1/99 (1%)
 Frame = +3

Query: 126 LHHHALTTPTRTSSQRQVVSIKPNQIVCRAQKQQD-VEDVSPVSRRLALTLLIGAAAVGS 302
           LHH +LTTP RTSS R VV+ +  Q VCRAQKQ    EDV+ VSRRLALT+LIGAAAVGS
Sbjct: 1   LHHLSLTTPARTSSPRYVVNSRSTQTVCRAQKQTSGEEDVAVVSRRLALTVLIGAAAVGS 60

Query: 303 KVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           KVSPADAAYGEAANVFGKPK+NTDFLPYNGDGFKL+IP+
Sbjct: 61  KVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKLNIPS 99

[17][TOP]
>UniRef100_A9XNJ0 23kDa polypeptide of the oxygen evolving complex of photosystem II
           (Fragment) n=1 Tax=Sonneratia alba RepID=A9XNJ0_9MYRT
          Length = 234

 Score =  151 bits (381), Expect = 2e-35
 Identities = 78/99 (78%), Positives = 86/99 (86%), Gaps = 1/99 (1%)
 Frame = +3

Query: 126 LHHHALTTPTRTSSQRQVVSIKPNQIVCRAQKQQD-VEDVSPVSRRLALTLLIGAAAVGS 302
           LHH +LTTP RTSS R VV+ +  Q VCRAQKQ    EDV+ VSRRLALT+LIGAAAVGS
Sbjct: 1   LHHLSLTTPARTSSPRYVVNSRSTQTVCRAQKQTSGEEDVAVVSRRLALTVLIGAAAVGS 60

Query: 303 KVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           KVSPADAAYGEAANVFGKPK+NTDFLPYNGDGFKL+IP+
Sbjct: 61  KVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKLNIPS 99

[18][TOP]
>UniRef100_P12302 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Spinacia
           oleracea RepID=PSBP_SPIOL
          Length = 267

 Score =  150 bits (380), Expect = 3e-35
 Identities = 82/113 (72%), Positives = 94/113 (83%), Gaps = 8/113 (7%)
 Frame = +3

Query: 105 MASTQCFLHHHA-LTTPTR---TSSQR-QVVSIKPNQIVCRAQKQQDVEDV---SPVSRR 260
           MAST CFLHHHA +++P     +++QR Q VSIKPNQIVC+AQKQ D E     S VSRR
Sbjct: 1   MASTACFLHHHAAISSPAAGRGSAAQRYQAVSIKPNQIVCKAQKQDDNEANVLNSGVSRR 60

Query: 261 LALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           LALT+LIGAAAVGSKVSPADAAYGEAANVFGKPK NT+F+PYNGDGFKL +P+
Sbjct: 61  LALTVLIGAAAVGSKVSPADAAYGEAANVFGKPKKNTEFMPYNGDGFKLLVPS 113

[19][TOP]
>UniRef100_Q04127 Oxygen-evolving enhancer protein 2-3, chloroplastic n=1
           Tax=Nicotiana tabacum RepID=PSBP3_TOBAC
          Length = 266

 Score =  150 bits (380), Expect = 3e-35
 Identities = 83/112 (74%), Positives = 91/112 (81%), Gaps = 7/112 (6%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVV-SIKPNQI-VCRAQK-----QQDVEDVSPVSRRL 263
           MASTQCFLHHHAL+TP RTS  R +V S+K NQ+ VCRAQ      QQD  +   VSRRL
Sbjct: 1   MASTQCFLHHHALSTPARTSLVRGIVPSLKSNQLLVCRAQNKQSAPQQDNVNSVSVSRRL 60

Query: 264 ALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           ALTLLIGAAAVGSKVSPADAAYGEAANVFGKPK++TDF  YNGDGFKL IP+
Sbjct: 61  ALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPS 112

[20][TOP]
>UniRef100_Q9SLQ8 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Cucumis
           sativus RepID=PSBP_CUCSA
          Length = 263

 Score =  150 bits (379), Expect = 4e-35
 Identities = 78/109 (71%), Positives = 89/109 (81%), Gaps = 4/109 (3%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVVSI--KPNQIVCRAQKQQDV--EDVSPVSRRLALT 272
           MAST CFLHHHALT   R+SS  +  ++   P  +VCRAQKQQ    E+   VSRRLALT
Sbjct: 1   MASTSCFLHHHALTAAARSSSSPRQAALPKSPQLLVCRAQKQQPAQEEEGGVVSRRLALT 60

Query: 273 LLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           +LIGAAA+GSKVSPADAAYGEAANVFGKPKSNTD+LPY+GDGFKLSIP+
Sbjct: 61  VLIGAAALGSKVSPADAAYGEAANVFGKPKSNTDYLPYSGDGFKLSIPS 109

[21][TOP]
>UniRef100_B9S6F7 Oxygen-evolving enhancer protein 2, chloroplast, putative n=1
           Tax=Ricinus communis RepID=B9S6F7_RICCO
          Length = 265

 Score =  149 bits (375), Expect = 1e-34
 Identities = 81/111 (72%), Positives = 93/111 (83%), Gaps = 6/111 (5%)
 Frame = +3

Query: 105 MASTQCFLHHHALT-TPTRTSS--QRQVVSI-KPNQIVCRAQKQQDV--EDVSPVSRRLA 266
           MA+T CFLHH ALT TP R SS  QRQV +  KP Q +CRA  +Q +  ED+S VSRRLA
Sbjct: 1   MATTGCFLHHPALTSTPNRLSSVSQRQVSNTTKPTQFICRASTKQPLQEEDLSLVSRRLA 60

Query: 267 LTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           LT+LIGAAAVGSKVSPADAAYGEAANVFGKPK+NTDF+PYNGDGF+LS+P+
Sbjct: 61  LTVLIGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFMPYNGDGFQLSVPS 111

[22][TOP]
>UniRef100_A9XNJ2 23kDa polypeptide of the oxygen evolving complex of photosystem II
           (Fragment) n=1 Tax=Sonneratia ovata RepID=A9XNJ2_9MYRT
          Length = 233

 Score =  148 bits (374), Expect = 2e-34
 Identities = 76/99 (76%), Positives = 85/99 (85%), Gaps = 1/99 (1%)
 Frame = +3

Query: 126 LHHHALTTPTRTSSQRQVVSIKPNQIVCRAQKQQD-VEDVSPVSRRLALTLLIGAAAVGS 302
           LHH +LTTP RTSS R V + +  Q VCRAQKQ    EDV+ VSRRLALT+LIGAAAVGS
Sbjct: 1   LHHLSLTTPARTSSPRHVANSRSTQTVCRAQKQTSGEEDVAVVSRRLALTVLIGAAAVGS 60

Query: 303 KVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           KVSPADAAYGEAANVFGKPK+NT+FLPYNGDGFKL+IP+
Sbjct: 61  KVSPADAAYGEAANVFGKPKTNTEFLPYNGDGFKLNIPS 99

[23][TOP]
>UniRef100_A9XNJ3 23kDa polypeptide of the oxygen evolving complex of photosystem II
           (Fragment) n=1 Tax=Sonneratia apetala RepID=A9XNJ3_9MYRT
          Length = 233

 Score =  147 bits (370), Expect = 5e-34
 Identities = 76/99 (76%), Positives = 85/99 (85%), Gaps = 1/99 (1%)
 Frame = +3

Query: 126 LHHHALTTPTRTSSQRQVVSIKPNQIVCRAQKQQD-VEDVSPVSRRLALTLLIGAAAVGS 302
           LHH +LTTP RTSS R VV+ +  Q VC AQKQ    EDV+ VSRRLALT+LIGAAAVGS
Sbjct: 1   LHHLSLTTPARTSSPRHVVNSRSTQTVCWAQKQTSGEEDVAVVSRRLALTVLIGAAAVGS 60

Query: 303 KVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           KVSPADAAYGEAANVFGKPK+NT+FLPYNGDGFKL+IP+
Sbjct: 61  KVSPADAAYGEAANVFGKPKTNTEFLPYNGDGFKLNIPS 99

[24][TOP]
>UniRef100_B5BT07 23 kDa protein of the oxygen-evolving complex n=1 Tax=Salicornia
           europaea RepID=B5BT07_SALEU
          Length = 265

 Score =  142 bits (357), Expect = 1e-32
 Identities = 76/111 (68%), Positives = 86/111 (77%), Gaps = 6/111 (5%)
 Frame = +3

Query: 105 MASTQCFLHHHALTT---PTRTSSQR-QVVSIKPNQIVCRAQKQQDVEDV--SPVSRRLA 266
           MAST CFLHHHA  +     R  +Q+ Q VS+KPNQIVC+ QKQ D      S VSRRLA
Sbjct: 1   MASTACFLHHHAAISGPASARNPAQKYQAVSMKPNQIVCKVQKQDDEAQALNSSVSRRLA 60

Query: 267 LTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           LT+LIGAAAVGSKVSPADAAYGEAANVFGKPK +T+F  YNGDGFKL +P+
Sbjct: 61  LTVLIGAAAVGSKVSPADAAYGEAANVFGKPKKDTEFSSYNGDGFKLLVPS 111

[25][TOP]
>UniRef100_O49080 Oxygen-evolving enhancer protein 2, chloroplastic n=1
           Tax=Fritillaria agrestis RepID=PSBP_FRIAG
          Length = 264

 Score =  142 bits (357), Expect = 1e-32
 Identities = 73/110 (66%), Positives = 89/110 (80%), Gaps = 5/110 (4%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTP---TRTSSQRQVVSIKPNQIVCRAQKQQDVEDVSP--VSRRLAL 269
           MAS+ CFL HHA +TP   +RT S R V +IKP+Q++CRAQK  D ++ S   VSRRLAL
Sbjct: 1   MASSACFLLHHAPSTPATTSRTPSHRLVPTIKPSQLICRAQKSSDTDENSSTAVSRRLAL 60

Query: 270 TLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           T+LIG+AAVG+K++PA+AAYGEAANVFGK K+NTDFLPY GDGF L IPA
Sbjct: 61  TILIGSAAVGTKIAPANAAYGEAANVFGKAKTNTDFLPYTGDGFNLLIPA 110

[26][TOP]
>UniRef100_Q58H59 Chloroplast photosynthetic oxygen-evolving protein 23 kDa subunit
           (Fragment) n=1 Tax=Nicotiana benthamiana
           RepID=Q58H59_NICBE
          Length = 261

 Score =  141 bits (355), Expect = 3e-32
 Identities = 75/107 (70%), Positives = 87/107 (81%), Gaps = 6/107 (5%)
 Frame = +3

Query: 117 QCFLHHHALTTPTRTSSQRQVV-SIKPNQI-VCRAQKQ----QDVEDVSPVSRRLALTLL 278
           QCFLH HAL+TP RT   R +V S+KPNQ+ VCRAQKQ    +D  +   +SRRLALTLL
Sbjct: 1   QCFLHQHALSTPARTPLVRSIVPSLKPNQLLVCRAQKQSAPQEDNVNSLSLSRRLALTLL 60

Query: 279 IGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           IG+AA+GSKVSPADAAYGEAANVFGKPK++TDF  YNGDGFKL IP+
Sbjct: 61  IGSAAIGSKVSPADAAYGEAANVFGKPKTDTDFQTYNGDGFKLQIPS 107

[27][TOP]
>UniRef100_Q42029 Oxygen-evolving enhancer protein 2-1, chloroplastic n=1
           Tax=Arabidopsis thaliana RepID=PSBP1_ARATH
          Length = 263

 Score =  141 bits (355), Expect = 3e-32
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 5/110 (4%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTP-----TRTSSQRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLAL 269
           MA + CFLH  AL +      + +SSQR V   KP QI+C+AQ+  + +D S VSRRLAL
Sbjct: 1   MAYSACFLHQSALASSAARSSSSSSSQRHVSLSKPVQIICKAQQSHE-DDNSAVSRRLAL 59

Query: 270 TLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           TLL+GAAAVGSKVSPADAAYGEAANVFGKPK+NTDFLPYNGDGFK+ +PA
Sbjct: 60  TLLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKVQVPA 109

[28][TOP]
>UniRef100_C6JT03 23 kDa polypeptide of the oxygen evolving complex of photosystem II
           (Fragment) n=1 Tax=Sonneratia alba RepID=C6JT03_9MYRT
          Length = 214

 Score =  136 bits (342), Expect = 8e-31
 Identities = 71/89 (79%), Positives = 78/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query: 156 RTSSQRQVVSIKPNQIVCRAQKQQD-VEDVSPVSRRLALTLLIGAAAVGSKVSPADAAYG 332
           RTSS R VV+ +  Q VCRAQKQ    EDV+ VSRRLALT+LIGAAAVGSKVSPADAAYG
Sbjct: 2   RTSSPRYVVNSRSTQTVCRAQKQTSGEEDVAVVSRRLALTVLIGAAAVGSKVSPADAAYG 61

Query: 333 EAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           EAANVFGKPK+NTDFLPYNGDGFKL+IP+
Sbjct: 62  EAANVFGKPKTNTDFLPYNGDGFKLNIPS 90

[29][TOP]
>UniRef100_Q8GZB2 PsbP (Fragment) n=1 Tax=Xerophyta humilis RepID=Q8GZB2_9LILI
          Length = 244

 Score =  130 bits (328), Expect = 3e-29
 Identities = 66/105 (62%), Positives = 81/105 (77%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLALTLLIG 284
           MAST CFLH    T  +R SSQR   S +  Q+VC+AQ   D E+ + +SRRL LT+L+G
Sbjct: 1   MASTACFLHLAPSTAVSRASSQRLAPSFRTTQVVCKAQNHDD-ENNAVISRRLTLTVLVG 59

Query: 285 AAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           AAAVG+KV+PADAAYGEAANVFG+PK+NTDFL Y GDGFK+ IP+
Sbjct: 60  AAAVGAKVNPADAAYGEAANVFGRPKTNTDFLTYAGDGFKVLIPS 104

[30][TOP]
>UniRef100_P11594 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Sinapis
           alba RepID=PSBP_SINAL
          Length = 260

 Score =  127 bits (318), Expect = 5e-28
 Identities = 69/109 (63%), Positives = 85/109 (77%), Gaps = 4/109 (3%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTR----TSSQRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLALT 272
           MA + CFLH  AL + T     +SS ++ VSI  +++VC+AQ+  + ED S VSRRLALT
Sbjct: 1   MAYSACFLHQSALASSTARSSPSSSSQRYVSI--SKLVCKAQQTHE-EDNSTVSRRLALT 57

Query: 273 LLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           LL+GAAAVGSKVSPADAAYGEAANVFGKPK NTDF  Y+GDGF++ +PA
Sbjct: 58  LLVGAAAVGSKVSPADAAYGEAANVFGKPKKNTDFTAYSGDGFQVQVPA 106

[31][TOP]
>UniRef100_A7LNN9 Chloroplast oxygen-evolving enhancer protein 2 n=1 Tax=Limonium
           bicolor RepID=A7LNN9_9CARY
          Length = 268

 Score =  115 bits (287), Expect = 2e-24
 Identities = 64/115 (55%), Positives = 83/115 (72%), Gaps = 10/115 (8%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTS-----SQRQVVSIKPNQ--IVCRAQKQQDVEDVS---PVS 254
           MAST CF HH+AL++ + ++     SQRQ +S   +   ++C AQKQ  + + +    +S
Sbjct: 1   MASTACFSHHYALSSSSNSARNSLASQRQGLSTSKSGALVICNAQKQDQISNTAVNESIS 60

Query: 255 RRLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           RRLALTL +GAAAVGSKV+PADAAYGE+ANVFGK K+ TDF  Y G+GFKL IPA
Sbjct: 61  RRLALTLFVGAAAVGSKVNPADAAYGESANVFGKQKT-TDFTAYVGEGFKLQIPA 114

[32][TOP]
>UniRef100_C5X9F7 Putative uncharacterized protein Sb02g002690 n=1 Tax=Sorghum
           bicolor RepID=C5X9F7_SORBI
          Length = 261

 Score =  110 bits (275), Expect = 5e-23
 Identities = 62/110 (56%), Positives = 77/110 (70%), Gaps = 5/110 (4%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVVSIKPNQI-VCRAQKQQDVE----DVSPVSRRLAL 269
           MAST CFLH    +T    +S R   + +  Q+ VC+AQ++Q  +    D S VSRR AL
Sbjct: 1   MASTSCFLHQ---STARLGASPRVAAAPRSAQLFVCKAQQKQQQDAAAVDQSDVSRRAAL 57

Query: 270 TLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
            L  G AAVG+KVSPA AAYGEAANVFGKPK+NT+++ YNGDGFKL IP+
Sbjct: 58  ALFAGVAAVGAKVSPAAAAYGEAANVFGKPKTNTEYIAYNGDGFKLLIPS 107

[33][TOP]
>UniRef100_A2YI23 Putative uncharacterized protein n=1 Tax=Oryza sativa Indica Group
           RepID=A2YI23_ORYSI
          Length = 191

 Score =  109 bits (273), Expect = 8e-23
 Identities = 61/106 (57%), Positives = 73/106 (68%), Gaps = 1/106 (0%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLALTLLIG 284
           MAST CFLH        R +S       + + +VCRAQKQ D +    VSRR AL LL G
Sbjct: 1   MASTSCFLHQSTARVAARVASPSPAT--RTHLLVCRAQKQDDAD----VSRRAALALLAG 54

Query: 285 A-AAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           A AAVG KV+PA AAYGEAANVFGKPK+NT+F+ Y+G+GFKL IP+
Sbjct: 55  ATAAVGVKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPS 100

[34][TOP]
>UniRef100_Q8GTK4 Os07g0141400 protein n=3 Tax=Oryza sativa RepID=Q8GTK4_ORYSJ
          Length = 254

 Score =  109 bits (273), Expect = 8e-23
 Identities = 61/106 (57%), Positives = 73/106 (68%), Gaps = 1/106 (0%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLALTLLIG 284
           MAST CFLH        R +S       + + +VCRAQKQ D +    VSRR AL LL G
Sbjct: 1   MASTSCFLHQSTARVAARVASPSPAT--RTHLLVCRAQKQDDAD----VSRRAALALLAG 54

Query: 285 A-AAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           A AAVG KV+PA AAYGEAANVFGKPK+NT+F+ Y+G+GFKL IP+
Sbjct: 55  ATAAVGVKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPS 100

[35][TOP]
>UniRef100_Q40407 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Narcissus
           pseudonarcissus RepID=PSBP_NARPS
          Length = 265

 Score =  107 bits (266), Expect = 5e-22
 Identities = 58/111 (52%), Positives = 75/111 (67%), Gaps = 6/111 (5%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVVSIKPNQIVCRAQKQQD------VEDVSPVSRRLA 266
           MAST CFLHHHA +  T   S+ +  + +  Q    + + Q        E+ + +SRRLA
Sbjct: 1   MASTACFLHHHAPSPATSNLSRTRSATNRDEQQQEHSARLQSPEADCATENDALLSRRLA 60

Query: 267 LTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           LT+LIG AA+GS+VS ADAAYGE+ANVFGKPK+NTDF    GDGFK+ IP+
Sbjct: 61  LTILIGGAALGSRVSAADAAYGESANVFGKPKTNTDFQTVTGDGFKILIPS 111

[36][TOP]
>UniRef100_O22536 23kDa polypeptide of photosystem II n=1 Tax=Oryza sativa
           RepID=O22536_ORYSA
          Length = 254

 Score =  105 bits (262), Expect = 2e-21
 Identities = 58/106 (54%), Positives = 70/106 (66%), Gaps = 1/106 (0%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLALTLLIG 284
           MAST CFLH        R +S       + + +VCRAQKQ D +     SRR AL LL G
Sbjct: 1   MASTSCFLHQSTARVAARVASPSPAT--RTHLLVCRAQKQDDAD----FSRRAALALLAG 54

Query: 285 A-AAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
             AAVG  V+P  AAYGEAANVFGKPK+NT+F+PY+G+GFKL IP+
Sbjct: 55  TTAAVGVNVAPPAAAYGEAANVFGKPKTNTEFIPYSGEGFKLLIPS 100

[37][TOP]
>UniRef100_Q00434 Oxygen-evolving enhancer protein 2, chloroplastic n=1 Tax=Triticum
           aestivum RepID=PSBP_WHEAT
          Length = 258

 Score =  105 bits (261), Expect = 2e-21
 Identities = 60/108 (55%), Positives = 73/108 (67%), Gaps = 3/108 (2%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVVSIKPNQI-VCRAQKQQDVEDVSPV--SRRLALTL 275
           MAST CFLH    +T    +S R   ++   Q+ VC+AQK  +    + V  SRR AL+L
Sbjct: 1   MASTSCFLHQ---STARLAASARPAPAVGRTQLFVCKAQKNDEAASDAAVVTSRRAALSL 57

Query: 276 LIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           L GAAA+  KVSPA AAYGEAANVFGK K NTDF+ Y+G+GFKL IPA
Sbjct: 58  LAGAAAIAVKVSPAAAAYGEAANVFGKAKKNTDFVAYSGEGFKLMIPA 105

[38][TOP]
>UniRef100_Q96334 Oxygen-evolving enhancer protein 2, chloroplastic (Fragment) n=1
           Tax=Brassica juncea RepID=PSBP_BRAJU
          Length = 217

 Score =  104 bits (259), Expect = 3e-21
 Identities = 50/62 (80%), Positives = 56/62 (90%)
 Frame = +3

Query: 234 EDVSPVSRRLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSI 413
           +D S VSRRLALTLL+GAAAVGSKVSPADAAYGEAANVFGKPK+NTDF   NGDGF++ +
Sbjct: 2   DDTSTVSRRLALTLLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFTAINGDGFQVQV 61

Query: 414 PA 419
           PA
Sbjct: 62  PA 63

[39][TOP]
>UniRef100_C0Z3I6 AT1G06680 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z3I6_ARATH
          Length = 168

 Score = 89.4 bits (220), Expect(2) = 7e-21
 Identities = 51/83 (61%), Positives = 61/83 (73%), Gaps = 5/83 (6%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTP-----TRTSSQRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLAL 269
           MA + CFLH  AL +      + +SSQR V   KP QI+C+AQ+  + +D S VSRRLAL
Sbjct: 1   MAYSACFLHQSALASSAARSSSSSSSQRHVSLSKPVQIICKAQQSHE-DDNSAVSRRLAL 59

Query: 270 TLLIGAAAVGSKVSPADAAYGEA 338
           TLL+GAAAVGSKVSPADAAYGEA
Sbjct: 60  TLLVGAAAVGSKVSPADAAYGEA 82

 Score = 34.7 bits (78), Expect(2) = 7e-21
 Identities = 16/25 (64%), Positives = 17/25 (68%)
 Frame = +1

Query: 340 QMCLESQSQTQTSCHTMVMDSNYPF 414
           Q CL SQ +TQTSCHTM M S   F
Sbjct: 87  QTCLGSQRRTQTSCHTMEMGSKCRF 111

[40][TOP]
>UniRef100_B8LMQ7 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=B8LMQ7_PICSI
          Length = 272

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 53/77 (68%), Positives = 60/77 (77%), Gaps = 2/77 (2%)
 Frame = +3

Query: 195 NQIVCRAQKQQDVEDV-SPVSRR-LALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSN 368
           N I CRA KQ D E V SP +RR +ALTLL GAAA+ SKVSPADAAYGEAANVFG PK N
Sbjct: 42  NSISCRAVKQADAEIVTSPATRRQIALTLLAGAAALTSKVSPADAAYGEAANVFGAPKKN 101

Query: 369 TDFLPYNGDGFKLSIPA 419
           TDF+ Y+G GF + IP+
Sbjct: 102 TDFITYSGKGFTIQIPS 118

[41][TOP]
>UniRef100_A9NP13 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NP13_PICSI
          Length = 272

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 53/77 (68%), Positives = 60/77 (77%), Gaps = 2/77 (2%)
 Frame = +3

Query: 195 NQIVCRAQKQQDVEDV-SPVSRR-LALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSN 368
           N I CRA KQ D E V SP +RR +ALTLL GAAA+ SKVSPADAAYGEAANVFG PK N
Sbjct: 42  NSISCRAVKQADAEIVTSPATRRQIALTLLAGAAALTSKVSPADAAYGEAANVFGAPKKN 101

Query: 369 TDFLPYNGDGFKLSIPA 419
           TDF+ Y+G GF + IP+
Sbjct: 102 TDFITYSGKGFTIQIPS 118

[42][TOP]
>UniRef100_A9NKX3 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NKX3_PICSI
          Length = 272

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 53/77 (68%), Positives = 60/77 (77%), Gaps = 2/77 (2%)
 Frame = +3

Query: 195 NQIVCRAQKQQDVEDV-SPVSRR-LALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSN 368
           N I CRA KQ D E V SP +RR +ALTLL GAAA+ SKVSPADAAYGEAANVFG PK N
Sbjct: 42  NSISCRAVKQADAEIVTSPATRRQIALTLLAGAAALTSKVSPADAAYGEAANVFGAPKKN 101

Query: 369 TDFLPYNGDGFKLSIPA 419
           TDF+ Y+G GF + IP+
Sbjct: 102 TDFITYSGKGFTIQIPS 118

[43][TOP]
>UniRef100_A9NZP7 Putative uncharacterized protein n=1 Tax=Picea sitchensis
           RepID=A9NZP7_PICSI
          Length = 272

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/77 (67%), Positives = 59/77 (76%), Gaps = 2/77 (2%)
 Frame = +3

Query: 195 NQIVCRAQKQQDVEDV-SPVSRR-LALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSN 368
           N I CRA KQ D E V SP +RR +ALTLL GAAA+ SKVSPADAAYGE ANVFG PK N
Sbjct: 42  NSISCRAVKQADAEIVTSPATRRQIALTLLAGAAALTSKVSPADAAYGEPANVFGAPKKN 101

Query: 369 TDFLPYNGDGFKLSIPA 419
           TDF+ Y+G GF + IP+
Sbjct: 102 TDFITYSGKGFTIQIPS 118

[44][TOP]
>UniRef100_Q40458 23 kDa polypeptide of water-oxidizing complex of photosystem II
           (Fragment) n=1 Tax=Nicotiana tabacum RepID=Q40458_TOBAC
          Length = 205

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 43/51 (84%), Positives = 47/51 (92%)
 Frame = +3

Query: 267 LTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           LTLLIG+AA+GSKVSPADAAYGEAANVFGK K+NTDF  YNGDGFKL IP+
Sbjct: 1   LTLLIGSAAIGSKVSPADAAYGEAANVFGKAKTNTDFQTYNGDGFKLQIPS 51

[45][TOP]
>UniRef100_UPI000034EDD4 PSBP-2 (photosystem II subunit P-2); calcium ion binding n=1
           Tax=Arabidopsis thaliana RepID=UPI000034EDD4
          Length = 261

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 54/111 (48%), Positives = 70/111 (63%), Gaps = 6/111 (5%)
 Frame = +3

Query: 105 MASTQCFLHHHAL------TTPTRTSSQRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLA 266
           MA +  FLH  AL      ++ + +SS R V   +P  +VCRAQ+ Q+  + S V RRLA
Sbjct: 1   MAYSPSFLHQSALASSAGRSSSSSSSSFRHVSLSRPVHLVCRAQQSQENNN-SAVFRRLA 59

Query: 267 LTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           LTLL+GAAA+GSKVSPA         +   PK NTDFLPY G+GFK+ IP+
Sbjct: 60  LTLLVGAAAIGSKVSPAPPM---VKPLMCLPKKNTDFLPYTGEGFKIQIPS 107

[46][TOP]
>UniRef100_B0L802 23 kDa OEC protein (Fragment) n=1 Tax=Salicornia veneta
           RepID=B0L802_9CARY
          Length = 202

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 40/48 (83%), Positives = 44/48 (91%)
 Frame = +3

Query: 276 LIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           LIGAAAVGSKVSPADAAYGEAANVFGKPK +T+F  YNGDGFKL +P+
Sbjct: 1   LIGAAAVGSKVSPADAAYGEAANVFGKPKKDTEFSSYNGDGFKLLVPS 48

[47][TOP]
>UniRef100_Q699I9 Oxygen-evolving complex (Fragment) n=1 Tax=Beta vulgaris
           RepID=Q699I9_BETVU
          Length = 62

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/62 (77%), Positives = 53/62 (85%), Gaps = 3/62 (4%)
 Frame = +3

Query: 162 SSQR-QVVSIKPNQIVCRAQKQQDVEDV--SPVSRRLALTLLIGAAAVGSKVSPADAAYG 332
           S+QR Q VSIKP QIVC+AQKQ D  +V  + VSRRLALT+LIGAAAVGSKVSPADAAYG
Sbjct: 1   SAQRYQAVSIKPTQIVCKAQKQDDEANVLNASVSRRLALTVLIGAAAVGSKVSPADAAYG 60

Query: 333 EA 338
           EA
Sbjct: 61  EA 62

[48][TOP]
>UniRef100_Q40701 23 kDa polypeptide of photosystem II n=1 Tax=Oryza sativa
           RepID=Q40701_ORYSA
          Length = 252

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 55/111 (49%), Positives = 69/111 (62%), Gaps = 6/111 (5%)
 Frame = +3

Query: 105 MASTQCFLHHHALTTPTRTSSQRQVV--SIKPNQIVCRAQKQQDVEDVSPVSRRL---AL 269
           MAST CFLH     +  R +++R  V     P   + R +  +         RRL   AL
Sbjct: 1   MASTSCFLHQ----STARVAARRLPVPGDTDPPPRLPRPEAGR--------RRRLPPRAL 48

Query: 270 TLLIGA-AAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
            LL GA AAVG KV+PA AAYGEAANVFGKPK+NT+F+ Y+G+GFKL IP+
Sbjct: 49  ALLAGATAAVGVKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPS 99

[49][TOP]
>UniRef100_A9SY12 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SY12_PHYPA
          Length = 268

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 38/78 (48%), Positives = 53/78 (67%)
 Frame = +3

Query: 186 IKPNQIVCRAQKQQDVEDVSPVSRRLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKS 365
           +    +  RA K ++ E VS   RR AL L+ G  A G++++PA+AAYGE+ANVFG PK 
Sbjct: 40  VASRSVTVRASKGEESEIVS---RRTALALVAGVVAAGARIAPANAAYGESANVFGAPKQ 96

Query: 366 NTDFLPYNGDGFKLSIPA 419
           +T F PY+G+GF L IP+
Sbjct: 97  STGFNPYSGNGFSLEIPS 114

[50][TOP]
>UniRef100_A9SG93 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SG93_PHYPA
          Length = 269

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 43/108 (39%), Positives = 61/108 (56%)
 Frame = +3

Query: 96  LAKMASTQCFLHHHALTTPTRTSSQRQVVSIKPNQIVCRAQKQQDVEDVSPVSRRLALTL 275
           L   +ST       A+   + T +  +V  +    +V RA K ++ E  S   RR AL L
Sbjct: 11  LVVKSSTSLASAKSAINGASVTVAAPRVAPVAVRSLVVRASKGEEGETFS---RRAALAL 67

Query: 276 LIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           + G  A G+KV  A+AAYGE+ANVFG PK +T F P+ G+GF L +P+
Sbjct: 68  VAGVLAAGAKVGSANAAYGESANVFGAPKISTGFTPFAGNGFTLDVPS 115

[51][TOP]
>UniRef100_A9SBL7 Predicted protein n=1 Tax=Physcomitrella patens subsp. patens
           RepID=A9SBL7_PHYPA
          Length = 268

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 33/62 (53%), Positives = 45/62 (72%)
 Frame = +3

Query: 234 EDVSPVSRRLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSI 413
           ++   VSRR AL L+ G  A  ++++PA+AAYGE+ANVFG PK +T F P+ GDGF L I
Sbjct: 53  DESETVSRRAALALVAGVVAASARIAPANAAYGESANVFGAPKQSTGFSPFTGDGFSLDI 112

Query: 414 PA 419
           P+
Sbjct: 113 PS 114

[52][TOP]
>UniRef100_A9RIB5 Predicted protein (Fragment) n=1 Tax=Physcomitrella patens subsp.
           patens RepID=A9RIB5_PHYPA
          Length = 216

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 34/62 (54%), Positives = 43/62 (69%)
 Frame = +3

Query: 234 EDVSPVSRRLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSI 413
           E+   VSRR AL L+ G  A G+KV  A+AAYGE+ANVFG PK  T F P+ G+GF L +
Sbjct: 1   EESETVSRRAALALVAGVIAAGAKVGSANAAYGESANVFGAPKKQTGFTPFIGNGFSLDV 60

Query: 414 PA 419
           P+
Sbjct: 61  PS 62

[53][TOP]
>UniRef100_A8IYH9 Oxygen-evolving enhancer protein 2 of photosystem II n=1
           Tax=Chlamydomonas reinhardtii RepID=A8IYH9_CHLRE
          Length = 282

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/59 (59%), Positives = 43/59 (72%)
 Frame = +3

Query: 243 SPVSRRLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           S VSRR AL    GAAA+ S  SPA+AAYG++ANVFGK  + + F+PY GDGF L +PA
Sbjct: 69  SDVSRRAALAGFAGAAALVSS-SPANAAYGDSANVFGKVTNKSGFVPYAGDGFALLLPA 126

[54][TOP]
>UniRef100_P11471 Oxygen-evolving enhancer protein 2, chloroplastic n=1
           Tax=Chlamydomonas reinhardtii RepID=PSBP_CHLRE
          Length = 245

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 35/59 (59%), Positives = 43/59 (72%)
 Frame = +3

Query: 243 SPVSRRLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           S VSRR AL    GAAA+ S  SPA+AAYG++ANVFGK  + + F+PY GDGF L +PA
Sbjct: 32  SDVSRRAALAGFAGAAALVSS-SPANAAYGDSANVFGKVTNKSGFVPYAGDGFALLLPA 89

[55][TOP]
>UniRef100_Q7M1Y7 Photosystem II oxygen-evolving complex protein 2 (Fragment) n=1
           Tax=Oryza sativa RepID=Q7M1Y7_ORYSA
          Length = 37

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 24/31 (77%), Positives = 29/31 (93%)
 Frame = +3

Query: 324 AYGEAANVFGKPKSNTDFLPYNGDGFKLSIP 416
           AYGEAANVFGKPK+NT+F+ Y+G+GFKL IP
Sbjct: 1   AYGEAANVFGKPKTNTEFIAYSGEGFKLLIP 31

[56][TOP]
>UniRef100_B0FFP0 Chloroplast 23 kDa polypeptide of photosystem II (Fragment) n=1
           Tax=Oryza sativa Japonica Group RepID=B0FFP0_ORYSJ
          Length = 185

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 23/31 (74%), Positives = 29/31 (93%)
 Frame = +3

Query: 327 YGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           YGEAANVFGKPK+NT+F+ Y+G+GFKL IP+
Sbjct: 1   YGEAANVFGKPKTNTEFIAYSGEGFKLLIPS 31

[57][TOP]
>UniRef100_Q42029-2 Isoform 2 of Oxygen-evolving enhancer protein 2-1, chloroplastic
           n=1 Tax=Arabidopsis thaliana RepID=Q42029-2
          Length = 219

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 22/26 (84%), Positives = 25/26 (96%)
 Frame = +3

Query: 342 NVFGKPKSNTDFLPYNGDGFKLSIPA 419
           NVFGKPK+NTDFLPYNGDGFK+ +PA
Sbjct: 40  NVFGKPKTNTDFLPYNGDGFKVQVPA 65

[58][TOP]
>UniRef100_A4SBE3 Oxygen evolving enhancer 2 of Photosystem II n=1 Tax=Ostreococcus
           lucimarinus CCE9901 RepID=A4SBE3_OSTLU
          Length = 249

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 27/56 (48%), Positives = 37/56 (66%)
 Frame = +3

Query: 252 SRRLALTLLIGAAAVGSKVSPADAAYGEAANVFGKPKSNTDFLPYNGDGFKLSIPA 419
           SRR A++L+ GA  +     PA AAYG++ANVFG   + T F+PY GDGF   +P+
Sbjct: 41  SRREAMSLIAGATTLAMS-KPAFAAYGDSANVFGGVSNPTGFVPYAGDGFAFLLPS 95

[59][TOP]
>UniRef100_Q7M1Y8 Photosystem II oxygen-evolving complex protein 1 (Fragment) n=1
           Tax=Pinus monticola RepID=Q7M1Y8_PINMO
          Length = 35

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 23/31 (74%), Positives = 25/31 (80%)
 Frame = +3

Query: 324 AYGEAANVFGKPKSNTDFLPYNGDGFKLSIP 416
           AYGEAANVFG PK NTDF+ Y+G GF L IP
Sbjct: 1   AYGEAANVFGAPKKNTDFITYSGPGFTLQIP 31