AV412923 ( MWM225g07_r )

[UP]


[1][TOP]
>UniRef100_Q2YHP5 Proline-rich protein (Fragment) n=1 Tax=Phaseolus vulgaris
           RepID=Q2YHP5_PHAVU
          Length = 264

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 36  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 95

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 96  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 145

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 46  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 105

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 106 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 155

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 56  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 115

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 116 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 165

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 66  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 125

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 126 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 175

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 76  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 135

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 136 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 185

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 86  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 145

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 146 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 195

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 96  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 155

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 156 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 205

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 106 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 165

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 166 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 215

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 116 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 175

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 176 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 225

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 126 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 185

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 186 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 235

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 136 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 195

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 196 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 245

 Score =  241 bits (616), Expect = 1e-62
 Identities = 106/108 (98%), Positives = 106/108 (98%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY
Sbjct: 28  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 87

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 88  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 135

 Score =  239 bits (611), Expect = 5e-62
 Identities = 105/110 (95%), Positives = 106/110 (96%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 146 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 205

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVY+PP  KPP
Sbjct: 206 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYQPPYGKPP 255

 Score =  218 bits (556), Expect = 1e-55
 Identities = 97/105 (92%), Positives = 98/105 (93%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 156 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 215

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVY+PP  KPP  K P
Sbjct: 216 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYQPPYGKPPHPKYP 260

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 42/49 (85%), Positives = 43/49 (87%), Gaps = 5/49 (10%)
 Frame = +3

Query: 201 EKPPVYKPPVY-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +KPPV KPPVY     KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 27  DKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 75

[2][TOP]
>UniRef100_P13993 Repetitive proline-rich cell wall protein 2 n=2 Tax=Glycine max
           RepID=PRP2_SOYBN
          Length = 230

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 69  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 128

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 129 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 178

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 79  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 138

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 139 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 188

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 89  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 148

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 149 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 198

 Score =  245 bits (626), Expect = 1e-63
 Identities = 107/110 (97%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 59  IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 118

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 119 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 168

 Score =  245 bits (626), Expect = 1e-63
 Identities = 107/110 (97%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 99  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 158

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPP
Sbjct: 159 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPP 208

 Score =  243 bits (621), Expect = 4e-63
 Identities = 106/110 (96%), Positives = 107/110 (97%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVE PP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 39  VYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 98

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 99  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 148

 Score =  243 bits (621), Expect = 4e-63
 Identities = 106/110 (96%), Positives = 107/110 (97%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVE PP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 49  VYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 108

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 109 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 158

 Score =  242 bits (617), Expect = 1e-62
 Identities = 105/110 (95%), Positives = 106/110 (96%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPP EKPPVYKPPVEKPPVYKPPVE PP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 29  VYKPPTEKPPVYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 88

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 89  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 138

 Score =  241 bits (614), Expect = 2e-62
 Identities = 105/110 (95%), Positives = 106/110 (96%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 109 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 168

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPP+YKPPVEKPPVYKPP  KPP
Sbjct: 169 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPYGKPP 218

 Score =  227 bits (578), Expect = 4e-58
 Identities = 98/104 (94%), Positives = 99/104 (95%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           E PPVYKPP EKPPVYKPPVEKPPVYKPPVE PP+YKPPVEKPPVYKPPVEKPPVYKPP 
Sbjct: 25  ENPPVYKPPTEKPPVYKPPVEKPPVYKPPVENPPIYKPPVEKPPVYKPPVEKPPVYKPPV 84

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 85  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 128

 Score =  220 bits (561), Expect = 3e-56
 Identities = 97/105 (92%), Positives = 98/105 (93%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 119 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 178

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           VYKPP EKPPVYKPPV KPP+YKPPVEKPPVYKPP  KPP  K P
Sbjct: 179 VYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPYGKPPYPKYP 223

[3][TOP]
>UniRef100_Q40375 Repetitive proline-rich cell wall protein 2 n=1 Tax=Medicago
           truncatula RepID=PRP2_MEDTR
          Length = 371

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 34  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 93

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 94  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 143

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 44  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 103

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 104 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 153

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 54  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 113

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 114 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 163

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 64  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 123

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 124 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 173

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 74  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 133

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 134 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 183

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 84  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 143

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 144 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 193

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 94  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 153

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 154 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 203

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 104 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 163

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 164 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 213

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 114 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 173

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 174 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 223

 Score =  246 bits (627), Expect = 7e-64
 Identities = 108/110 (98%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 124 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 183

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 184 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 233

 Score =  245 bits (626), Expect = 1e-63
 Identities = 107/110 (97%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 134 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 193

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPP
Sbjct: 194 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPP 243

 Score =  245 bits (626), Expect = 1e-63
 Identities = 107/110 (97%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 144 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 203

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPP
Sbjct: 204 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPP 253

 Score =  245 bits (626), Expect = 1e-63
 Identities = 107/110 (97%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 154 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 213

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 214 VYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 263

 Score =  245 bits (625), Expect = 1e-63
 Identities = 106/110 (96%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 164 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 223

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPP+YKPPV KPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPP
Sbjct: 224 VYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPP 273

 Score =  245 bits (625), Expect = 1e-63
 Identities = 106/110 (96%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 174 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 233

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +YKPP EKPPVYKPPV KPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPP
Sbjct: 234 IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPP 283

 Score =  245 bits (625), Expect = 1e-63
 Identities = 106/110 (96%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPP
Sbjct: 184 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPP 243

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 244 VYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 293

 Score =  245 bits (625), Expect = 1e-63
 Identities = 106/110 (96%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPP
Sbjct: 194 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPP 253

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPP+YKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 254 VYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 303

 Score =  245 bits (625), Expect = 1e-63
 Identities = 106/110 (96%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 204 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 263

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +YKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 264 IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 313

 Score =  242 bits (618), Expect = 8e-63
 Identities = 105/110 (95%), Positives = 107/110 (97%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPP
Sbjct: 214 VYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPP 273

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPP
Sbjct: 274 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPP 323

 Score =  242 bits (618), Expect = 8e-63
 Identities = 105/110 (95%), Positives = 107/110 (97%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPP
Sbjct: 224 VYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPP 283

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPVEKPP
Sbjct: 284 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEKPP 333

 Score =  240 bits (612), Expect = 4e-62
 Identities = 105/110 (95%), Positives = 106/110 (96%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 244 VYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 303

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPVYKPPVYKPPVEKPPVYKPPV KPPV KPPV KPP
Sbjct: 304 VYKPPVEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPP 353

 Score =  239 bits (611), Expect = 5e-62
 Identities = 104/110 (94%), Positives = 106/110 (96%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 234 IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 293

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 294 VYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 343

 Score =  237 bits (605), Expect = 3e-61
 Identities = 104/108 (96%), Positives = 105/108 (97%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPPV +PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY
Sbjct: 26  KPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 85

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 86  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 133

 Score =  234 bits (596), Expect = 3e-60
 Identities = 103/110 (93%), Positives = 104/110 (94%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 254 VYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 313

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPP
Sbjct: 314 VYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP 363

 Score =  226 bits (577), Expect = 5e-58
 Identities = 99/105 (94%), Positives = 100/105 (95%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPP
Sbjct: 264 IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPP 323

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           VYKPP EKPPVYKPPVYKPPV KPPV KPPVYKPPVEKPPVY PP
Sbjct: 324 VYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYGPP 368

 Score =  109 bits (273), Expect = 8e-23
 Identities = 49/59 (83%), Positives = 51/59 (86%), Gaps = 5/59 (8%)
 Frame = +3

Query: 171 EKPPVYKPPAEKPPVYKPPVY-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +KPPVY+PP  KPPV KPPVY     KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 25  DKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 83

[4][TOP]
>UniRef100_Q43414 Proline rich protein (Fragment) n=1 Tax=Cicer arietinum
           RepID=Q43414_CICAR
          Length = 227

 Score =  245 bits (625), Expect = 1e-63
 Identities = 106/110 (96%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPP+EKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPP
Sbjct: 22  VYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPP 81

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 82  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 131

 Score =  245 bits (625), Expect = 1e-63
 Identities = 106/110 (96%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPP+EKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 32  VYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 91

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 92  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 141

 Score =  244 bits (624), Expect = 2e-63
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPP+EKPPVYKPPVEKPPVYKPPVEKPPVYKPP+EKPPVYKPPVEKPP
Sbjct: 2   VYKPPVEKPPVYKPPIEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPP 61

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +YKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 62  IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 111

 Score =  244 bits (624), Expect = 2e-63
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPP+EKPPVYKPPVEKPPVYKPPVEKPPVYKPP+EKPPVYKPPVEKPP+YKPPVEKPP
Sbjct: 12  VYKPPIEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPIYKPPVEKPP 71

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 72  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 121

 Score =  244 bits (624), Expect = 2e-63
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPP+EKPPVYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 42  VYKPPIEKPPVYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 101

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPP
Sbjct: 102 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPP 151

 Score =  244 bits (624), Expect = 2e-63
 Identities = 105/110 (95%), Positives = 108/110 (98%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPP+YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 52  VYKPPVEKPPIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 111

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPP+YKPPVEKPPVYKPP+EKPP
Sbjct: 112 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPP 161

 Score =  242 bits (618), Expect = 8e-63
 Identities = 104/110 (94%), Positives = 107/110 (97%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 62  IYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 121

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPP+YKPPVEKPPVYKPP+EKPPVY PPVEKPP
Sbjct: 122 VYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPP 171

 Score =  241 bits (614), Expect = 2e-62
 Identities = 103/110 (93%), Positives = 107/110 (97%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 72  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 131

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPP+YKPPV KPPVYKPP+EKPPVY PPVEKPPVYKPP+E+PP
Sbjct: 132 VYKPPVEKPPIYKPPVEKPPVYKPPIEKPPVYTPPVEKPPVYKPPIEEPP 181

 Score =  241 bits (614), Expect = 2e-62
 Identities = 103/110 (93%), Positives = 107/110 (97%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 82  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 141

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +YKPP EKPPVYKPP+ KPPVY PPVEKPPVYKPP+E+PPVYKPPVEKPP
Sbjct: 142 IYKPPVEKPPVYKPPIEKPPVYTPPVEKPPVYKPPIEEPPVYKPPVEKPP 191

 Score =  236 bits (602), Expect = 6e-61
 Identities = 102/110 (92%), Positives = 105/110 (95%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPP
Sbjct: 92  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPP 151

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVY PPV KPPVYKPP+E+PPVYKPPVEKPPVY PP EKPP
Sbjct: 152 VYKPPIEKPPVYTPPVEKPPVYKPPIEEPPVYKPPVEKPPVYGPPYEKPP 201

 Score =  225 bits (573), Expect = 1e-57
 Identities = 96/101 (95%), Positives = 99/101 (98%)
 Frame = +3

Query: 30  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKP 209
           PVYKPPVEKPPVYKPP+EKPPVYKPPVEKPPVYKPPVEKPPVYKPP+EKPPVYKPP EKP
Sbjct: 1   PVYKPPVEKPPVYKPPIEKPPVYKPPVEKPPVYKPPVEKPPVYKPPIEKPPVYKPPVEKP 60

Query: 210 PVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P+YKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 61  PIYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 101

 Score =  224 bits (571), Expect = 2e-57
 Identities = 98/112 (87%), Positives = 102/112 (91%), Gaps = 2/112 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP+YKPPVEKPPVYKPP+EKPP
Sbjct: 102 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPIYKPPVEKPPVYKPPIEKPP 161

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPP 332
           VY PP EKPPVYKPP+ +PPVYKPPVEKPPVY PP EKPP Y   PP EKPP
Sbjct: 162 VYTPPVEKPPVYKPPIEEPPVYKPPVEKPPVYGPPYEKPPHYPGYPPYEKPP 213

[5][TOP]
>UniRef100_Q9SC42 Proline-rich protein n=1 Tax=Pisum sativum RepID=Q9SC42_PEA
          Length = 214

 Score =  238 bits (608), Expect = 1e-61
 Identities = 103/110 (93%), Positives = 105/110 (95%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPV+KPPVYKPPVEKPPVYKPPVEKPP YKPPVEKPP
Sbjct: 53  VYKPPVEKPPVYKPPVEKPPVYKPPVKKPPVYKPPVEKPPVYKPPVEKPPTYKPPVEKPP 112

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPP YKPPV +PPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP
Sbjct: 113 VYKPPVEKPPTYKPPVERPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPP 162

 Score =  237 bits (604), Expect = 3e-61
 Identities = 102/110 (92%), Positives = 104/110 (94%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPV+KPPVYKPPVEKPPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP
Sbjct: 63  VYKPPVEKPPVYKPPVKKPPVYKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPP 122

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            YKPP E+PPVYKPPV KPP YKPPVEKPPVYKPPVEKPP YKPPVEKPP
Sbjct: 123 TYKPPVERPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVEKPP 172

 Score =  235 bits (600), Expect = 1e-60
 Identities = 101/110 (91%), Positives = 103/110 (93%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV+KPPVYKPPVEKPPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP YKPPVE+PP
Sbjct: 73  VYKPPVKKPPVYKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPP 132

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPP YKPPV KPPVYKPPVEKPP YKPPVEKPP YKPPVEKPP
Sbjct: 133 VYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVEKPPAYKPPVEKPP 182

 Score =  232 bits (592), Expect = 9e-60
 Identities = 101/110 (91%), Positives = 103/110 (93%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV+KPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 43  VEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVKKPPVYKPPVEKPPVYKPPVEKPP 102

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            YKPP EKPPVYKPPV KPP YKPPVE+PPVYKPPVEKPP YKPPVEKPP
Sbjct: 103 TYKPPVEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPPTYKPPVEKPP 152

 Score =  230 bits (586), Expect = 4e-59
 Identities = 101/115 (87%), Positives = 105/115 (91%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 167
           VY+PPVE PP+YKPPVEKPPVYKP     PVEKPPVYKPPVEKPPVYKPPV+KPPVYKPP
Sbjct: 28  VYRPPVETPPIYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVKKPPVYKPP 87

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VEKPPVYKPP EKPP YKPPV KPPVYKPPVEKPP YKPPVE+PPVYKPPVEKPP
Sbjct: 88  VEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPP 142

 Score =  228 bits (580), Expect = 2e-58
 Identities = 98/106 (92%), Positives = 99/106 (93%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPP YKPPVEKPPVYKPPVEKPP YKPPVE+PPVYKPPVEKPP
Sbjct: 83  VYKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPPVYKPPVEKPP 142

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 320
            YKPP EKPPVYKPPV KPP YKPPVEKPP YKPPVEKPPVYKPPV
Sbjct: 143 TYKPPVEKPPVYKPPVEKPPTYKPPVEKPPAYKPPVEKPPVYKPPV 188

 Score =  217 bits (552), Expect = 4e-55
 Identities = 95/109 (87%), Positives = 99/109 (90%), Gaps = 5/109 (4%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           EKPPVY+PPVE PP+YKPPVE     KPPVYKPPVEKPPVYKPPVEKPPVYKPPV+KPPV
Sbjct: 24  EKPPVYRPPVETPPIYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVKKPPV 83

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKPP EKPPVYKPPV KPP YKPPVEKPPVYKPPVEKPP YKPPVE+PP
Sbjct: 84  YKPPVEKPPVYKPPVEKPPTYKPPVEKPPVYKPPVEKPPTYKPPVERPP 132

[6][TOP]
>UniRef100_Q9MAW3 TrPRP2 n=1 Tax=Trifolium repens RepID=Q9MAW3_TRIRP
          Length = 343

 Score =  230 bits (586), Expect = 4e-59
 Identities = 102/110 (92%), Positives = 102/110 (92%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 44  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 103

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPV KPPVYKPPV KPPV  PPV KPPVYKPPV KPP
Sbjct: 104 VYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPP 153

 Score =  229 bits (585), Expect = 6e-59
 Identities = 104/115 (90%), Positives = 104/115 (90%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPP
Sbjct: 54  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPP 113

Query: 183 VYKPPAEKPPVYKPPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVYK     PPVYKPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 114 VYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPP 168

 Score =  229 bits (583), Expect = 9e-59
 Identities = 101/110 (91%), Positives = 102/110 (92%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPP+YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 219 VYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPP 278

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 279 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 328

 Score =  227 bits (579), Expect = 3e-58
 Identities = 100/110 (90%), Positives = 101/110 (91%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY PP+ KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 34  VYTPPIVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 93

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV  PPV KPP
Sbjct: 94  VYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPP 143

 Score =  224 bits (572), Expect = 2e-57
 Identities = 100/110 (90%), Positives = 100/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 64  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPP 123

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPV  PPVYKPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 124 VYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPP 173

 Score =  224 bits (570), Expect = 3e-57
 Identities = 99/110 (90%), Positives = 100/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP+YKPPV KPPVYKPPVEKPP
Sbjct: 189 VYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPP 248

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPV KPPVYKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 249 VYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPPVEKPP 298

 Score =  223 bits (569), Expect = 4e-57
 Identities = 99/110 (90%), Positives = 100/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPV KPPV KPPVYKPPV KPP+YKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 199 VYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPP 258

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPP  KPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 259 VVKPPVYKPPVYKPPVVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 308

 Score =  223 bits (568), Expect = 5e-57
 Identities = 98/108 (90%), Positives = 99/108 (91%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPPV  PPVY PP+ KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY
Sbjct: 26  KPPVYTPPVYTPPIVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 85

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 86  KPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPP 133

 Score =  223 bits (568), Expect = 5e-57
 Identities = 99/110 (90%), Positives = 100/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPV KPPVYKPPV KPP+YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPP
Sbjct: 209 VVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPP 268

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 269 VYKPPVVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 318

 Score =  222 bits (565), Expect = 1e-56
 Identities = 99/110 (90%), Positives = 99/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 74  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPP 133

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP  KPPVYKPPVYKPPV KPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 134 VVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPP 183

 Score =  219 bits (558), Expect = 7e-56
 Identities = 96/105 (91%), Positives = 98/105 (93%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 229 IYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPP 288

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           VYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVEKPPVY+PP
Sbjct: 289 VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYEPP 333

 Score =  218 bits (555), Expect = 2e-55
 Identities = 97/110 (88%), Positives = 98/110 (89%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP+YKPPV KPP
Sbjct: 179 VVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPP 238

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPVYKPPV KPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 239 VYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVEKPP 288

 Score =  215 bits (548), Expect = 1e-54
 Identities = 96/110 (87%), Positives = 97/110 (88%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 139 VYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPP 198

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPV KPPVYKPPVYKPPV KPP+YKPPV KPPVYKPPVEKPP
Sbjct: 199 VYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPP 248

 Score =  213 bits (541), Expect = 7e-54
 Identities = 98/115 (85%), Positives = 98/115 (85%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----PPVYKPPVEKPPVYKPP 167
           VYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV K     PPVYKPPV KPPVYKPP
Sbjct: 94  VYKPPVEKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPP 153

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPPVYKPP  KPPV KPPVYKPPV KPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 154 VVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPP 208

 Score =  213 bits (541), Expect = 7e-54
 Identities = 98/115 (85%), Positives = 98/115 (85%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 144 VYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP 203

Query: 183 VYKPPAEKPPVYKPPVYKPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVYKPPV     YKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 204 VYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPP 258

 Score =  211 bits (536), Expect = 3e-53
 Identities = 95/110 (86%), Positives = 95/110 (86%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPV KPPV  PPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 114 VYKPPVVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPP 173

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVYKPPV KPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 174 VYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPP 223

 Score =  210 bits (535), Expect = 3e-53
 Identities = 94/110 (85%), Positives = 95/110 (86%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV  PPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPV KPPV KPP
Sbjct: 129 VYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPPVYKPP 188

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVYKPPV KPPV KPPVYKPPV KPP+YKPPV KPP
Sbjct: 189 VYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPPVVKPP 238

 Score =  209 bits (532), Expect = 8e-53
 Identities = 94/110 (85%), Positives = 95/110 (86%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPV KPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 159 VYKPPVYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP 218

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPP+YKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPP
Sbjct: 219 VYKPPVVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPP 268

 Score =  209 bits (532), Expect = 8e-53
 Identities = 95/110 (86%), Positives = 95/110 (86%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 164 VYKPPVVKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPP 223

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPP  KPPV KPPVYKPPV KPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 224 VVKPPIYKPPVVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPP 273

 Score =  207 bits (527), Expect = 3e-52
 Identities = 93/110 (84%), Positives = 94/110 (85%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPV  PPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 124 VYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVVKPP 183

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPV KPPVYKPPVYKPPV KPPVYKPPV KPPV KPP+ KPP
Sbjct: 184 VYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPP 233

 Score =  206 bits (524), Expect = 7e-52
 Identities = 93/110 (84%), Positives = 94/110 (85%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPV KPPV KPP+ KPP
Sbjct: 174 VYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPIYKPP 233

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPP  KPPV KPPVYKPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 234 VVKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP 283

 Score =  204 bits (520), Expect = 2e-51
 Identities = 93/110 (84%), Positives = 93/110 (84%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPV KPPVYKPPV  PPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 119 VVKPPVYKPPVYKPPVVMPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPP 178

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPP  KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 179 VVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVVKPP 228

 Score =  124 bits (310), Expect = 4e-27
 Identities = 56/69 (81%), Positives = 57/69 (82%), Gaps = 5/69 (7%)
 Frame = +3

Query: 141 EKPPVYKPPVEKPPVYKPPAEKPPVYKPPVY-----KPPVYKPPVEKPPVYKPPVEKPPV 305
           EKPPVY PPV  PP+ KPP  KPPV KPPVY     KPPVYKPPVEKPPVYKPPVEKPPV
Sbjct: 25  EKPPVYTPPVYTPPIVKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 84

Query: 306 YKPPVEKPP 332
           YKPPVEKPP
Sbjct: 85  YKPPVEKPP 93

[7][TOP]
>UniRef100_Q40358 Repetitive proline-rich cell wall protein n=1 Tax=Medicago sativa
           RepID=PRP_MEDSA
          Length = 236

 Score =  229 bits (585), Expect = 6e-59
 Identities = 102/110 (92%), Positives = 102/110 (92%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 59  VYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPP 118

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPV KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPP
Sbjct: 119 VYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPP 168

 Score =  229 bits (585), Expect = 6e-59
 Identities = 102/110 (92%), Positives = 102/110 (92%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPP
Sbjct: 89  VYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP 148

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPVYKPPVYKPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 149 VYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPP 198

 Score =  226 bits (576), Expect = 6e-58
 Identities = 101/110 (91%), Positives = 101/110 (91%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 49  VEKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 108

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVYKPPV KPPV KPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 109 VYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPP 158

 Score =  224 bits (570), Expect = 3e-57
 Identities = 100/110 (90%), Positives = 100/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 99  VYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPP 158

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 159 VYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 208

 Score =  223 bits (569), Expect = 4e-57
 Identities = 100/110 (90%), Positives = 100/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPP
Sbjct: 109 VYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPP 168

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVYKPPVYKPPVEKPPVYKPPV KPPV KPPV KPP
Sbjct: 169 VYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPP 218

 Score =  223 bits (568), Expect = 5e-57
 Identities = 102/115 (88%), Positives = 102/115 (88%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 167
           VYKPPVEKPPVYKPPVEKPPVYKP     PVEKPPVYKPPV KPPVYKPPV KPPVYKPP
Sbjct: 34  VYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVYKPP 93

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VEKPPVYKPP  KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPP
Sbjct: 94  VEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP 148

 Score =  220 bits (560), Expect = 4e-56
 Identities = 99/110 (90%), Positives = 99/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 119 VYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPP 178

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPVEKPP
Sbjct: 179 VYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP 228

 Score =  218 bits (554), Expect = 2e-55
 Identities = 99/113 (87%), Positives = 100/113 (88%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVE 173
           KPPV +PPVYKPPVEKPPVYKPPVEKPPVYKPPV     EKPPVYKPPV KPPVYKPPV 
Sbjct: 26  KPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVY 85

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPPVYKPP EKPPVYKPPVYKPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 86  KPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPP 138

 Score =  215 bits (548), Expect = 1e-54
 Identities = 96/105 (91%), Positives = 96/105 (91%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPV KPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 129 VEKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPP 188

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           VYKPP EKPPVYKPPVYKPPV KPPV KPPVYKPPVEKPPVY PP
Sbjct: 189 VYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYGPP 233

 Score =  107 bits (266), Expect = 5e-22
 Identities = 46/54 (85%), Positives = 48/54 (88%)
 Frame = +3

Query: 171 EKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +KPPVY+PP  KPPV KPPVYKPPV KPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 25  DKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVVKPP 78

[8][TOP]
>UniRef100_Q43564 Repetitive proline-rich cell wall protein 1 n=1 Tax=Medicago
           truncatula RepID=PRP1_MEDTR
          Length = 206

 Score =  226 bits (577), Expect = 5e-58
 Identities = 103/115 (89%), Positives = 103/115 (89%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 34  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPP 93

Query: 183 VYKPPA-----EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP      EKPPVYKPPVYKPPV KPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 94  VYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPP 148

 Score =  224 bits (570), Expect = 3e-57
 Identities = 102/115 (88%), Positives = 102/115 (88%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY-----KPPVEKPPVYKPPVEKPPVYKPP 167
           VYKPPVEKPPVYKPPVEKPPVYKPPV KPPVY     KPPV KPPVYKPPV KPPVYKPP
Sbjct: 44  VYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPP 103

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VEKPPVYKPP  KPPV KPPVYKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 104 VEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPP 158

 Score =  221 bits (563), Expect = 2e-56
 Identities = 98/108 (90%), Positives = 99/108 (91%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPPV +PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPVY
Sbjct: 26  KPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVY 85

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP  KPPVYKPPVYKPPV KPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 86  KPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPP 133

 Score =  221 bits (562), Expect = 3e-56
 Identities = 99/110 (90%), Positives = 99/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 89  VYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPP 148

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPV KPPVYKPPVYKPPV KPPV KPPV KPPVYKPPVEKPP
Sbjct: 149 VYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPP 198

 Score =  218 bits (555), Expect = 2e-55
 Identities = 100/115 (86%), Positives = 100/115 (86%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPP
Sbjct: 69  VYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPP 128

Query: 183 VYKPPAEKPPVY-----KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVY     KPPVYKPPVYKPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 129 VYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPP 183

 Score =  218 bits (555), Expect = 2e-55
 Identities = 100/115 (86%), Positives = 100/115 (86%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPVEKPP
Sbjct: 79  VVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPP 138

Query: 183 VYKPPAEKPPVYKPPVY-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVY     KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 139 VYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 193

 Score =  215 bits (547), Expect = 1e-54
 Identities = 97/110 (88%), Positives = 97/110 (88%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPP
Sbjct: 54  VYKPPVEKPPVYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPP 113

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVYKPPV KPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 114 VYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPP 163

 Score =  212 bits (540), Expect = 9e-54
 Identities = 96/110 (87%), Positives = 96/110 (87%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 64  VYKPPVYKPPVYKPPVVKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVVKPP 123

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPV KPPVYKPPV KPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 124 VYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPPVVKPPVYKPPVYKPP 173

 Score =  210 bits (534), Expect = 5e-53
 Identities = 94/105 (89%), Positives = 94/105 (89%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 99  VYKPPVEKPPVYKPPVYKPPVVKPPVYKPPVYKPPVEKPPVYKPPVVKPPVYKPPVYKPP 158

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           V KPP  KPPVYKPPVYKPPV KPPV KPPVYKPPVEKPPVY PP
Sbjct: 159 VVKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVEKPPVYGPP 203

 Score =  105 bits (262), Expect = 2e-21
 Identities = 48/59 (81%), Positives = 49/59 (83%), Gaps = 5/59 (8%)
 Frame = +3

Query: 171 EKPPVYKPPAEKPPVYKPPVY-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           EKPPVY+PP  KPPV KPPVY     KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 25  EKPPVYQPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVYKPPVYKPPVVKPP 83

[9][TOP]
>UniRef100_P08012 Repetitive proline-rich cell wall protein 1 n=1 Tax=Glycine max
           RepID=PRP1_SOYBN
          Length = 256

 Score =  223 bits (567), Expect = 7e-57
 Identities = 98/110 (89%), Positives = 100/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPP+ KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 43  VYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPP 102

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPP+ KPPVYKPPVYKPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 103 VYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPP 152

 Score =  222 bits (566), Expect = 9e-57
 Identities = 97/110 (88%), Positives = 100/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPP+EKPPVYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 108 VYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPP 167

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPVYKPPVYKPPV KPPV KPP+ KPPVYKPP+EKPP
Sbjct: 168 VYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPPVYKPPIEKPP 217

 Score =  221 bits (563), Expect = 2e-56
 Identities = 97/110 (88%), Positives = 100/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPP
Sbjct: 133 VYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPP 192

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPP+YKPPVYKPP+ KPPV KPPVYKPPV KPPVYKPPV+KPP
Sbjct: 193 VYKPPVEKPPIYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVKKPP 242

 Score =  221 bits (562), Expect = 3e-56
 Identities = 101/115 (87%), Positives = 101/115 (87%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKPP 167
           VYKPPVEKPPVYKPPV KPPVYKPPV     EKPPVYKPPV KPPVYKPPV KPPVYKPP
Sbjct: 83  VYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPP 142

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPPV KPP  KPPVYKPPVYKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 143 VYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 197

 Score =  220 bits (561), Expect = 3e-56
 Identities = 100/115 (86%), Positives = 101/115 (87%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPP-----VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 167
           VYKPPVEKPPVYKPPV KPP     VYKPPVEKPPVYKPPV KPPVYKPPV KPP+ KPP
Sbjct: 58  VYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPP 117

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPPVYKPP  KPPVYKPPVYKPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 118 VYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 172

 Score =  220 bits (561), Expect = 3e-56
 Identities = 100/115 (86%), Positives = 101/115 (87%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVYKPP 167
           VYKPP+ KPPVYKPPVEKPPVYKPPV KPPVYKPPV     EKPPVYKPPV KPPVYKPP
Sbjct: 73  VYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPP 132

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPPVYKPP  KPPV KPPVYKPPVYKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 133 VYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 187

 Score =  220 bits (561), Expect = 3e-56
 Identities = 98/110 (89%), Positives = 99/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPV KPP+ KPPV KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 93  VYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPP 152

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVYKPPV KPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 153 VYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPP 202

 Score =  220 bits (560), Expect = 4e-56
 Identities = 97/110 (88%), Positives = 99/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPV KPPV KPPVYKPP+ KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 53  VYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 112

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           + KPP  KPPVYKPPVYKPPVYKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 113 IEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 162

 Score =  220 bits (560), Expect = 4e-56
 Identities = 97/110 (88%), Positives = 99/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPP+YKPPV KPPV KPPV KPPVYKPPV KPPVYKPP+EKPPVYKPPV KPP
Sbjct: 68  VYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPP 127

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVYKPPV KPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 128 VYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPP 177

 Score =  220 bits (560), Expect = 4e-56
 Identities = 97/110 (88%), Positives = 99/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPP+ KPPV KPPVYKPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 103 VYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 162

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPV KPPVYKPPVYKPPV KPPVYKPPVEKPP+YKPPV KPP
Sbjct: 163 VYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPIYKPPVYKPP 212

 Score =  220 bits (560), Expect = 4e-56
 Identities = 97/110 (88%), Positives = 99/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 118 VYKPPVYKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPP 177

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVYKPPV KPP+ KPPVYKPP+EKPPVYKPPV KPP
Sbjct: 178 VYKPPVYKPPVYKPPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPPVYKPP 227

 Score =  220 bits (560), Expect = 4e-56
 Identities = 97/110 (88%), Positives = 99/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 128 VYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPP 187

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPV KPP+YKPPVYKPP+EKPPVYKPPV KPPVYKPPV KPP
Sbjct: 188 VYKPPVYKPPVEKPPIYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPP 237

 Score =  217 bits (553), Expect = 3e-55
 Identities = 95/110 (86%), Positives = 98/110 (89%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YKPPV  PPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPP+ KPPVYKPPVEKPP
Sbjct: 33  IYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPP 92

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVYKPP+ KPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 93  VYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPP 142

 Score =  215 bits (548), Expect = 1e-54
 Identities = 94/110 (85%), Positives = 98/110 (89%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPV KPPVYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPP
Sbjct: 143 VYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPP 202

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +YKPP  KPP+ KPPVYKPPVYKPPV KPPVYKPPV+KPP+YKPP  K P
Sbjct: 203 IYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVKKPPIYKPPYPKYP 252

 Score =  213 bits (542), Expect = 5e-54
 Identities = 93/108 (86%), Positives = 96/108 (88%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP+ KPPVY PPV KPPV KPPV KPPVYKPPVEKPPVYKPPV KPP+YKPPV KPPV 
Sbjct: 30  KPPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVE 89

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP  KPPVYKPPVYKPPVYKPP+EKPPVYKPPV KPPVYKPPV KPP
Sbjct: 90  KPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPP 137

 Score =  210 bits (534), Expect = 5e-53
 Identities = 94/110 (85%), Positives = 96/110 (87%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPV KPPV KPPVYKPPV KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 138 VYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 197

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPP  KPPVYKPP+ KPPVYKPPV KPPVYKPPV KPPV KPP+ KPP
Sbjct: 198 VEKPPIYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVKKPPIYKPP 247

 Score =  187 bits (475), Expect = 3e-46
 Identities = 83/99 (83%), Positives = 86/99 (86%), Gaps = 5/99 (5%)
 Frame = +3

Query: 51  EKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPV 215
           EKPP+YKPPV  PPVYKPPVE     KPPVYKPPVEKPPVYKPPV KPP+YKPP  KPPV
Sbjct: 29  EKPPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPV 88

Query: 216 YKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            KPPVYKPPVYKPPV KPPVYKPP+EKPPVYKPPV KPP
Sbjct: 89  EKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPP 127

[10][TOP]
>UniRef100_Q40376 Nodulin n=1 Tax=Medicago truncatula RepID=Q40376_MEDTR
          Length = 549

 Score =  220 bits (560), Expect = 4e-56
 Identities = 97/110 (88%), Positives = 105/110 (95%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPP
Sbjct: 334 VHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPP 393

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V+KPP EKPPV+KPPV K PVYKPPVEKPPVYKPPVEKPPV+KPPVEKPP
Sbjct: 394 VHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEKPP 443

 Score =  219 bits (557), Expect = 1e-55
 Identities = 96/110 (87%), Positives = 105/110 (95%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           ++KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPP
Sbjct: 324 LHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPP 383

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V+KPP EKPPV+KPPV KPPV+KPPVEK PVYKPPVEKPPVYKPPVEKPP
Sbjct: 384 VHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPP 433

 Score =  215 bits (548), Expect = 1e-54
 Identities = 95/110 (86%), Positives = 104/110 (94%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPP
Sbjct: 304 VYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPP 363

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKP  EKPP++KPPV KPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK P
Sbjct: 364 VYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLP 413

 Score =  215 bits (548), Expect = 1e-54
 Identities = 95/110 (86%), Positives = 104/110 (94%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP
Sbjct: 314 VYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPP 373

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           ++KPP EKPPV+KPPV KPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPP
Sbjct: 374 LHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPP 423

 Score =  214 bits (546), Expect = 2e-54
 Identities = 95/110 (86%), Positives = 104/110 (94%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPP
Sbjct: 99  VHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPP 158

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPP++KP V KPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPP
Sbjct: 159 VYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPP 208

 Score =  214 bits (544), Expect = 3e-54
 Identities = 95/110 (86%), Positives = 103/110 (93%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEK P
Sbjct: 294 VEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLP 353

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKP V KPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPP
Sbjct: 354 VYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPP 403

 Score =  213 bits (542), Expect = 5e-54
 Identities = 95/110 (86%), Positives = 103/110 (93%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKPPVEKPP
Sbjct: 109 VHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPP 168

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           ++KP  EKPPV+KPPV KPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP
Sbjct: 169 LHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPP 218

 Score =  213 bits (542), Expect = 5e-54
 Identities = 94/109 (86%), Positives = 103/109 (94%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KPPVEK PVYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPP
Sbjct: 344 VHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPP 403

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V+KPP EK PVYKPPV KPPVYKPPVEKPPV+KPPVEKPP++KP VEKP
Sbjct: 404 VHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEKPPLHKPQVEKP 452

 Score =  212 bits (540), Expect = 9e-54
 Identities = 92/109 (84%), Positives = 100/109 (91%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           + PP+EKPP+YKPPVEKPP YKPPVE  PVYKP VEKPPV+KPPVEKPPV+KPPVEKPPV
Sbjct: 60  HHPPIEKPPIYKPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPPVEKPPVHKPPVEKPPV 119

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +KPP EKPPV+KPPV KPPV+KPPVEK PVYKP VEKPPVYKPPVEKPP
Sbjct: 120 HKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPP 168

 Score =  212 bits (539), Expect = 1e-53
 Identities = 95/115 (82%), Positives = 105/115 (91%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 167
           ++KPPVEKPPV+KPPVEKPPV     YKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPP
Sbjct: 279 MHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPP 338

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VEKPPV+KPP EK PVYKPPV KPPVYKP VEKPP++KPPVEKPPV+KPPVEKPP
Sbjct: 339 VEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPP 393

 Score =  211 bits (538), Expect = 2e-53
 Identities = 93/110 (84%), Positives = 101/110 (91%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YKPPVEKPP YKPPVE  PVYKP VEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPP
Sbjct: 69  IYKPPVEKPPAYKPPVEHHPVYKPSVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPP 128

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V+KPP EKPPV+KPPV K PVYKP VEKPPVYKPPVEKPP++KP VEKPP
Sbjct: 129 VHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPP 178

 Score =  211 bits (538), Expect = 2e-53
 Identities = 94/110 (85%), Positives = 103/110 (93%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKP VEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK P
Sbjct: 89  VYKPSVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLP 148

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKP  EKPPVYKPPV KPP++KP VEKPPV+KPPVEKPPV+KPPVEK P
Sbjct: 149 VYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLP 198

 Score =  211 bits (538), Expect = 2e-53
 Identities = 95/110 (86%), Positives = 102/110 (92%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKPPVEKPP++KP VEKPP
Sbjct: 119 VHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPP 178

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V+KPP EKPPV+KPPV K PVYKPPVEKPPVYKP VEKPPV KPPVEKPP
Sbjct: 179 VHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPP 228

 Score =  211 bits (538), Expect = 2e-53
 Identities = 95/110 (86%), Positives = 102/110 (92%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKPPVEKPP++KP VEKPPV+KPPVEKPP
Sbjct: 129 VHKPPVEKPPVHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPP 188

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V+KPP EK PVYKPPV KPPVYKP VEKPPV KPPVEKPPV+KPPVEKPP
Sbjct: 189 VHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPP 238

 Score =  211 bits (538), Expect = 2e-53
 Identities = 93/110 (84%), Positives = 102/110 (92%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK P
Sbjct: 354 VYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLP 413

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKPPV KPPV+KPPVEKPP++KP VEKP  YKPP+EK P
Sbjct: 414 VYKPPVEKPPVYKPPVEKPPVHKPPVEKPPLHKPQVEKPTEYKPPIEKFP 463

 Score =  210 bits (534), Expect = 5e-53
 Identities = 95/110 (86%), Positives = 101/110 (91%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKP VEKPPVYKPPVEKPP++KP VEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPP
Sbjct: 149 VYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPP 208

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKP  EKPPV KPPV KPPV+KPPVEKPPV+KPPVEK PVYKP VEKPP
Sbjct: 209 VYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPP 258

 Score =  210 bits (534), Expect = 5e-53
 Identities = 92/110 (83%), Positives = 102/110 (92%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           ++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKPPVEKPP
Sbjct: 374 LHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPP 433

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V+KPP EKPP++KP V KP  YKPP+EK PVYKPPVEKP V+KPPVEKPP
Sbjct: 434 VHKPPVEKPPLHKPQVEKPTEYKPPIEKFPVYKPPVEKPQVHKPPVEKPP 483

 Score =  209 bits (532), Expect = 8e-53
 Identities = 95/110 (86%), Positives = 101/110 (91%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPP++KP VEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP
Sbjct: 159 VYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPP 218

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPP EKPPV+KPPV KPPV+KPPVEK PVYKP VEKPPVYKP VEKPP
Sbjct: 219 VNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPP 268

 Score =  209 bits (531), Expect = 1e-52
 Identities = 92/109 (84%), Positives = 101/109 (92%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKP VEKPP++KPPVEKPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPP
Sbjct: 364 VYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPP 423

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           VYKPP EKPPV+KPPV KPP++KP VEKP  YKPP+EK PVYKPPVEKP
Sbjct: 424 VYKPPVEKPPVHKPPVEKPPLHKPQVEKPTEYKPPIEKFPVYKPPVEKP 472

 Score =  207 bits (528), Expect = 2e-52
 Identities = 94/110 (85%), Positives = 101/110 (91%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KPPVEK PVYKP VEKPPVYKPPVEKPP++KP VEKPPV+KPPVEKPPV+KPPVEK P
Sbjct: 139 VHKPPVEKLPVYKPSVEKPPVYKPPVEKPPLHKPLVEKPPVHKPPVEKPPVHKPPVEKLP 198

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP EKPPVYKP V KPPV KPPVEKPPV+KPPVEKPPV+KPPVEK P
Sbjct: 199 VYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLP 248

 Score =  207 bits (528), Expect = 2e-52
 Identities = 93/115 (80%), Positives = 104/115 (90%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPP 167
           ++KPPVEK P++KPPVEKPPV+KPPVEKPPV     YKPPVEKPPVYKP VEKPP++KPP
Sbjct: 269 LHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPP 328

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VEKPPV+KPP EKPPV+KPPV K PVYKPPVEKPPVYKP VEKPP++KPPVEKPP
Sbjct: 329 VEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPP 383

 Score =  207 bits (526), Expect = 4e-52
 Identities = 93/110 (84%), Positives = 101/110 (91%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPPVEKPP
Sbjct: 179 VHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPP 238

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V+KPP EK PVYKP V KPPVYKP VEKPP++KPPVEK P++KPPVEKPP
Sbjct: 239 VHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPP 288

 Score =  207 bits (526), Expect = 4e-52
 Identities = 93/110 (84%), Positives = 101/110 (91%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPPVEKPPV+KPPVEK P
Sbjct: 189 VHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLP 248

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKP  EKPPVYKP V KPP++KPPVEK P++KPPVEKPPV+KPPVEKPP
Sbjct: 249 VYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPP 298

 Score =  207 bits (526), Expect = 4e-52
 Identities = 94/115 (81%), Positives = 103/115 (89%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPP 167
           VYKP VEKPPVYKP VEKPP++KPPVEK P++KPPVEKPPV+KPPVEKPPV     YKPP
Sbjct: 249 VYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPP 308

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VEKPPVYKP  EKPP++KPPV KPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPP
Sbjct: 309 VEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPP 363

 Score =  207 bits (526), Expect = 4e-52
 Identities = 94/115 (81%), Positives = 103/115 (89%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPP 167
           VYKP VEKPP++KPPVEK P++KPPVEKPPV+KPPVEKPPV     YKPPVEKPPVYKP 
Sbjct: 259 VYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPH 318

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VEKPP++KPP EKPPV+KPPV KPPV+KPPVEK PVYKPPVEKPPVYKP VEKPP
Sbjct: 319 VEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPP 373

 Score =  207 bits (526), Expect = 4e-52
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 20/130 (15%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV----------YKPPVEKPPVYKPPVEKPP 152
           VYKPPVEKPPVYKPPVEKPPV+KPPVEKPP+          YKPP+EK PVYKPPVEKP 
Sbjct: 414 VYKPPVEKPPVYKPPVEKPPVHKPPVEKPPLHKPQVEKPTEYKPPIEKFPVYKPPVEKPQ 473

Query: 153 VYKPPVEKP----------PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP 302
           V+KPPVEKP          PVYKPPAEKPPVYKPPV  PPV+KP VEKPPVYKPPVEKPP
Sbjct: 474 VHKPPVEKPPVHKSPVKKLPVYKPPAEKPPVYKPPVENPPVHKPLVEKPPVYKPPVEKPP 533

Query: 303 VYKPPVEKPP 332
           V+KPP EKPP
Sbjct: 534 VHKPPFEKPP 543

 Score =  206 bits (525), Expect = 5e-52
 Identities = 95/115 (82%), Positives = 102/115 (88%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKP VEKPPV KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPP
Sbjct: 199 VYKPPVEKPPVYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPP 258

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPP 332
           VYKP  EKPP++KPPV K P++KPPVEKPPV+KPPVEKP     PVYKPPVEKPP
Sbjct: 259 VYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPP 313

 Score =  205 bits (521), Expect = 1e-51
 Identities = 93/115 (80%), Positives = 103/115 (89%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKP VEKPP++KPPVEK P++KPPVEKPP
Sbjct: 229 VHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPP 288

Query: 183 VYKPPAEKP-----PVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V+KPP EKP     PVYKPPV KPPVYKP VEKPP++KPPVEKPPV+KPPVEKPP
Sbjct: 289 VHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPP 343

 Score =  204 bits (519), Expect = 2e-51
 Identities = 88/109 (80%), Positives = 98/109 (89%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +EKPPV+KP VEKPP + PP+EKPP+YKPPVEKPP YKPPVE  PVYKP VEKPPV
Sbjct: 40  YKPHIEKPPVHKPLVEKPPTHHPPIEKPPIYKPPVEKPPAYKPPVEHHPVYKPSVEKPPV 99

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +KPP EKPPV+KPPV KPPV+KPPVEKPPV+KPPVEKPPV+KPPVEK P
Sbjct: 100 HKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKLP 148

 Score =  204 bits (518), Expect = 3e-51
 Identities = 97/130 (74%), Positives = 103/130 (79%), Gaps = 20/130 (15%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKPPVEKPPV+KPPVEKPP
Sbjct: 384 VHKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPPVEKPPVHKPPVEKPP 443

Query: 183 V----------YKPPAEKPPVYKPPVYKPPVYKPPVEKP----------PVYKPPVEKPP 302
           +          YKPP EK PVYKPPV KP V+KPPVEKP          PVYKPP EKPP
Sbjct: 444 LHKPQVEKPTEYKPPIEKFPVYKPPVEKPQVHKPPVEKPPVHKSPVKKLPVYKPPAEKPP 503

Query: 303 VYKPPVEKPP 332
           VYKPPVE PP
Sbjct: 504 VYKPPVENPP 513

 Score =  203 bits (517), Expect = 4e-51
 Identities = 93/115 (80%), Positives = 102/115 (88%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKP VEKPP++KPPVEK P
Sbjct: 219 VNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTP 278

Query: 183 VYKPPAEKPPVYKPPVYKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           ++KPP EKPPV+KPPV KP     PVYKPPVEKPPVYKP VEKPP++KPPVEKPP
Sbjct: 279 MHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPP 333

 Score =  203 bits (516), Expect = 6e-51
 Identities = 87/109 (79%), Positives = 96/109 (88%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKPPVE P  YKP +EKPPV+KP VEKPP + PP+EKPP+YKPPVEKPP YKPPVE  PV
Sbjct: 30  YKPPVENPQFYKPHIEKPPVHKPLVEKPPTHHPPIEKPPIYKPPVEKPPAYKPPVEHHPV 89

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP  EKPPV+KPPV KPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPP
Sbjct: 90  YKPSVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPP 138

 Score =  203 bits (516), Expect = 6e-51
 Identities = 92/110 (83%), Positives = 100/110 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           ++KP VEKPPV+KPPVEKPPV+KPPVEK PVYKPPVEKPPVYKP VEKPPV KPPVEKPP
Sbjct: 169 LHKPLVEKPPVHKPPVEKPPVHKPPVEKLPVYKPPVEKPPVYKPHVEKPPVNKPPVEKPP 228

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V+KPP EKPPV+KPPV K PVYKP VEKPPVYKP VEKPP++KPPVEK P
Sbjct: 229 VHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTP 278

 Score =  203 bits (516), Expect = 6e-51
 Identities = 94/115 (81%), Positives = 101/115 (87%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKP VEKPPV KPPVEKPPV+KPPVEKPPV+KPPVEK PVYKP VEKPPVYKP VEKPP
Sbjct: 209 VYKPHVEKPPVNKPPVEKPPVHKPPVEKPPVHKPPVEKLPVYKPHVEKPPVYKPLVEKPP 268

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPP 332
           ++KPP EK P++KPPV KPPV+KPPVEKP     PVYKPPVEKPPVYKP VEKPP
Sbjct: 269 LHKPPVEKTPMHKPPVEKPPVHKPPVEKPPVEKLPVYKPPVEKPPVYKPHVEKPP 323

 Score =  201 bits (511), Expect = 2e-50
 Identities = 92/115 (80%), Positives = 102/115 (88%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP- 179
           V+KPPVEK PVYKP VEKPPVYKP VEKPP++KPPVEK P++KPPVEKPPV+KPPVEKP 
Sbjct: 239 VHKPPVEKLPVYKPHVEKPPVYKPLVEKPPLHKPPVEKTPMHKPPVEKPPVHKPPVEKPP 298

Query: 180 ----PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
               PVYKPP EKPPVYKP V KPP++KPPVEKPPV+KPPVEKPPV+KPPVEK P
Sbjct: 299 VEKLPVYKPPVEKPPVYKPHVEKPPLHKPPVEKPPVHKPPVEKPPVHKPPVEKLP 353

 Score =  191 bits (485), Expect = 2e-47
 Identities = 82/104 (78%), Positives = 90/104 (86%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           EKPP YKPPVE P  YKP +EKPPV+KP VEKPP + PP+EKPP+YKPPVEKPP YKPP 
Sbjct: 25  EKPPEYKPPVENPQFYKPHIEKPPVHKPLVEKPPTHHPPIEKPPIYKPPVEKPPAYKPPV 84

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           E  PVYKP V KPPV+KPPVEKPPV+KPPVEKPPV+KPPVEKPP
Sbjct: 85  EHHPVYKPSVEKPPVHKPPVEKPPVHKPPVEKPPVHKPPVEKPP 128

 Score =  176 bits (445), Expect = 9e-43
 Identities = 76/95 (80%), Positives = 84/95 (88%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKPP+EK PVYKPPVEKP V+KPPVEKPPV+K PV+K PVYKPP EKPPVYKPPVE PPV
Sbjct: 455 YKPPIEKFPVYKPPVEKPQVHKPPVEKPPVHKSPVKKLPVYKPPAEKPPVYKPPVENPPV 514

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPV 290
           +KP  EKPPVYKPPV KPPV+KPP EKPP+Y PP+
Sbjct: 515 HKPLVEKPPVYKPPVEKPPVHKPPFEKPPIYTPPL 549

 Score =  159 bits (403), Expect = 7e-38
 Identities = 69/86 (80%), Positives = 76/86 (88%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKP V+KPPVEKPPV+K PV+K PVYKPP EKPPVYKPPVE PPV+KP VEKPP
Sbjct: 464 VYKPPVEKPQVHKPPVEKPPVHKSPVKKLPVYKPPAEKPPVYKPPVENPPVHKPLVEKPP 523

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPV 260
           VYKPP EKPPV+KPP  KPP+Y PP+
Sbjct: 524 VYKPPVEKPPVHKPPFEKPPIYTPPL 549

[11][TOP]
>UniRef100_C6TGK1 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TGK1_SOYBN
          Length = 161

 Score =  217 bits (553), Expect = 3e-55
 Identities = 95/110 (86%), Positives = 98/110 (89%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YKPPV  PPVYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPP+ KPPVYKPPVEKPP
Sbjct: 33  IYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPP 92

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPPVYKPP+ KPPV KPPVYKPPV KPPVYKPPV KPP
Sbjct: 93  VYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPP 142

 Score =  216 bits (550), Expect = 6e-55
 Identities = 95/110 (86%), Positives = 98/110 (89%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPV KPPV KPPV KPPVYKPP+ KPPVYKPPVEKPPVYKPPV KPP
Sbjct: 43  VYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPP 102

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPP+ KPPVYKPPVYKPPV KPPVYKPPV KPPV KPP+ KPP
Sbjct: 103 VYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVKKPPIYKPP 152

 Score =  213 bits (542), Expect = 5e-54
 Identities = 93/108 (86%), Positives = 96/108 (88%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP+ KPPVY PPV KPPV KPPV KPPVYKPPVEKPPVYKPPV KPP+YKPPV KPPV 
Sbjct: 30  KPPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVE 89

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP  KPPVYKPPVYKPPVYKPP+EKPPVYKPPV KPPVYKPPV KPP
Sbjct: 90  KPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPP 137

 Score =  213 bits (541), Expect = 7e-54
 Identities = 94/110 (85%), Positives = 97/110 (88%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY PPV KPPV KPPV KPPVYKPPVEKPPVYKPPV KPP+YKPPV KPPV KPPV KPP
Sbjct: 38  VYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPP 97

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VYKPP  KPPVYKPP+ KPPVYKPPV KPPVYKPPV KPPVYKPPV+KPP
Sbjct: 98  VYKPPVYKPPVYKPPIEKPPVYKPPVYKPPVYKPPVYKPPVYKPPVKKPP 147

 Score =  199 bits (506), Expect = 8e-50
 Identities = 86/100 (86%), Positives = 90/100 (90%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPV KPP+YKPPV KPPV KPPV KPPVYKPPV KPPVYKPP+EKPP
Sbjct: 58  VYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPPIEKPP 117

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP 302
           VYKPP  KPPVYKPPVYKPPVYKPPV+KPP+YKPP  K P
Sbjct: 118 VYKPPVYKPPVYKPPVYKPPVYKPPVKKPPIYKPPYPKYP 157

 Score =  198 bits (504), Expect = 1e-49
 Identities = 89/110 (80%), Positives = 93/110 (84%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPV KPPV KPPV KPPVYKPP+ KPPVYKPPVEKPPVYKPPV KPPVYKPPV KPP
Sbjct: 53  VYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPVEKPPVYKPPVYKPPVYKPPVYKPP 112

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           + KPP  KPPVYKPPVYKPPVY     KPPVYKPPV+KPP+YKPP  K P
Sbjct: 113 IEKPPVYKPPVYKPPVYKPPVY-----KPPVYKPPVKKPPIYKPPYPKYP 157

 Score =  187 bits (475), Expect = 3e-46
 Identities = 83/99 (83%), Positives = 86/99 (86%), Gaps = 5/99 (5%)
 Frame = +3

Query: 51  EKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPV 215
           EKPP+YKPPV  PPVYKPPVE     KPPVYKPPVEKPPVYKPPV KPP+YKPP  KPPV
Sbjct: 29  EKPPIYKPPVYTPPVYKPPVEKPPVYKPPVYKPPVEKPPVYKPPVYKPPIYKPPVYKPPV 88

Query: 216 YKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            KPPVYKPPVYKPPV KPPVYKPP+EKPPVYKPPV KPP
Sbjct: 89  EKPPVYKPPVYKPPVYKPPVYKPPIEKPPVYKPPVYKPP 127

[12][TOP]
>UniRef100_Q2PET4 Putative uncharacterized protein n=1 Tax=Trifolium pratense
           RepID=Q2PET4_TRIPR
          Length = 478

 Score =  209 bits (531), Expect = 1e-52
 Identities = 85/106 (80%), Positives = 94/106 (88%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE PPVYKPPVEKPPVYKPPVEKPP+YKPP+E PP+YKPP EKPP+YKPP EKPPVYKP
Sbjct: 359 PVETPPVYKPPVEKPPVYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKP 418

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+PP YKPP   PP+YKPP EKPP+YKPP EKPP+YKPP E+PP
Sbjct: 419 PIEEPPFYKPPFENPPIYKPPYEKPPLYKPPFEKPPLYKPPFEEPP 464

 Score =  199 bits (506), Expect = 8e-50
 Identities = 82/109 (75%), Positives = 94/109 (86%), Gaps = 2/109 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPPVEKPPVYKPPVEKPP+YKPP+E PP+YKPP EKPP+YKPP EKPPVYKPP+E+PP
Sbjct: 365 VYKPPVEKPPVYKPPVEKPPMYKPPIENPPIYKPPFEKPPIYKPPFEKPPVYKPPIEEPP 424

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVE 323
            YKPP E PP+YKPP  KPP+YKPP EKPP+YKPP E+PP +   PP +
Sbjct: 425 FYKPPFENPPIYKPPYEKPPLYKPPFEKPPLYKPPFEEPPHHPKYPPAD 473

[13][TOP]
>UniRef100_A9PE91 Predicted protein n=1 Tax=Populus trichocarpa RepID=A9PE91_POPTR
          Length = 182

 Score =  182 bits (463), Expect = 8e-45
 Identities = 89/114 (78%), Positives = 96/114 (84%), Gaps = 4/114 (3%)
 Frame = +3

Query: 3   VYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           VYKPP +EKPPVYKPP    PVYKPP+EKPPVYKPP    PVYKPP+EKPPVYKPP    
Sbjct: 53  VYKPPKIEKPPVYKPP----PVYKPPIEKPPVYKPP----PVYKPPIEKPPVYKPP---- 100

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPP-VEKPPVYKPP-VEKPPVYKPP-VEKPP 332
           PVYKPP EKPPVYKPP+ KPPVYKPP +EKPPVYKPP +EKPPVYKPP +EKPP
Sbjct: 101 PVYKPPIEKPPVYKPPIEKPPVYKPPKIEKPPVYKPPKIEKPPVYKPPKIEKPP 154

 Score =  177 bits (448), Expect = 4e-43
 Identities = 87/114 (76%), Positives = 94/114 (82%), Gaps = 4/114 (3%)
 Frame = +3

Query: 3   VYKP-PVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           V KP P  KPPVYKPP +EKPPVYKPP    PVYKPP+EKPPVYKPP    PVYKPP+EK
Sbjct: 42  VEKPFPEHKPPVYKPPKIEKPPVYKPP----PVYKPPIEKPPVYKPP----PVYKPPIEK 93

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPP-VEKPPVYKPP-VEKPP 332
           PPVYKPP    PVYKPP+ KPPVYKPP+EKPPVYKPP +EKPPVYKPP +EKPP
Sbjct: 94  PPVYKPP----PVYKPPIEKPPVYKPPIEKPPVYKPPKIEKPPVYKPPKIEKPP 143

 Score =  169 bits (429), Expect = 7e-41
 Identities = 85/120 (70%), Positives = 91/120 (75%), Gaps = 11/120 (9%)
 Frame = +3

Query: 6   YKPPV--EKPPVYKPPV-------EKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPV 155
           YKPP    KPP +KPP         KPPVYKPP +EKPPVYKPP    PVYKPP+EKPPV
Sbjct: 25  YKPPKYEPKPPYFKPPKVEKPFPEHKPPVYKPPKIEKPPVYKPP----PVYKPPIEKPPV 80

Query: 156 YKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPP 332
           YKPP    PVYKPP EKPPVYKPP    PVYKPP+EKPPVYKPP+EKPPVYKPP +EKPP
Sbjct: 81  YKPP----PVYKPPIEKPPVYKPP----PVYKPPIEKPPVYKPPIEKPPVYKPPKIEKPP 132

 Score =  162 bits (409), Expect = 1e-38
 Identities = 80/112 (71%), Positives = 88/112 (78%), Gaps = 5/112 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKPP+EKPPVYKPP    PVYKPP+EKPPVYKPP    PVYKPP+EKPPVYKPP+EKPP
Sbjct: 70  VYKPPIEKPPVYKPP----PVYKPPIEKPPVYKPP----PVYKPPIEKPPVYKPPIEKPP 121

Query: 183 VYKPP-AEKPPVYKPP-VYKPPVYKPP-VEKPPVYKPPVEKPPVY--KPPVE 323
           VYKPP  EKPPVYKPP + KPPVYKPP +EKPP +  P+     Y   PPVE
Sbjct: 122 VYKPPKIEKPPVYKPPKIEKPPVYKPPKIEKPPPFHKPLPPYGHYPGHPPVE 173

[14][TOP]
>UniRef100_O24443 Cell wall type 2 proline rich protein PvPRP2-37 (Fragment) n=1
           Tax=Phaseolus vulgaris RepID=O24443_PHAVU
          Length = 81

 Score =  179 bits (453), Expect = 1e-43
 Identities = 78/81 (96%), Positives = 78/81 (96%)
 Frame = +3

Query: 24  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAE 203
           KPPVY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP E
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 204 KPPVYKPPVYKPPVYKPPVEK 266
           KPPVYKPPV KPPVYKPPVEK
Sbjct: 61  KPPVYKPPVEKPPVYKPPVEK 81

 Score =  179 bits (453), Expect = 1e-43
 Identities = 78/81 (96%), Positives = 78/81 (96%)
 Frame = +3

Query: 54  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVY 233
           KPPVY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP EKPPVYKPPV 
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 234 KPPVYKPPVEKPPVYKPPVEK 296
           KPPVYKPPVEKPPVYKPPVEK
Sbjct: 61  KPPVYKPPVEKPPVYKPPVEK 81

 Score =  179 bits (453), Expect = 1e-43
 Identities = 78/81 (96%), Positives = 78/81 (96%)
 Frame = +3

Query: 84  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVE 263
           KPPVY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP EKPPVYKPPV KPPVYKPPVE
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 264 KPPVYKPPVEKPPVYKPPVEK 326
           KPPVYKPPVEKPPVYKPPVEK
Sbjct: 61  KPPVYKPPVEKPPVYKPPVEK 81

 Score =  171 bits (434), Expect = 2e-41
 Identities = 75/78 (96%), Positives = 75/78 (96%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP
Sbjct: 4   VYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 63

Query: 183 VYKPPAEKPPVYKPPVYK 236
           VYKPP EKPPVYKPPV K
Sbjct: 64  VYKPPVEKPPVYKPPVEK 81

 Score =  162 bits (409), Expect = 1e-38
 Identities = 70/73 (95%), Positives = 70/73 (95%)
 Frame = +3

Query: 114 KPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVE 293
           KPPVY PPVEKPPVYKPPVEKPPVYKPP EKPPVYKPPV KPPVYKPPVEKPPVYKPPVE
Sbjct: 1   KPPVYNPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 60

Query: 294 KPPVYKPPVEKPP 332
           KPPVYKPPVEKPP
Sbjct: 61  KPPVYKPPVEKPP 73

[15][TOP]
>UniRef100_Q39686 Proline-rich protein n=1 Tax=Daucus carota RepID=Q39686_DAUCA
          Length = 235

 Score =  164 bits (416), Expect = 2e-39
 Identities = 73/117 (62%), Positives = 88/117 (75%), Gaps = 10/117 (8%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+ KPPVY PPV KPP++KPPV   PV+KPP+ KPPVY PPV KPP++KPPV  PPV+K
Sbjct: 24  PPIHKPPVYTPPVHKPPIHKPPVYTSPVHKPPIHKPPVYTPPVHKPPIHKPPVYTPPVHK 83

Query: 192 PPAE-KPPVYKP--------PVYKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPP 332
           PP+E KPPV           P++KPPVYKPPV+KP P +KPPV KPP++KPPV   P
Sbjct: 84  PPSEYKPPVEATNSVTEDHYPIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTP 140

 Score =  160 bits (404), Expect = 5e-38
 Identities = 78/142 (54%), Positives = 92/142 (64%), Gaps = 32/142 (22%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           ++KPPV  PPV+KPP+ KPPVY  PV KPP++KPPV  PPV+KPP+ KPPVY PPV KPP
Sbjct: 26  IHKPPVYTPPVHKPPIHKPPVYTSPVHKPPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPP 85

Query: 183 -VYKPPAE-------------KPPVYKPPVYKP-PVYKPPVEKPPVYKPPV--------- 290
             YKPP E             KPPVYKPPV KP P +KPPV KPP++KPPV         
Sbjct: 86  SEYKPPVEATNSVTEDHYPIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDD 145

Query: 291 -------EKP-PVYKPPVEKPP 332
                   KP P+++PPV KPP
Sbjct: 146 HYPAHPIHKPQPIHRPPVHKPP 167

 Score =  155 bits (391), Expect = 2e-36
 Identities = 74/143 (51%), Positives = 92/143 (64%), Gaps = 33/143 (23%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP------ 164
           VY PPV KPP++KPPV   PV+KPP+ KPPVY PPV KPP++KPPV  PPV+KP      
Sbjct: 31  VYTPPVHKPPIHKPPVYTSPVHKPPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPPSEYKP 90

Query: 165 -------------PVEKPPVYKPPAEKP-PVYKPPVYKPPVYKPPVEKP----------- 269
                        P+ KPPVYKPP +KP P +KPPV+KPP++KPPV              
Sbjct: 91  PVEATNSVTEDHYPIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAH 150

Query: 270 PVYKP-PVEKPPVYKPPVE-KPP 332
           P++KP P+ +PPV+KPP E KPP
Sbjct: 151 PIHKPQPIHRPPVHKPPTEHKPP 173

 Score =  110 bits (274), Expect = 6e-23
 Identities = 67/148 (45%), Positives = 79/148 (53%), Gaps = 38/148 (25%)
 Frame = +3

Query: 3   VYKPPVEKPPV-YKPPVE-------------KPPVYKPPVEKP-PVYKPPVEKPPVYKPP 137
           VY PPV KPP  YKPPVE             KPPVYKPPV+KP P +KPPV KPP++KPP
Sbjct: 76  VYTPPVHKPPSEYKPPVEATNSVTEDHYPIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPP 135

Query: 138 VE----------------------KPPVYKPPVE-KPPVYKPPAEKPPVYKPPVYKPPVY 248
           V                       +PPV+KPP E KPPV++P  E  P    PVY+PP  
Sbjct: 136 VHNTPSVTDDHYPAHPIHKPQPIHRPPVHKPPTEHKPPVHEPATEHKP---SPVYQPPKT 192

Query: 249 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           + PV   P +KPP   P V +PP    P
Sbjct: 193 EKPV---PEHKPPHLPPIVVRPPPTHKP 217

[16][TOP]
>UniRef100_A9VE05 Predicted protein n=1 Tax=Monosiga brevicollis RepID=A9VE05_MONBE
          Length = 1536

 Score =  155 bits (393), Expect = 1e-36
 Identities = 65/110 (59%), Positives = 78/110 (70%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPP
Sbjct: 1247 VVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPP 1306

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V +PPA KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  KPP
Sbjct: 1307 VVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPP 1356

 Score =  155 bits (393), Expect = 1e-36
 Identities = 65/110 (59%), Positives = 78/110 (70%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  KPP
Sbjct: 1257 VVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPP 1316

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V +PPA KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP  KPP
Sbjct: 1317 VVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPP 1366

 Score =  149 bits (376), Expect = 9e-35
 Identities = 62/103 (60%), Positives = 74/103 (71%)
 Frame = +3

Query: 24   KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAE 203
            KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PPA 
Sbjct: 1244 KPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAA 1303

Query: 204  KPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPP
Sbjct: 1304 KPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPP 1346

 Score =  146 bits (368), Expect = 8e-34
 Identities = 61/104 (58%), Positives = 74/104 (71%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP  KPP
Sbjct: 1267 VVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPP 1326

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
            V +PPA KPP+ +PP  KPPV +PP  KPPV +PP  KPPV +P
Sbjct: 1327 VVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEP 1370

 Score =  145 bits (367), Expect = 1e-33
 Identities = 63/108 (58%), Positives = 76/108 (70%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  
Sbjct: 1244 KPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAA 1303

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            KPP  +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP
Sbjct: 1304 KPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPP 1351

 Score =  143 bits (360), Expect = 7e-33
 Identities = 62/107 (57%), Positives = 75/107 (70%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP  
Sbjct: 1264 KPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAA 1323

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            KPP  +PP  KPP+ +PP  KPPV +PP  KPPV +PP  KPPV +P
Sbjct: 1324 KPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEP 1370

 Score =  138 bits (347), Expect = 2e-31
 Identities = 59/104 (56%), Positives = 69/104 (66%)
 Frame = +3

Query: 21   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
            E P        KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PPA
Sbjct: 1233 EAPTADSSAAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPA 1292

Query: 201  EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             KPP+ +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP
Sbjct: 1293 AKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPP 1336

 Score =  135 bits (339), Expect = 2e-30
 Identities = 59/107 (55%), Positives = 71/107 (66%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            P  +     KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP  K
Sbjct: 1235 PTADSSAAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAK 1294

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  +PP  KPPV +PP  KPPV +PP  KPPV +PP  KPP+ +PP
Sbjct: 1295 PPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPP 1341

 Score =  127 bits (319), Expect = 4e-28
 Identities = 56/105 (53%), Positives = 65/105 (61%)
 Frame = +3

Query: 18   VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
            V KP       E P        KPPV +PP  KPPV +PP  KPPV +PP  KPPV +PP
Sbjct: 1222 VAKPKTEPVDAEAPTADSSAAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPP 1281

Query: 198  AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            A KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP  KPP
Sbjct: 1282 AAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPP 1326

 Score =  116 bits (290), Expect = 9e-25
 Identities = 56/112 (50%), Positives = 66/112 (58%), Gaps = 2/112 (1%)
 Frame = +3

Query: 3    VYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
            V KP  E P   V KP  E      P  +     KPPV +PP  KPPV +PP  KPPV +
Sbjct: 1210 VAKPRPEAPASEVAKPKTEPVDAEAPTADSSAAAKPPVVEPPAAKPPVVEPPAAKPPVVE 1269

Query: 177  PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  KPP  +PP  KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP
Sbjct: 1270 PPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPP 1321

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 38/66 (57%), Positives = 46/66 (69%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V +PP  KPPV +PP  KPPV +PP  KPP+ +PP  KPPV +PP  KPPV +PP  KPP
Sbjct: 1307 VVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPP 1366

Query: 183  VYKPPA 200
            V +P A
Sbjct: 1367 VVEPTA 1372

[17][TOP]
>UniRef100_UPI0001983482 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983482
          Length = 329

 Score =  154 bits (388), Expect = 4e-36
 Identities = 86/119 (72%), Positives = 97/119 (81%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPV 170
           +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPV
Sbjct: 37  HKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPV 96

Query: 171 EK-PPVYKPPAEK-PPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPP 332
           EK PP +KPP EK PP +KPPV K PP +KPPVEK PP +KPPVEK PP +KPPVEKPP
Sbjct: 97  EKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPP 155

 Score =  149 bits (376), Expect = 9e-35
 Identities = 84/117 (71%), Positives = 94/117 (80%), Gaps = 10/117 (8%)
 Frame = +3

Query: 12  PPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK 176
           PP EKPP  +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK PP +KPPVEK
Sbjct: 28  PPFEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEK 87

Query: 177 -PPVYKPPAEK-PPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPP 332
            PP +KPP EK PP +KPPV K PP +KPPVEK PP +KPPVEK PP +KPPVEKPP
Sbjct: 88  PPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPP 144

 Score =  149 bits (376), Expect = 9e-35
 Identities = 87/130 (66%), Positives = 99/130 (76%), Gaps = 21/130 (16%)
 Frame = +3

Query: 6   YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPV 170
           +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPV
Sbjct: 92  HKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPV 151

Query: 171 EKPPV-YKPPAEKPPV-YKPPV------YKPPV------YKPPVEK-PPVYKPPVEK-PP 302
           EKPP  +KPP EKPP  +KPPV      +KPPV      +KPPVEK PP +KPPVEK PP
Sbjct: 152 EKPPPEHKPPVEKPPPEHKPPVEKPPPLHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPP 211

Query: 303 VYKPPVEKPP 332
            +KPPVEKPP
Sbjct: 212 EHKPPVEKPP 221

 Score =  109 bits (273), Expect = 8e-23
 Identities = 74/124 (59%), Positives = 83/124 (66%), Gaps = 14/124 (11%)
 Frame = +3

Query: 3   VYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEK-PPVYKPP 167
           ++KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KPPVEK PP +KPP
Sbjct: 179 LHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPP 238

Query: 168 VEKPPVYKPPAEKP-PVYKPPVYKPPVYKPPV-EKPP-----VYKPPVEK-PPVYKPPVE 323
           VEKPP      EKP P +KPP    PV KPP  EKPP        PP E     YKPP +
Sbjct: 239 VEKPP--PEHKEKPLPEHKPPT---PVGKPPKGEKPPHCGHNPGHPPAENAEDSYKPPRK 293

Query: 324 -KPP 332
            KPP
Sbjct: 294 IKPP 297

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 3/60 (5%)
 Frame = +3

Query: 162 PPVEKPPVYKPPAEKPPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPP 332
           P +   P + P  + PP +KPPV K PP +KPPVEK PP +KPPVEK PP +KPPVEKPP
Sbjct: 19  PSLADYPTHPPFEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPP 78

[18][TOP]
>UniRef100_P06600 Proline-rich 33 kDa extensin-related protein (Fragment) n=1
           Tax=Daucus carota RepID=PRP33_DAUCA
          Length = 211

 Score =  151 bits (382), Expect = 2e-35
 Identities = 75/138 (54%), Positives = 91/138 (65%), Gaps = 28/138 (20%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVE------------ 143
           ++KPPV  PPV+KPP+ KPPVY PPV KPPVY PPV KPP  YKPPVE            
Sbjct: 22  IHKPPVYTPPVHKPPIHKPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHYPI 81

Query: 144 -KPPVYKPPVEKP-PVYKPPAEKPPVYKPPVYKP-----------PVYKP-PVEKPPVYK 281
            KPPVYKPPV+KP P +KPP  KPP++KPPV+             P++KP P+ +PPV+K
Sbjct: 82  HKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPVHK 141

Query: 282 PPVE-KPPVYKPPVEKPP 332
           PP E KPPV++P  E  P
Sbjct: 142 PPTEHKPPVHEPATEHKP 159

 Score =  148 bits (373), Expect = 2e-34
 Identities = 73/130 (56%), Positives = 87/130 (66%), Gaps = 28/130 (21%)
 Frame = +3

Query: 27  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVE---------- 173
           PP++KPPV  PPV+KPP+ KPPVY PPV KPPVY PPV KPP  YKPPVE          
Sbjct: 20  PPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHY 79

Query: 174 ---KPPVYKPPAEKP-PVYKPPVYKPPVYKPPVEKP-----------PVYKP-PVEKPPV 305
              KPPVYKPP +KP P +KPPV+KPP++KPPV              P++KP P+ +PPV
Sbjct: 80  PIHKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPV 139

Query: 306 YKPPVE-KPP 332
           +KPP E KPP
Sbjct: 140 HKPPTEHKPP 149

 Score =  106 bits (265), Expect = 7e-22
 Identities = 71/169 (42%), Positives = 80/169 (47%), Gaps = 62/169 (36%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPV-YKPPVE-------------KPPVYKPPVEKP-PVYKPP 137
           VY PPV KPPVY PPV KPP  YKPPVE             KPPVYKPPV+KP P +KPP
Sbjct: 42  VYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHYPIHKPPVYKPPVQKPAPEHKPP 101

Query: 138 VEKPPVYKPPVE----------------------KPPVYKPPAE-KPPVY---------- 218
           V KPP++KPPV                       +PPV+KPP E KPPV+          
Sbjct: 102 VHKPPIHKPPVHNTPSVTDDHYPAHPIHKPQPIHRPPVHKPPTEHKPPVHEPATEHKPSP 161

Query: 219 --------------KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
                         KPP   P V +PP    P   PP    P + PPVE
Sbjct: 162 VYQPPKTEKPVPEHKPPHLPPIVVRPPPTHKP--NPPYGHHPRH-PPVE 207

[19][TOP]
>UniRef100_P93237 Proline-rich protein PRP2 n=1 Tax=Lupinus luteus RepID=P93237_LUPLU
          Length = 894

 Score =  149 bits (375), Expect = 1e-34
 Identities = 77/127 (60%), Positives = 88/127 (69%), Gaps = 18/127 (14%)
 Frame = +3

Query: 6   YKPPVEKPPVYKP-PVEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPVEK 176
           Y PP EKPP+  P P EKPPVY+PP EKPP V+ PP EKPP+ Y PP EKPPV++PP EK
Sbjct: 533 YPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEK 592

Query: 177 PPV------------YKPPAEKPPV-YKPPVYKPPV-YKPPVEKPPV-YKPPVEKPPVYK 311
           PP+            Y PP EKPP+ Y PP  KPP+ Y PP EKPP+ Y PP EKPPVY+
Sbjct: 593 PPLVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYE 652

Query: 312 PPVEKPP 332
           PP EKPP
Sbjct: 653 PPYEKPP 659

 Score =  147 bits (370), Expect = 5e-34
 Identities = 73/122 (59%), Positives = 88/122 (72%), Gaps = 12/122 (9%)
 Frame = +3

Query: 3   VYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP-------VYKPPVEKPPV 155
           VY+PP EK PPV+ PP EKPP+ Y PP EKPPV++PP +KPP        Y PP EKPPV
Sbjct: 392 VYEPPYEKSPPVHPPPDEKPPIEYPPPHEKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPV 451

Query: 156 YKPPVEK-PPVYKPPAEKPPVYKPPVY-KPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEK 326
           Y+PP EK PPV+ PP EKPP+  PP + KPP+++PP EK PPV+ PPV  PP  KPP+E 
Sbjct: 452 YEPPYEKSPPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEKPPIEY 511

Query: 327 PP 332
           PP
Sbjct: 512 PP 513

 Score =  147 bits (370), Expect = 5e-34
 Identities = 75/118 (63%), Positives = 89/118 (75%), Gaps = 8/118 (6%)
 Frame = +3

Query: 3   VYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPV 170
           V+ PP +KPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPPVY+PP 
Sbjct: 596 VHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPY 655

Query: 171 EK-PPVYKPPAEKPPV-YKPPVYKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPP 332
           EK PPV+ PP EKPP+ Y PP+ KPPV++PP EK PPV  PP +KPP+ Y PP EKPP
Sbjct: 656 EKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEKPP 713

 Score =  146 bits (368), Expect = 8e-34
 Identities = 75/118 (63%), Positives = 90/118 (76%), Gaps = 8/118 (6%)
 Frame = +3

Query: 3   VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPP 167
           V++PP EKPP V+ PP +KPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP
Sbjct: 585 VHEPPYEKPPLVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPP 644

Query: 168 VEKPPVYKPPAEK-PPVYKPPVYKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP 332
            EKPPVY+PP EK PPV+ PP  KPP+ Y PP+EKPPV++PP EK PPV  PP +KPP
Sbjct: 645 HEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPP 702

 Score =  142 bits (359), Expect = 9e-33
 Identities = 72/122 (59%), Positives = 87/122 (71%), Gaps = 12/122 (9%)
 Frame = +3

Query: 3   VYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP-------VYKPPVEKPPVYKPPVEK-PPV 155
           V+ PP EKPP+ Y PP EKPPV++PP +KPP        Y PP EKPPVY+PP EK PPV
Sbjct: 403 VHPPPDEKPPIEYPPPHEKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYEKSPPV 462

Query: 156 YKPPVEKPP-VYKPPAEKPPVYKPPVYK-PPVYKPPVEKPPVYKPPVEKPPVY-KPPVEK 326
           + PP EKPP V+ PP EKPP+++PP  K PPV+ PPV  PP  KPP+E PP + KPP+E 
Sbjct: 463 HPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEKPPIEYPPPHTKPPIEY 522

Query: 327 PP 332
           PP
Sbjct: 523 PP 524

 Score =  142 bits (359), Expect = 9e-33
 Identities = 73/122 (59%), Positives = 88/122 (72%), Gaps = 12/122 (9%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVY-KPPVE------KPPV- 155
           V+ PP EKPP+++PP EK PPV+ PPV  PP  KPP+E PP + KPP+E      KPP+ 
Sbjct: 473 VHPPPHEKPPLFEPPFEKPPPVHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHVKPPIQ 532

Query: 156 YKPPVEKPPV-YKPPAEKPPVYKPPVYK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK 326
           Y PP EKPP+ Y  P EKPPVY+PP  K PPV+ PP EKPP+ Y PP EKPPV++PP EK
Sbjct: 533 YPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEK 592

Query: 327 PP 332
           PP
Sbjct: 593 PP 594

 Score =  142 bits (359), Expect = 9e-33
 Identities = 73/117 (62%), Positives = 88/117 (75%), Gaps = 7/117 (5%)
 Frame = +3

Query: 3    VYKPPVEKPPV-YKPPVEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPVE 173
            V+ PP EKPP+ Y PP+EKPPV++PP EKPP V  PP +KPP+ Y PP EKPPVY+PP E
Sbjct: 661  VHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPVQPPPHDKPPIEYPPPHEKPPVYEPPYE 720

Query: 174  K-PPVYKPPAEKPP-VYKPPVYKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPP 332
            + PPV+ P  EKPP VY PP  K P+++PP EK PPV+ PP EKPP+ Y PP EKPP
Sbjct: 721  RSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPP 777

 Score =  141 bits (355), Expect = 3e-32
 Identities = 76/138 (55%), Positives = 87/138 (63%), Gaps = 29/138 (21%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPV-------- 155
           Y PP EKPPVY+PP +KPP V+ PP EKPP+ Y PP EKPPV++PP EKPP         
Sbjct: 275 YPPPHEKPPVYEPPYDKPPPVHPPPHEKPPIEYPPPHEKPPVHEPPYEKPPPEHSPPHDK 334

Query: 156 ----YKPPVEKPPV-YKPPAEKPPV-YKPPVYKPPV------------YKPPVEKPPVYK 281
               Y PP EKPP+ Y PP EKPP+ Y PP  KPP+            Y PP EK PVY+
Sbjct: 335 PPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPSIEYPPPHEKSPVYE 394

Query: 282 PPVEK-PPVYKPPVEKPP 332
           PP EK PPV+ PP EKPP
Sbjct: 395 PPYEKSPPVHPPPDEKPP 412

 Score =  140 bits (354), Expect = 3e-32
 Identities = 68/116 (58%), Positives = 86/116 (74%), Gaps = 6/116 (5%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPVEK 176
           V++PP E PP+  PP EKPP+++ P EK PPV+ PP +KP + Y PP EKPPVY+PP +K
Sbjct: 232 VHQPPYETPPIENPPHEKPPIHESPYEKPPPVHPPPHDKPSIEYPPPHEKPPVYEPPYDK 291

Query: 177 -PPVYKPPAEKPPV-YKPPVYKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPP 332
            PPV+ PP EKPP+ Y PP  KPPV++PP EK PP + PP +KPP+ Y PP EKPP
Sbjct: 292 PPPVHPPPHEKPPIEYPPPHEKPPVHEPPYEKPPPEHSPPHDKPPIEYHPPHEKPP 347

 Score =  140 bits (353), Expect = 4e-32
 Identities = 71/124 (57%), Positives = 85/124 (68%), Gaps = 17/124 (13%)
 Frame = +3

Query: 12  PPVEKPPV-YKPPVEKPP-VYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           PP +KPP+ Y P  EKPP VY+PP EK PPV++PP E PP+  PP EKPP+++ P EKPP
Sbjct: 202 PPHKKPPIGYPPSYEKPPPVYEPPYEKSPPVHQPPYETPPIENPPHEKPPIHESPYEKPP 261

Query: 183 ------------VYKPPAEKPPVYKPPVYK-PPVYKPPVEKPPV-YKPPVEKPPVYKPPV 320
                        Y PP EKPPVY+PP  K PPV+ PP EKPP+ Y PP EKPPV++PP 
Sbjct: 262 PVHPPPHDKPSIEYPPPHEKPPVYEPPYDKPPPVHPPPHEKPPIEYPPPHEKPPVHEPPY 321

Query: 321 EKPP 332
           EKPP
Sbjct: 322 EKPP 325

 Score =  140 bits (353), Expect = 4e-32
 Identities = 74/130 (56%), Positives = 87/130 (66%), Gaps = 23/130 (17%)
 Frame = +3

Query: 12  PPVEKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-- 176
           PP +KPP+ Y PP EKPPVY+PP EK PPV+ PP EKPP V+ PP EKPP+++PP EK  
Sbjct: 433 PPHDKPPIEYPPPHEKPPVYEPPYEKSPPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPP 492

Query: 177 ----PPVYKPPAEKPPV------------YKPPVYKPPV-YKPPVEKPPV-YKPPVEKPP 302
               PPV+ PP EKPP+            Y PP  KPP+ Y PP EKPP+ Y  P EKPP
Sbjct: 493 PVHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPP 552

Query: 303 VYKPPVEKPP 332
           VY+PP EKPP
Sbjct: 553 VYEPPYEKPP 562

 Score =  136 bits (343), Expect = 6e-31
 Identities = 74/132 (56%), Positives = 85/132 (64%), Gaps = 23/132 (17%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEK 176
            Y PP EKPPVY+PP E+ PPV+ P  EKPP VY PP EK P+++PP EK PPV+ PP EK
Sbjct: 705  YPPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEK 764

Query: 177  PPV-YKPPAEKPPVYKPPVY------------------KPPVYKPPVEKPPVYKPPVEKP 299
            PP+ Y PP EKPPV  PP +                  KPP+  PP EKPPVY+PP EKP
Sbjct: 765  PPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYEPPYEKP 824

Query: 300  P-VYKPPVEKPP 332
            P V  PP EKPP
Sbjct: 825  PSVCPPPHEKPP 836

 Score =  135 bits (341), Expect = 1e-30
 Identities = 73/122 (59%), Positives = 84/122 (68%), Gaps = 13/122 (10%)
 Frame = +3

Query: 6   YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEK------PPVY 158
           Y PP EKPP+ Y PP EKPP+ Y PP EKP + Y PP EK PVY+PP EK      PP  
Sbjct: 350 YPPPHEKPPIEYPPPHEKPPIEYPPPHEKPSIEYPPPHEKSPVYEPPYEKSPPVHPPPDE 409

Query: 159 KPPVEKPPVY-KPPAEKPPVYKPPVY-KPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEK 326
           KPP+E PP + KPP  +PP  KPP + KPP+ Y PP EKPPVY+PP EK PPV+ PP EK
Sbjct: 410 KPPIEYPPPHEKPPVHEPPYKKPPPHDKPPIEYPPPHEKPPVYEPPYEKSPPVHPPPHEK 469

Query: 327 PP 332
           PP
Sbjct: 470 PP 471

 Score =  126 bits (316), Expect = 9e-28
 Identities = 70/142 (49%), Positives = 87/142 (61%), Gaps = 32/142 (22%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEK--PPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKP-PVYKPP 167
           +Y  P EKPP+  PP     PP+Y+PP EKPP ++ PP EKPP+ Y PP EKP PVY+PP
Sbjct: 110 LYPSPHEKPPIECPPPHDKLPPIYEPPNEKPPPLHPPPHEKPPIDYPPPHEKPSPVYEPP 169

Query: 168 VEKPPV------------YKPPAEKPP-VYKPPVYK-------------PPVYKPPVEK- 266
            EKPP+            Y+ P+EKPP V+ PP +K             PPVY+PP EK 
Sbjct: 170 YEKPPILHPPPHEKPPPLYESPSEKPPHVHPPPPHKKPPIGYPPSYEKPPPVYEPPYEKS 229

Query: 267 PPVYKPPVEKPPVYKPPVEKPP 332
           PPV++PP E PP+  PP EKPP
Sbjct: 230 PPVHQPPYETPPIENPPHEKPP 251

 Score =  118 bits (296), Expect = 2e-25
 Identities = 69/132 (52%), Positives = 83/132 (62%), Gaps = 22/132 (16%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPP--VEKPPVY-KPPVEK-PPVYKPPVEK------------PPVYKP 134
           VY PP EKP +  PP   EKPP + KPP EK PP Y PP E+            PP+Y  
Sbjct: 54  VYHPPREKPSIENPPPSYEKPPPHEKPPHEKSPPEYSPPHEEPTPEFPPSHEKSPPLYPS 113

Query: 135 PVEKPPVYKPPV--EKPPVYKPPAEK-PPVYKPPVYKPPV-YKPPVEKP-PVYKPPVEKP 299
           P EKPP+  PP   + PP+Y+PP EK PP++ PP  KPP+ Y PP EKP PVY+PP EKP
Sbjct: 114 PHEKPPIECPPPHDKLPPIYEPPNEKPPPLHPPPHEKPPIDYPPPHEKPSPVYEPPYEKP 173

Query: 300 PV-YKPPVEKPP 332
           P+ + PP EKPP
Sbjct: 174 PILHPPPHEKPP 185

 Score =  117 bits (293), Expect = 4e-25
 Identities = 69/129 (53%), Positives = 81/129 (62%), Gaps = 22/129 (17%)
 Frame = +3

Query: 12  PPV-EKPPVYKPPVEKPPVYKPP--VEKPPVY-KPPVEK-PPVYKPPVEK---------- 146
           PPV E PPVY PP EKP +  PP   EKPP + KPP EK PP Y PP E+          
Sbjct: 46  PPVYEPPPVYHPPREKPSIENPPPSYEKPPPHEKPPHEKSPPEYSPPHEEPTPEFPPSHE 105

Query: 147 --PPVYKPPVEKPPVYKPPA--EKPPVYKPPVYK-PPVYKPPVEKPPV-YKPPVEKP-PV 305
             PP+Y  P EKPP+  PP   + PP+Y+PP  K PP++ PP EKPP+ Y PP EKP PV
Sbjct: 106 KSPPLYPSPHEKPPIECPPPHDKLPPIYEPPNEKPPPLHPPPHEKPPIDYPPPHEKPSPV 165

Query: 306 YKPPVEKPP 332
           Y+PP EKPP
Sbjct: 166 YEPPYEKPP 174

 Score =  104 bits (259), Expect = 4e-21
 Identities = 62/115 (53%), Positives = 71/115 (61%), Gaps = 12/115 (10%)
 Frame = +3

Query: 3    VYKPPVEKPPV-YKPPVEKPPV------YKPPVEKP-PVYKPPV-EKPPVYKPPVEKPPV 155
            V+ PP EKPP+ Y PP EKPPV       KPPVE P P  KPP  EKPP+  PP EKPPV
Sbjct: 757  VHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPV 816

Query: 156  YKPPVEKPP-VYKPPAEKPPVY--KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
            Y+PP EKPP V  PP EKPP +  +  +Y P   KPP    P+   P +KPP YK
Sbjct: 817  YEPPYEKPPSVCPPPHEKPPHHEKRSALYPPHHRKPPNHHKPL---PYKKPPFYK 868

[20][TOP]
>UniRef100_Q06841 Early nodulin-75 (Fragment) n=1 Tax=Lupinus luteus RepID=NO75_LUPLU
          Length = 434

 Score =  149 bits (375), Expect = 1e-34
 Identities = 77/127 (60%), Positives = 88/127 (69%), Gaps = 18/127 (14%)
 Frame = +3

Query: 6   YKPPVEKPPVYKP-PVEKPPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPVEK 176
           Y PP EKPP+  P P EKPPVY+PP EKPP V+ PP EKPP+ Y PP EKPPV++PP EK
Sbjct: 75  YPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHEKPPVHEPPYEK 134

Query: 177 PPV------------YKPPAEKPPV-YKPPVYKPPV-YKPPVEKPPV-YKPPVEKPPVYK 311
           PP+            Y PP EKPP+ Y PP  KPP+ Y PP EKPP+ Y PP EKPPVY+
Sbjct: 135 PPLVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYE 194

Query: 312 PPVEKPP 332
           PP EKPP
Sbjct: 195 PPYEKPP 201

 Score =  147 bits (370), Expect = 5e-34
 Identities = 75/128 (58%), Positives = 89/128 (69%), Gaps = 18/128 (14%)
 Frame = +3

Query: 3   VYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPV 170
           V+ PP +KPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPPVY+PP 
Sbjct: 138 VHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPPHEKPPVYEPPY 197

Query: 171 EK-PPVYKPPAEKPPV-YKPPVYKPPVYKPPVEKPP------------VYKPPVEKPPVY 308
           EK PPV+ PP EKPP+ Y PP+ KPPV++PP EKPP             Y PP EKPPVY
Sbjct: 198 EKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPPHEKPPVY 257

Query: 309 KPPVEKPP 332
           +PP E+ P
Sbjct: 258 EPPYERSP 265

 Score =  144 bits (364), Expect = 2e-33
 Identities = 74/118 (62%), Positives = 89/118 (75%), Gaps = 8/118 (6%)
 Frame = +3

Query: 3   VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPP 167
           V++PP EKPP V+ PP +KPP+ Y PP EKPP+ Y PP EKPP+ Y PP EKPP+ Y PP
Sbjct: 127 VHEPPYEKPPLVHPPPHDKPPIEYHPPHEKPPIEYPPPHEKPPIEYPPPHEKPPIEYPPP 186

Query: 168 VEKPPVYKPPAEK-PPVYKPPVYKPPV-YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP 332
            EKPPVY+PP EK PPV+ PP  KPP+ Y PP+EKPPV++PP EK PP   PP +KPP
Sbjct: 187 HEKPPVYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPAQPPPHDKPP 244

 Score =  142 bits (358), Expect = 1e-32
 Identities = 75/128 (58%), Positives = 89/128 (69%), Gaps = 18/128 (14%)
 Frame = +3

Query: 3   VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPV------------YKPPV 140
           VY+PP EKPP V+ PP EKPP+ Y PP+EKPPV++PP EKPP             Y PP 
Sbjct: 192 VYEPPYEKPPPVHPPPDEKPPIEYPPPLEKPPVHEPPYEKPPPAQPPPHDKPPIEYPPPH 251

Query: 141 EKPPVYKPPVEK-PPVYKPPAEKPP-VYKPPVYKPPVYKPPVEK-PPVYKPPVEKPPV-Y 308
           EKPPVY+PP E+ PPV+ P  EKPP VY PP  K P+++PP EK PPV+ PP EKPP+ Y
Sbjct: 252 EKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEY 311

Query: 309 KPPVEKPP 332
            PP EKPP
Sbjct: 312 APPHEKPP 319

 Score =  139 bits (350), Expect = 1e-31
 Identities = 74/133 (55%), Positives = 88/133 (66%), Gaps = 23/133 (17%)
 Frame = +3

Query: 3   VYKPPVEKPP-VYKPPVEKPPVYKPPVEK------PPVYKPPVEKPPV-YKPPVEKPPV- 155
           V+ PP EKPP V+ PP EKPP+++PP EK      PPV+ PP EKPP+ Y PP  KPP+ 
Sbjct: 4   VHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPAHPPPVHPPPHEKPPIEYPPPHTKPPIE 63

Query: 156 -----------YKPPVEKPPV-YKPPAEKPPVYKPPVYK-PPVYKPPVEKPPV-YKPPVE 293
                      Y PP EKPP+ Y  P EKPPVY+PP  K PPV+ PP EKPP+ Y PP E
Sbjct: 64  YPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPPPVHPPPHEKPPIEYSPPHE 123

Query: 294 KPPVYKPPVEKPP 332
           KPPV++PP EKPP
Sbjct: 124 KPPVHEPPYEKPP 136

 Score =  136 bits (343), Expect = 6e-31
 Identities = 74/132 (56%), Positives = 85/132 (64%), Gaps = 23/132 (17%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEK 176
           Y PP EKPPVY+PP E+ PPV+ P  EKPP VY PP EK P+++PP EK PPV+ PP EK
Sbjct: 247 YPPPHEKPPVYEPPYERSPPVHPPSHEKPPFVYPPPHEKSPMHEPPYEKAPPVHLPPHEK 306

Query: 177 PPV-YKPPAEKPPVYKPPVY------------------KPPVYKPPVEKPPVYKPPVEKP 299
           PP+ Y PP EKPPV  PP +                  KPP+  PP EKPPVY+PP EKP
Sbjct: 307 PPIEYAPPHEKPPVEYPPPHVKPPVEYPSPAEKPPTHEKPPIEFPPHEKPPVYEPPYEKP 366

Query: 300 P-VYKPPVEKPP 332
           P V  PP EKPP
Sbjct: 367 PSVCPPPHEKPP 378

 Score =  125 bits (313), Expect = 2e-27
 Identities = 76/140 (54%), Positives = 85/140 (60%), Gaps = 31/140 (22%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPV-YKPPVEKPPV------YKPPVEKP-PV 155
           VY PP EK P+++PP EK PPV+ PP EKPP+ Y PP EKPPV       KPPVE P P 
Sbjct: 278 VYPPPHEKSPMHEPPYEKAPPVHLPPHEKPPIEYAPPHEKPPVEYPPPHVKPPVEYPSPA 337

Query: 156 YKPPV-EKPPVYKPPAEKPPVYKPPVYKPP-VYKPPVEKPP-------VYKP-------- 284
            KPP  EKPP+  PP EKPPVY+PP  KPP V  PP EKPP       +Y P        
Sbjct: 338 EKPPTHEKPPIEFPPHEKPPVYEPPYEKPPSVCPPPHEKPPHHEKRSALYPPHHRKPPNH 397

Query: 285 ----PVEKPPVYK-PPVEKP 329
               P +KPP YK PPVEKP
Sbjct: 398 HKPLPYKKPPFYKSPPVEKP 417

 Score =  121 bits (303), Expect = 3e-26
 Identities = 62/103 (60%), Positives = 73/103 (70%), Gaps = 11/103 (10%)
 Frame = +3

Query: 57  PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEK------PPVYKPPVEKPPV-YKPPAEKPP 212
           PPV+ PP EKPP V+ PP EKPP+++PP EK      PPV+ PP EKPP+ Y PP  KPP
Sbjct: 2   PPVHPPPHEKPPIVHPPPHEKPPLFEPPFEKPPPAHPPPVHPPPHEKPPIEYPPPHTKPP 61

Query: 213 V-YKPPVYKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVEKPP 332
           + Y PP  KPP+ Y PP EKPP+ Y  P EKPPVY+PP EKPP
Sbjct: 62  IEYPPPHVKPPIQYPPPHEKPPIEYPLPHEKPPVYEPPYEKPP 104

[21][TOP]
>UniRef100_Q41402 Nodulin n=1 Tax=Sesbania rostrata RepID=Q41402_SESRO
          Length = 330

 Score =  148 bits (374), Expect = 2e-34
 Identities = 81/116 (69%), Positives = 82/116 (70%), Gaps = 6/116 (5%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPP-VEKPPVY-KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           VY PP EKPP  KPP  EKPP Y KPP EKPP  KPP EKPP  KPP +KPP  KPP EK
Sbjct: 177 VYPPPYEKPPHEKPPSYEKPPPYEKPPHEKPPYEKPPHEKPPHEKPPYDKPPYEKPPHEK 236

Query: 177 PPVYKPPAEK-PPVYKPPVYK-PPVYKPPVEKPPVY-KPPVEK-PPVYKPPVEKPP 332
           PP  KPP EK PP YKPP  K PP YKPP EKPP Y KPP EK PP YKPP EKPP
Sbjct: 237 PPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPPPYEKPPHEKPPPEYKPPHEKPP 292

 Score =  145 bits (367), Expect = 1e-33
 Identities = 79/115 (68%), Positives = 82/115 (71%), Gaps = 6/115 (5%)
 Frame = +3

Query: 6   YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPP-VYKPPVEKPPVYKPP-VEKPPVY-KPPV 170
           Y+PP EKPP  Y+PP EKPP  Y+PP EKPP VY PP EKPP  KPP  EKPP Y KPP 
Sbjct: 145 YQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPPVYPPPYEKPPHEKPPSYEKPPPYEKPPH 204

Query: 171 EKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPP 332
           EKPP  KPP EKPP  KPP  KPP  KPP EKPP  KPP EK PP YKPP EKPP
Sbjct: 205 EKPPYEKPPHEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPPPEYKPPHEKPP 259

 Score =  145 bits (367), Expect = 1e-33
 Identities = 75/114 (65%), Positives = 80/114 (70%), Gaps = 6/114 (5%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPV 185
           KPP EKPP  KPP EKPP  KPP +KPP  KPP EKPP  KPP EKPP  YKPP EKPP 
Sbjct: 201 KPPHEKPPYEKPPHEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPPPEYKPPHEKPPP 260

Query: 186 -YKPPAEKPPVYKPPVYK--PPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPP 332
            YKPP EKPP Y+ P ++  PP YKPP EKPP   Y P V+ PP YKPP EKPP
Sbjct: 261 EYKPPHEKPPPYEKPPHEKPPPEYKPPHEKPPPPEYPPYVKPPPEYKPPHEKPP 314

 Score =  135 bits (341), Expect = 1e-30
 Identities = 78/125 (62%), Positives = 87/125 (69%), Gaps = 15/125 (12%)
 Frame = +3

Query: 3   VYKPPV------EKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PP 152
           VYKPP+      + PPVY PP EK PPVY PP EK PPVY PP EK PP Y+PP EK PP
Sbjct: 51  VYKPPIFPPPYEKPPPVYSPPYEKPPPVYPPPYEKPPPVYPPPYEKPPPEYQPPHEKPPP 110

Query: 153 VYKPPVEK-PPVYKPPAEK-PPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPP 317
            Y+PP E  PP Y+PP EK PP Y+PP  K PP Y+PP EK PP Y+PP EK PP Y+PP
Sbjct: 111 EYQPPHENPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPP 170

Query: 318 VEKPP 332
            EKPP
Sbjct: 171 QEKPP 175

 Score =  134 bits (337), Expect = 3e-30
 Identities = 74/116 (63%), Positives = 82/116 (70%), Gaps = 9/116 (7%)
 Frame = +3

Query: 12  PPVEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEK-PPVYKPPVEK- 176
           PP+EKPP Y+PP   EKPP    PV KPP++ PP EKPP VY PP EK PPVY PP EK 
Sbjct: 31  PPIEKPPTYEPPPTYEKPP----PVYKPPIFPPPYEKPPPVYSPPYEKPPPVYPPPYEKP 86

Query: 177 PPVYKPPAEK-PPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPP 332
           PPVY PP EK PP Y+PP  K PP Y+PP E  PP Y+PP EK PP Y+PP EKPP
Sbjct: 87  PPVYPPPYEKPPPEYQPPHEKPPPEYQPPHENPPPEYQPPHEKPPPEYQPPHEKPP 142

 Score =  125 bits (315), Expect = 1e-27
 Identities = 73/119 (61%), Positives = 75/119 (63%), Gaps = 13/119 (10%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPP 182
           KPP EKPP  KPP +KPP  KPP EKPP  KPP EKPP  YKPP EKPP  YKPP EKPP
Sbjct: 211 KPPHEKPPHEKPPYDKPPYEKPPHEKPPHEKPPHEKPPPEYKPPHEKPPPEYKPPHEKPP 270

Query: 183 VY-KPPAEKPPV-YKPPVYKPP-------VYKPPVEKPPVYKPPVEKPPVY--KPPVEK 326
            Y KPP EKPP  YKPP  KPP       V  PP  KPP  KPP   PP Y   PP +K
Sbjct: 271 PYEKPPHEKPPPEYKPPHEKPPPPEYPPYVKPPPEYKPPHEKPPGYNPPPYGHYPPSKK 329

[22][TOP]
>UniRef100_Q9FUR6 ENOD2 (Fragment) n=1 Tax=Cladrastis kentukea RepID=Q9FUR6_CLALU
          Length = 244

 Score =  147 bits (371), Expect = 4e-34
 Identities = 82/122 (67%), Positives = 89/122 (72%), Gaps = 17/122 (13%)
 Frame = +3

Query: 3   VYKPPVEKPP-VYKPPVEK--PPVYKPPVEKPP-VYKPPVEK--PPVYKPPVEKPP-VYK 161
           VY PP EKPP VY+PP  +  PPVY PP EKPP VY+PP  +  PPVY PP EKPP VY+
Sbjct: 113 VYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQ 172

Query: 162 PPVEK--PPVYKPPAEKPP-VY------KPPVYKPPVYKPP-VEKPPVYKPPVEKPPVYK 311
           PP  +  PPVY PP EKPP VY      KPPVYKPP Y+PP VEKPPVYKPPVEKPP YK
Sbjct: 173 PPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPVYKPPGYEPPPVEKPPVYKPPVEKPPSYK 232

Query: 312 PP 317
           PP
Sbjct: 233 PP 234

 Score =  144 bits (363), Expect = 3e-33
 Identities = 85/129 (65%), Positives = 93/129 (72%), Gaps = 19/129 (14%)
 Frame = +3

Query: 3   VYKPPV-EKPP-VYKPPVEKPP-VYKPPVEK--PPVYKPPVEKPP-VYKPPVEK--PPVY 158
           VY+PP  EKPP VY PP EKPP VY+PP  +  PPVY PP EKPP VY+PP  +  PPVY
Sbjct: 101 VYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVY 160

Query: 159 KPPVEKPP-VYKPPAEK--PPVYKPPVYKPP-VYKPPV-EKPPVYKPP------VEKPPV 305
            PP EKPP VY+PP  +  PPVY PP  KPP VY+PP  EKPPVYKPP      VEKPPV
Sbjct: 161 PPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPVYKPPGYEPPPVEKPPV 220

Query: 306 YKPPVEKPP 332
           YKPPVEKPP
Sbjct: 221 YKPPVEKPP 229

 Score =  137 bits (345), Expect = 4e-31
 Identities = 80/136 (58%), Positives = 92/136 (67%), Gaps = 26/136 (19%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPP--------------VEKPPVYKP 134
           VYKPP+  PPV+ PP EK PPVY PP EK PPVY+PP              V+ PPVY+P
Sbjct: 33  VYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYQPPPHVKPPPVYQP 92

Query: 135 P--VEKPPVYKPPV-EKPP-VYKPPAEK-PPVYKPPVYK--PPVYKPPVEK-PPVYKPPV 290
           P  V+ PPVY+PP  EKPP VY PP EK PPVY+PP ++  PPVY PP EK PPVY+PP 
Sbjct: 93  PPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPP 152

Query: 291 EK--PPVYKPPVEKPP 332
            +  PPVY PP EKPP
Sbjct: 153 HEKPPPVYPPPHEKPP 168

 Score =  135 bits (340), Expect = 1e-30
 Identities = 76/121 (62%), Positives = 88/121 (72%), Gaps = 14/121 (11%)
 Frame = +3

Query: 12  PPVEKPP-VYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK--PPVYKPP--V 170
           PP EKPP VYKPP+  PPV+ PP EK PPVY PP EK PPVY+PP  +  PPVY+PP  V
Sbjct: 25  PPTEKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYQPPPHV 84

Query: 171 EKPPVYKPP--AEKPPVYKPPVY-KPP-VYKPPVEK-PPVYKPPVEK--PPVYKPPVEKP 329
           + PPVY+PP   + PPVY+PP + KPP VY PP EK PPVY+PP  +  PPVY PP EKP
Sbjct: 85  KPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKP 144

Query: 330 P 332
           P
Sbjct: 145 P 145

 Score =  133 bits (335), Expect = 5e-30
 Identities = 75/116 (64%), Positives = 85/116 (73%), Gaps = 13/116 (11%)
 Frame = +3

Query: 24  KPPVYKPPV-EKPPVYK-PPVEK-PPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVY 188
           KPP Y+PP  EKPP Y+ PP EK PPVYKPP+  PPV+ PP EK PPVY PP EK PPVY
Sbjct: 7   KPPTYEPPATEKPPTYEPPPTEKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVY 66

Query: 189 KPPAEK--PPVYKPP--VYKPPVYKPP--VEKPPVYKPPV-EKPP-VYKPPVEKPP 332
           +PP  +  PPVY+PP  V  PPVY+PP  V+ PPVY+PP  EKPP VY PP EKPP
Sbjct: 67  QPPPHEKPPPVYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPP 122

 Score =  133 bits (335), Expect = 5e-30
 Identities = 79/124 (63%), Positives = 90/124 (72%), Gaps = 15/124 (12%)
 Frame = +3

Query: 6   YKPPV-EKPPVYK-PPVEK-PPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPV 170
           Y+PP  EKPP Y+ PP EK PPVYKPP+  PPV+ PP EK PPVY PP EK PPVY+PP 
Sbjct: 11  YEPPATEKPPTYEPPPTEKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPVYQPPP 70

Query: 171 EK--PPVYKPP--AEKPPVYKPP--VYKPPVYKPPV-EKPP-VYKPPVEK-PPVYKPPV- 320
            +  PPVY+PP   + PPVY+PP  V  PPVY+PP  EKPP VY PP EK PPVY+PP  
Sbjct: 71  HEKPPPVYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPPSVYPPPHEKPPPVYQPPPH 130

Query: 321 EKPP 332
           EKPP
Sbjct: 131 EKPP 134

 Score =  125 bits (315), Expect = 1e-27
 Identities = 69/101 (68%), Positives = 74/101 (73%), Gaps = 9/101 (8%)
 Frame = +3

Query: 3   VYKPPVEKPP-VYKPPVEK--PPVYKPPVEKPP-VYKPPVEK--PPVYKPPVEKPP-VYK 161
           VY PP EKPP VY+PP  +  PPVY PP EKPP VY+PP  +  PPVY PP EKPP VY+
Sbjct: 136 VYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQPPPHEKPPPVYPPPHEKPPPVYQ 195

Query: 162 PPV-EKPPVYKPPA-EKPPVYKPPVYKPPVYKPPVEKPPVY 278
           PP  EKPPVYKPP  E PPV KPPVYKPPV KPP  KPP Y
Sbjct: 196 PPPHEKPPVYKPPGYEPPPVEKPPVYKPPVEKPPSYKPPPY 236

 Score =  112 bits (280), Expect = 1e-23
 Identities = 64/106 (60%), Positives = 75/106 (70%), Gaps = 17/106 (16%)
 Frame = +3

Query: 66  YKPPVE------KPPVYK-PPVEK-PPVYKPPVEKPPVYKPPVEK-PPVYKPPAEK-PPV 215
           YKPP        KPP Y+ PP EK PPVYKPP+  PPV+ PP EK PPVY PP EK PPV
Sbjct: 6   YKPPTYEPPATEKPPTYEPPPTEKPPPVYKPPIYPPPVHHPPHEKPPPVYPPPHEKPPPV 65

Query: 216 YKPPVYK--PPVYKPP--VEKPPVYKPP--VEKPPVYKPPV-EKPP 332
           Y+PP ++  PPVY+PP  V+ PPVY+PP  V+ PPVY+PP  EKPP
Sbjct: 66  YQPPPHEKPPPVYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHEKPP 111

[23][TOP]
>UniRef100_Q9FUR5 ENOD2f (Fragment) n=1 Tax=Maackia amurensis RepID=Q9FUR5_9FABA
          Length = 308

 Score =  145 bits (365), Expect = 2e-33
 Identities = 81/125 (64%), Positives = 89/125 (71%), Gaps = 15/125 (12%)
 Frame = +3

Query: 3   VYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPP 167
           +Y PP EKPPV Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP
Sbjct: 129 LYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPP 188

Query: 168 VEKPPV-YKPPAEK-PPVYKPPVYK-PPVYKPPVEKPPV-YKPPVEK------PPVYKPP 317
            EKPP+ Y PP EK PPVY+PP  K PP Y PP EKPP+ Y PP EK      PP+Y PP
Sbjct: 189 HEKPPIEYPPPHEKPPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPP 248

Query: 318 VEKPP 332
            EKPP
Sbjct: 249 YEKPP 253

 Score =  144 bits (362), Expect = 4e-33
 Identities = 80/119 (67%), Positives = 88/119 (73%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP-VYKPPV 170
           Y PP EKPP  + PP EKPP  Y+PP EKPP +Y PP EKPPV Y PP EKPP VY+PP 
Sbjct: 97  YPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPVEYPPPHEKPPPVYQPPY 156

Query: 171 EKPPV-YKPPAEK-PPVYKPPVYK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPP 332
           EKPP+ Y PP EK PPVY+PP  K PPVY PP EKPP+ Y PP EK PPVY+PP EKPP
Sbjct: 157 EKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPP 215

 Score =  142 bits (358), Expect = 1e-32
 Identities = 78/131 (59%), Positives = 89/131 (67%), Gaps = 21/131 (16%)
 Frame = +3

Query: 3   VYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP-VYKPP 167
           VY+PP EKPP+ Y PP EKPP VY+PP EKPP VY PP EKPP+ Y PP EKPP VY+PP
Sbjct: 151 VYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPP 210

Query: 168 VEKPP-VYKPPAEKPPVYKPPVYK-------PPVYKPPVEK-PPVYKPP-------VEKP 299
            EKPP  Y PP EKPP+  PP ++       PP+Y PP EK PP+Y PP        EKP
Sbjct: 211 YEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHEKP 270

Query: 300 PVYKPPVEKPP 332
           P YKPPV +PP
Sbjct: 271 PFYKPPVYEPP 281

 Score =  139 bits (349), Expect = 1e-31
 Identities = 76/119 (63%), Positives = 87/119 (73%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPV 170
           Y+PP EK PP Y+PP EK PP Y+PP EK PP Y PP EK PP + PP EK PP Y+PP 
Sbjct: 64  YQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPY 123

Query: 171 EK-PPVYKPPAEKPPVYKPPVYK--PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPP 332
           EK PP+Y PP EKPPV  PP ++  PPVY+PP EKPP+ Y PP EK PPVY+PP EKPP
Sbjct: 124 EKPPPLYPPPHEKPPVEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPP 182

 Score =  136 bits (343), Expect = 6e-31
 Identities = 77/126 (61%), Positives = 86/126 (68%), Gaps = 16/126 (12%)
 Frame = +3

Query: 3   VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPV-YKPP 167
           VY+PP EKPP VY PP EKPP+ Y PP EKPP VY+PP EKPP  Y PP EKPP+ Y PP
Sbjct: 173 VYQPPYEKPPPVYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPPTYPPPHEKPPIEYPPP 232

Query: 168 VEKPPVYKPPAEKPPVYK--PPVYKPPVY-------KPPVEKPPVYKPP-VEKPP-VYKP 314
            EKPP  KPP   PP Y+  PP+Y PP +       KPP  KPPVY+PP +EKPP V KP
Sbjct: 233 HEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHEKPPFYKPPVYEPPPLEKPPPVEKP 292

Query: 315 PVEKPP 332
           P  KPP
Sbjct: 293 PSYKPP 298

 Score =  128 bits (322), Expect = 2e-28
 Identities = 75/136 (55%), Positives = 84/136 (61%), Gaps = 29/136 (21%)
 Frame = +3

Query: 12  PPVEKPPVYKPP-VEKPP-VYKPP--------------------VEKPPVYKPPVEKPPV 125
           PP EKPP Y+PP +EKPP VY+PP                     E PP Y+PP EKPP 
Sbjct: 14  PPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEPPPEYQPPHEKPPP 73

Query: 126 -YKPPVEKPPV-YKPPVEKPPV-YKPPAEKPPVYKPPVYK--PPVYKPPVEK-PPVYKPP 287
            Y+PP EKPP  Y+PP EKPP  Y PP EKPP   PP Y+  PP Y+PP EK PP+Y PP
Sbjct: 74  EYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPP 133

Query: 288 VEKPPV-YKPPVEKPP 332
            EKPPV Y PP EKPP
Sbjct: 134 HEKPPVEYPPPHEKPP 149

 Score =  112 bits (279), Expect = 2e-23
 Identities = 67/122 (54%), Positives = 78/122 (63%), Gaps = 23/122 (18%)
 Frame = +3

Query: 36  YKPPVE------KPPVYKPP-VEK-PPVYKPP--------VEKPPVYKPP--VEKPPVYK 161
           YKPP+       KPP Y+PP +EK PPVY+PP        V+ PP Y+PP   E PP Y+
Sbjct: 6   YKPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYEPPPEYQ 65

Query: 162 PPVEK-PPVYKPPAEK-PPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK 326
           PP EK PP Y+PP EK PP Y+PP  K PP Y PP EK PP + PP EK PP Y+PP EK
Sbjct: 66  PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEK 125

Query: 327 PP 332
           PP
Sbjct: 126 PP 127

 Score =  102 bits (253), Expect = 2e-20
 Identities = 59/110 (53%), Positives = 65/110 (59%), Gaps = 26/110 (23%)
 Frame = +3

Query: 6   YKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP------VYKPPVEKPPVY 158
           Y PP EKPP VY+PP EKPP  Y PP EKPP+ Y PP EKPP      +Y PP EKPP  
Sbjct: 196 YPPPHEKPPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPL 255

Query: 159 -------------KPPVEKPPVYKPPA--EKPPVYKPPVYKPPVYK--PP 257
                        KPP  KPPVY+PP   + PPV KPP YKPP Y+  PP
Sbjct: 256 YPPPHHHKPPHHEKPPFYKPPVYEPPPLEKPPPVEKPPSYKPPPYRHYPP 305

[24][TOP]
>UniRef100_O49151 Early nodulin (Fragment) n=1 Tax=Maackia amurensis
           RepID=O49151_9FABA
          Length = 447

 Score =  145 bits (365), Expect = 2e-33
 Identities = 78/125 (62%), Positives = 89/125 (71%), Gaps = 15/125 (12%)
 Frame = +3

Query: 3   VYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPV-YKPPVEK-PPVYKPP 167
           VY+PP EKPP+ Y PP EKPP VY+PP EKPP VY PP EKPP+ Y PP EK PPVY+PP
Sbjct: 164 VYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPP 223

Query: 168 VEKPP-VYKPPAEKPPVYKPPVYK-------PPVYKPPVEK-PPVYKPPVEKPPV-YKPP 317
            EKPP  Y PP EKPP+  PP ++       PP Y+PP EK PP+Y PP EKPP+ Y PP
Sbjct: 224 YEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPP 283

Query: 318 VEKPP 332
            EKPP
Sbjct: 284 HEKPP 288

 Score =  144 bits (364), Expect = 2e-33
 Identities = 80/125 (64%), Positives = 89/125 (71%), Gaps = 15/125 (12%)
 Frame = +3

Query: 3   VYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPP 167
           +Y PP EKPP+ Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP
Sbjct: 142 LYPPPHEKPPIEYPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPP 201

Query: 168 VEKPPV-YKPPAEK-PPVYKPPVYK-PPVYKPPVEKPPV-YKPPVEKPPV------YKPP 317
            EKPP+ Y PP EK PPVY+PP  K PP Y PP EKPP+ Y PP EKPP       Y+PP
Sbjct: 202 HEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPEYQPP 261

Query: 318 VEKPP 332
            EKPP
Sbjct: 262 YEKPP 266

 Score =  144 bits (364), Expect = 2e-33
 Identities = 79/118 (66%), Positives = 89/118 (75%), Gaps = 10/118 (8%)
 Frame = +3

Query: 9   KPPVEKPPVY-KPPVEKPPV-YKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP-VYKPPVE 173
           KPP+E PP + KPP EKPP  Y+PP EKPP +Y PP EKPP+ Y PP EKPP VY+PP E
Sbjct: 237 KPPIEYPPPHEKPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPYE 296

Query: 174 KPPV-YKPPAEK-PPVYKPPVYK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPP 332
           KPP+ Y PP EK PPVY+PP  K PPVY PP EKPP+ Y PP EK PPVY+PP EKPP
Sbjct: 297 KPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPP 354

 Score =  143 bits (361), Expect = 5e-33
 Identities = 79/119 (66%), Positives = 88/119 (73%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP-VYKPPV 170
           Y PP EKPP  + PP EKPP  Y+PP EKPP +Y PP EKPP+ Y PP EKPP VY+PP 
Sbjct: 110 YPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEYPPPHEKPPPVYQPPY 169

Query: 171 EKPPV-YKPPAEK-PPVYKPPVYK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPP 332
           EKPP+ Y PP EK PPVY+PP  K PPVY PP EKPP+ Y PP EK PPVY+PP EKPP
Sbjct: 170 EKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPP 228

 Score =  142 bits (358), Expect = 1e-32
 Identities = 78/131 (59%), Positives = 89/131 (67%), Gaps = 21/131 (16%)
 Frame = +3

Query: 3   VYKPPVEKPPV-YKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPV-YKPPVEK-PPVYKPP 167
           VY+PP EKPP+ Y PP EKPP VY+PP EKPP VY PP EKPP+ Y PP EK PPVY+PP
Sbjct: 290 VYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPP 349

Query: 168 VEKPP-VYKPPAEKPPVYKPPVYK-------PPVYKPPVEK-PPVYKPP-------VEKP 299
            EKPP  Y PP EKPP+  PP ++       PP+Y PP EK PP+Y PP        EKP
Sbjct: 350 YEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHEKP 409

Query: 300 PVYKPPVEKPP 332
           P YKPPV +PP
Sbjct: 410 PFYKPPVYEPP 420

 Score =  141 bits (356), Expect = 2e-32
 Identities = 77/117 (65%), Positives = 85/117 (72%), Gaps = 8/117 (6%)
 Frame = +3

Query: 6   YKPPVEK-PPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPV-YKPPV 170
           Y PP EK PPVY+PP EKPP+ Y PP EK PPVY+PP EK PPVY PP EKPP+ Y PP 
Sbjct: 280 YPPPHEKPPPVYQPPYEKPPIEYPPPHEKPPPVYQPPYEKPPPVYPPPHEKPPIEYPPPH 339

Query: 171 EK-PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVY-KPPVEK-PPVYKPPVEKPP 332
           EK PPVY+PP EKP    PP Y PP  KPP+E PP + KPP EK PP+Y PP EKPP
Sbjct: 340 EKLPPVYQPPYEKP----PPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPP 392

 Score =  136 bits (343), Expect = 6e-31
 Identities = 77/126 (61%), Positives = 86/126 (68%), Gaps = 16/126 (12%)
 Frame = +3

Query: 3   VYKPPVEKPP-VYKPPVEKPPV-YKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPV-YKPP 167
           VY+PP EKPP VY PP EKPP+ Y PP EK PPVY+PP EKPP  Y PP EKPP+ Y PP
Sbjct: 312 VYQPPYEKPPPVYPPPHEKPPIEYPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPP 371

Query: 168 VEKPPVYKPPAEKPPVYK--PPVYKPPVY-------KPPVEKPPVYKPP-VEKPP-VYKP 314
            EKPP  KPP   PP Y+  PP+Y PP +       KPP  KPPVY+PP +EKPP V KP
Sbjct: 372 HEKPPYEKPPPLYPPPYEKPPPLYPPPHHHKPPHHEKPPFYKPPVYEPPPLEKPPPVEKP 431

Query: 315 PVEKPP 332
           P  KPP
Sbjct: 432 PSYKPP 437

 Score =  127 bits (319), Expect = 4e-28
 Identities = 71/125 (56%), Positives = 84/125 (67%), Gaps = 18/125 (14%)
 Frame = +3

Query: 12  PPVEKPPVYKPP-VEK-PPVYKPP--------VEKPPVYKPPVE--KPPVYKPPVEK-PP 152
           PP EKPP Y+PP +EK PPVY+PP        V+ PP Y+PP E   PP Y+PP EK PP
Sbjct: 27  PPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQPPHEKPPP 86

Query: 153 VYKPPVEK-PPVYKPPAEKPPVYKPPVYK--PPVYKPPVEK-PPVYKPPVEK-PPVYKPP 317
            Y+PP EK PP Y+PP EKPP   PP ++  PP + PP EK PP Y+PP EK PP+Y PP
Sbjct: 87  EYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPP 146

Query: 318 VEKPP 332
            EKPP
Sbjct: 147 HEKPP 151

 Score =  127 bits (319), Expect = 4e-28
 Identities = 74/128 (57%), Positives = 86/128 (67%), Gaps = 19/128 (14%)
 Frame = +3

Query: 6   YKPP-VEKPP-VYKPP--------VEKPPVYKPPVE--KPPVYKPPVEKPPV-YKPPVEK 146
           Y+PP +EKPP VY+PP        V+ PP Y+PP E   PP Y+PP EKPP  Y+PP EK
Sbjct: 35  YEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQPPHEKPPPEYQPPHEK 94

Query: 147 PPV-YKPPVEKPPV-YKPPAEKPPVYKPPVYK--PPVYKPPVEK-PPVYKPPVEKPPV-Y 308
           PP  Y+PP EKPP  Y PP EKPP   PP Y+  PP Y+PP EK PP+Y PP EKPP+ Y
Sbjct: 95  PPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEKPPPLYPPPHEKPPIEY 154

Query: 309 KPPVEKPP 332
            PP EKPP
Sbjct: 155 PPPHEKPP 162

 Score =  111 bits (278), Expect = 2e-23
 Identities = 67/122 (54%), Positives = 78/122 (63%), Gaps = 23/122 (18%)
 Frame = +3

Query: 36  YKPPVE------KPPVYKPP-VEK-PPVYKPP--------VEKPPVYKPPVE--KPPVYK 161
           YKPP+       KPP Y+PP +EK PPVY+PP        V+ PP Y+PP E   PP Y+
Sbjct: 19  YKPPIYEPPPTEKPPTYEPPEIEKPPPVYQPPPVHYPPPHVKPPPEYEPPPEYQPPPEYQ 78

Query: 162 PPVEK-PPVYKPPAEK-PPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK 326
           PP EK PP Y+PP EK PP Y+PP  K PP Y PP EK PP + PP EK PP Y+PP EK
Sbjct: 79  PPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYPPPHEKPPPEFPPPYEKPPPEYQPPYEK 138

Query: 327 PP 332
           PP
Sbjct: 139 PP 140

 Score =  102 bits (253), Expect = 2e-20
 Identities = 59/110 (53%), Positives = 65/110 (59%), Gaps = 26/110 (23%)
 Frame = +3

Query: 6   YKPPVEK-PPVYKPPVEKPP-VYKPPVEKPPV-YKPPVEKPP------VYKPPVEKPPVY 158
           Y PP EK PPVY+PP EKPP  Y PP EKPP+ Y PP EKPP      +Y PP EKPP  
Sbjct: 335 YPPPHEKLPPVYQPPYEKPPPTYPPPHEKPPIEYPPPHEKPPYEKPPPLYPPPYEKPPPL 394

Query: 159 -------------KPPVEKPPVYKPPA--EKPPVYKPPVYKPPVYK--PP 257
                        KPP  KPPVY+PP   + PPV KPP YKPP Y+  PP
Sbjct: 395 YPPPHHHKPPHHEKPPFYKPPVYEPPPLEKPPPVEKPPSYKPPPYRHYPP 444

[25][TOP]
>UniRef100_Q9LIE8 Similarity to cell wall-plasma membrane linker protein n=1
            Tax=Arabidopsis thaliana RepID=Q9LIE8_ARATH
          Length = 1480

 Score =  144 bits (362), Expect = 4e-33
 Identities = 59/110 (53%), Positives = 72/110 (65%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+E PP
Sbjct: 1176 VATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPP 1235

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V KPP   PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPP
Sbjct: 1236 VAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPP 1285

 Score =  143 bits (360), Expect = 7e-33
 Identities = 60/107 (56%), Positives = 71/107 (66%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV  
Sbjct: 1169 PPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVAT 1228

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             P E PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP
Sbjct: 1229 SPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPP 1275

 Score =  140 bits (354), Expect = 3e-32
 Identities = 59/110 (53%), Positives = 71/110 (64%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP
Sbjct: 1146 IAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPP 1205

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            + KPP   PPV  PP+ KPPV   P+E PPV KPPV  PPV  PP+ KPP
Sbjct: 1206 ITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPP 1255

 Score =  140 bits (354), Expect = 3e-32
 Identities = 58/108 (53%), Positives = 70/108 (64%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+  PPV KPPV 
Sbjct: 1183 KPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVT 1242

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PP   PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP
Sbjct: 1243 TPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPP 1290

 Score =  140 bits (353), Expect = 4e-32
 Identities = 59/110 (53%), Positives = 70/110 (63%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+E PPV KPPV  PP
Sbjct: 1186 VASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPP 1245

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V  PP  KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PP
Sbjct: 1246 VATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPP 1295

 Score =  139 bits (350), Expect = 1e-31
 Identities = 58/107 (54%), Positives = 69/107 (64%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PPV  PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ K
Sbjct: 1139 PPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIK 1198

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP+ KPPV  PPV  PP+ KPPV   P+E PPV KPPV  PP
Sbjct: 1199 PPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPP 1245

 Score =  139 bits (350), Expect = 1e-31
 Identities = 59/110 (53%), Positives = 70/110 (63%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + KPPV  PP+ KPPV  PPV  PP+ KPPV   P+E PPV KPPV  PPV  PP+ KPP
Sbjct: 1196 IIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPP 1255

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP   PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPP
Sbjct: 1256 IVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPP 1305

 Score =  138 bits (348), Expect = 2e-31
 Identities = 58/110 (52%), Positives = 70/110 (63%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPP
Sbjct: 1151 IAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPP 1210

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V  PP   PP+ KPPV   P+  PPV KPPV  PPV  PP+ KPP+  PP
Sbjct: 1211 VATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPP 1260

 Score =  137 bits (346), Expect = 3e-31
 Identities = 57/110 (51%), Positives = 69/110 (62%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + KPP+  PP   PPV  PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPP
Sbjct: 1126 IAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPP 1185

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V  PP   PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+E PP
Sbjct: 1186 VASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPP 1235

 Score =  137 bits (344), Expect = 5e-31
 Identities = 61/110 (55%), Positives = 66/110 (60%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPVEKPPV  PP+ KPP
Sbjct: 965  VATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPP 1024

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
               PP  KPPV   P   PP   PPV  PPV KPPV  PP+ KPPV  PP
Sbjct: 1025 TVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPP 1074

 Score =  136 bits (343), Expect = 6e-31
 Identities = 60/107 (56%), Positives = 65/107 (60%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP   PPV  PP+  PP  KPPV  PP+  PPVEKPPV  PP+ KPP   PP+ KPPV  
Sbjct: 978  PPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVET 1037

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             P   PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP   PP
Sbjct: 1038 SPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPP 1084

 Score =  136 bits (343), Expect = 6e-31
 Identities = 60/107 (56%), Positives = 66/107 (61%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PPV  PP+  PP  KPPV  PP+  PPV KPPV  PP+ KPP   PP+ KPPVE  P   
Sbjct: 983  PPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTAT 1042

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP   PP+  PP
Sbjct: 1043 PPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPP 1089

 Score =  136 bits (343), Expect = 6e-31
 Identities = 58/115 (50%), Positives = 71/115 (61%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-----VYKPP 167
            + KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP     +  PP
Sbjct: 1111 IAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPP 1170

Query: 168  VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            + KPPV  PP  KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPP
Sbjct: 1171 IGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPP 1225

 Score =  136 bits (343), Expect = 6e-31
 Identities = 57/107 (53%), Positives = 69/107 (64%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ K
Sbjct: 1164 PSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAK 1223

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP    P+  PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P
Sbjct: 1224 PPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSP 1270

 Score =  136 bits (342), Expect = 8e-31
 Identities = 59/110 (53%), Positives = 69/110 (62%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPP
Sbjct: 1141 VANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPP 1200

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V  PP  KPPV  PPV  PP+ KPPV   P+  PPV KPPV  PPV  PP
Sbjct: 1201 VATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPP 1250

 Score =  135 bits (341), Expect = 1e-30
 Identities = 59/107 (55%), Positives = 66/107 (61%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPV  PP+ KPPV  PP   PP   PPV KPPVE PP+  PP  KPP+  PP+ KPPV  
Sbjct: 423 PPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVAT 482

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PPA  PP+  P   KPPV  PP+  PPV KPPV  PP   PP+  PP
Sbjct: 483 PPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPP 529

 Score =  135 bits (341), Expect = 1e-30
 Identities = 58/108 (53%), Positives = 66/108 (61%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV 
Sbjct: 747  KPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVA 806

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP
Sbjct: 807  TPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPP 854

 Score =  135 bits (341), Expect = 1e-30
 Identities = 58/110 (52%), Positives = 66/110 (60%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP
Sbjct: 800  IAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPP 859

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP
Sbjct: 860  ITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPP 909

 Score =  135 bits (341), Expect = 1e-30
 Identities = 60/110 (54%), Positives = 66/110 (60%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + KPP   PP   PPV  PP+  PP  KPPV  PP+  PPV KPPV  PP+ KPP   PP
Sbjct: 970  IAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPP 1029

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            + KPP E  P   PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP
Sbjct: 1030 IAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPP 1079

 Score =  135 bits (340), Expect = 1e-30
 Identities = 56/110 (50%), Positives = 68/110 (61%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   P 
Sbjct: 1106 VSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPS 1165

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP  KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPPV  PP
Sbjct: 1166 IATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPPVATPP 1215

 Score =  135 bits (339), Expect = 2e-30
 Identities = 57/107 (53%), Positives = 65/107 (60%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  
Sbjct: 793  PPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVAT 852

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PPA  PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   P
Sbjct: 853  PPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSP 899

 Score =  135 bits (339), Expect = 2e-30
 Identities = 59/110 (53%), Positives = 68/110 (61%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+ KPPV   P+E PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP
Sbjct: 1216 VATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPP 1275

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP  KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP
Sbjct: 1276 IGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPP 1325

 Score =  134 bits (338), Expect = 2e-30
 Identities = 58/110 (52%), Positives = 65/110 (59%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP
Sbjct: 780  IAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPP 839

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP  KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP
Sbjct: 840  ILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPP 889

 Score =  134 bits (338), Expect = 2e-30
 Identities = 58/110 (52%), Positives = 68/110 (61%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+ KPPV  PPV  PP+ KPPV   P+  PPV KPPV  PPV  PP+ KPP+  PP
Sbjct: 1201 VATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPP 1260

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP  K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP
Sbjct: 1261 IATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPP 1310

 Score =  134 bits (338), Expect = 2e-30
 Identities = 58/110 (52%), Positives = 68/110 (61%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + KPPV  PPV  PP+ KPPV   P+E PPV KPPV  PPV  PP+ KPP+  PP+  PP
Sbjct: 1206 ITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPP 1265

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            + K P   PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PP
Sbjct: 1266 IAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPP 1315

 Score =  134 bits (337), Expect = 3e-30
 Identities = 60/113 (53%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPPV  PP+ K P+  PP   PPV  PP+ KPPV  PP   PP   PPV KPPVE PP+ 
Sbjct: 402 KPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIA 461

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPP 332
            PP  KPP+  PP+ KPPV  PP   PP+      KPPV  PP+  PPV KPP
Sbjct: 462 TPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPP 514

 Score =  134 bits (337), Expect = 3e-30
 Identities = 57/108 (52%), Positives = 66/108 (61%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+ 
Sbjct: 617 KPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIA 676

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP
Sbjct: 677 TPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPP 724

 Score =  134 bits (337), Expect = 3e-30
 Identities = 58/110 (52%), Positives = 68/110 (61%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPP
Sbjct: 825  VATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPP 884

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPP
Sbjct: 885  VATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPP 934

 Score =  134 bits (337), Expect = 3e-30
 Identities = 58/108 (53%), Positives = 65/108 (60%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            KPPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP  
Sbjct: 917  KPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTT 976

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PP   PPV  PP+  PP  KPPV  PP+  PPVEKPPV  PP+ KPP
Sbjct: 977  TPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPP 1024

 Score =  134 bits (337), Expect = 3e-30
 Identities = 55/107 (51%), Positives = 67/107 (62%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PPV  PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   
Sbjct: 1104 PPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAM 1163

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P    PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP+ KPP
Sbjct: 1164 PSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPPITKPP 1210

 Score =  134 bits (336), Expect = 4e-30
 Identities = 60/115 (52%), Positives = 68/115 (59%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPP 167
           V KPPVE PP+  PP  KPP+  PP+ KPPV  PP   PP+      KPPV  PP+  PP
Sbjct: 450 VAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPP 509

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP
Sbjct: 510 VAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPP 564

 Score =  134 bits (336), Expect = 4e-30
 Identities = 58/108 (53%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPPV  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV 
Sbjct: 497 KPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVV 556

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP
Sbjct: 557 TPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPP 604

 Score =  134 bits (336), Expect = 4e-30
 Identities = 56/107 (52%), Positives = 64/107 (59%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ K
Sbjct: 743  PPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAK 802

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPP
Sbjct: 803  PPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPP 849

 Score =  134 bits (336), Expect = 4e-30
 Identities = 57/107 (53%), Positives = 66/107 (61%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   
Sbjct: 1234 PPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTAT 1293

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP    P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ KPP
Sbjct: 1294 PPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPP 1340

 Score =  133 bits (335), Expect = 5e-30
 Identities = 57/107 (53%), Positives = 64/107 (59%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   
Sbjct: 753  PPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTA 812

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP
Sbjct: 813  PPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPP 859

 Score =  133 bits (335), Expect = 5e-30
 Identities = 58/107 (54%), Positives = 65/107 (60%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   
Sbjct: 833  PPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTAT 892

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP    PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP
Sbjct: 893  PPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPP 939

 Score =  133 bits (335), Expect = 5e-30
 Identities = 54/110 (49%), Positives = 68/110 (61%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + K P+  PPV  PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP
Sbjct: 1096 IAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPP 1155

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPPV  PP
Sbjct: 1156 IATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPPVATPP 1205

 Score =  133 bits (335), Expect = 5e-30
 Identities = 57/107 (53%), Positives = 67/107 (62%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P+  PPV KPPV  PPV  PP+ K
Sbjct: 1194 PPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVK 1253

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P
Sbjct: 1254 PPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSP 1300

 Score =  133 bits (335), Expect = 5e-30
 Identities = 57/106 (53%), Positives = 66/106 (62%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            P+E PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  P
Sbjct: 1230 PIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATP 1289

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP
Sbjct: 1290 PTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPP 1335

 Score =  133 bits (335), Expect = 5e-30
 Identities = 58/110 (52%), Positives = 67/110 (60%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PP
Sbjct: 1236 VAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPP 1295

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P  KPPV  PP   PPV KPPV  PP   PPV  PP+ KPP  +PP
Sbjct: 1296 VATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPP 1345

 Score =  133 bits (334), Expect = 7e-30
 Identities = 58/110 (52%), Positives = 66/110 (60%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + KPPV  PP   PP   PPV KPPVE PP+  PP  KPP+  PP+ KPPV  PP   PP
Sbjct: 430 IEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPP 489

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +  P   KPPV  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP
Sbjct: 490 ITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPP 539

 Score =  133 bits (334), Expect = 7e-30
 Identities = 57/110 (51%), Positives = 67/110 (60%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPP
Sbjct: 575 VATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPP 634

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPP
Sbjct: 635 VATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPP 684

 Score =  133 bits (334), Expect = 7e-30
 Identities = 57/110 (51%), Positives = 64/110 (58%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PP
Sbjct: 760  VAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPP 819

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V KPP   PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPP
Sbjct: 820  VAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPP 869

 Score =  133 bits (334), Expect = 7e-30
 Identities = 56/107 (52%), Positives = 64/107 (59%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  
Sbjct: 773  PPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIAT 832

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP
Sbjct: 833  PPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPP 879

 Score =  133 bits (334), Expect = 7e-30
 Identities = 58/110 (52%), Positives = 65/110 (59%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP
Sbjct: 795  VATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPP 854

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
               PP   PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPP
Sbjct: 855  AATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPP 904

 Score =  133 bits (334), Expect = 7e-30
 Identities = 57/110 (51%), Positives = 67/110 (60%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPP
Sbjct: 1246 VATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPP 1305

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V  PP   PPV KPPV  PP   PPV  PP+ KPP  +PPV  PPV  PP
Sbjct: 1306 VATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPPVATPPVATPP 1355

 Score =  132 bits (333), Expect = 9e-30
 Identities = 58/110 (52%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP+EKPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP
Sbjct: 425 VATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPP 484

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PP   P   KPPV  PP+  PPV KPPV  PP   PP+  PP+ K P
Sbjct: 485 AATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSP 534

 Score =  132 bits (333), Expect = 9e-30
 Identities = 57/110 (51%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP
Sbjct: 550 IAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPP 609

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP
Sbjct: 610 ITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPP 659

 Score =  132 bits (333), Expect = 9e-30
 Identities = 57/108 (52%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP  
Sbjct: 667 KPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTT 726

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP
Sbjct: 727 IPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPP 774

 Score =  132 bits (333), Expect = 9e-30
 Identities = 57/107 (53%), Positives = 64/107 (59%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  K
Sbjct: 778  PPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAK 837

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPP
Sbjct: 838  PPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPP 884

 Score =  132 bits (333), Expect = 9e-30
 Identities = 57/110 (51%), Positives = 64/110 (58%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP
Sbjct: 785  VATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPP 844

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            + KPP   PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP
Sbjct: 845  ISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPP 894

 Score =  132 bits (333), Expect = 9e-30
 Identities = 57/107 (53%), Positives = 64/107 (59%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  
Sbjct: 813  PPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVAT 872

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPP
Sbjct: 873  PPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPP 919

 Score =  132 bits (333), Expect = 9e-30
 Identities = 58/107 (54%), Positives = 66/107 (61%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  
Sbjct: 818  PPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIAT 877

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP
Sbjct: 878  PPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPP 924

 Score =  132 bits (333), Expect = 9e-30
 Identities = 54/106 (50%), Positives = 66/106 (62%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KP
Sbjct: 1125 PIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKP 1184

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P   PP+  PP+ KPPV  PP+ KPPV  PPV  PP+ KPPV   P
Sbjct: 1185 PVASPPIATPPIIKPPVATPPITKPPVATPPVATPPIAKPPVATSP 1230

 Score =  132 bits (333), Expect = 9e-30
 Identities = 58/110 (52%), Positives = 67/110 (60%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PPV  PP+ KPPV   P+  PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P
Sbjct: 1211 VATPPVATPPIAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSP 1270

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP   PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPP
Sbjct: 1271 IAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPP 1320

 Score =  132 bits (332), Expect = 1e-29
 Identities = 57/107 (53%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   PPV  PP+EKPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K
Sbjct: 418 PPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISK 477

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP   PP+  P   KPPV  PP+  PPV KPPV  PP   PP
Sbjct: 478 PPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPP 524

 Score =  132 bits (332), Expect = 1e-29
 Identities = 57/107 (53%), Positives = 63/107 (58%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PPV KPPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP   PP   PPV  
Sbjct: 928  PPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAM 987

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP  KPPV  PP+  PPVEKPPV  PP+ KPP   PP+ KPP
Sbjct: 988  PPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPP 1034

 Score =  132 bits (331), Expect = 2e-29
 Identities = 56/107 (52%), Positives = 63/107 (58%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   
Sbjct: 758  PPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTAT 817

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP
Sbjct: 818  PPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPP 864

 Score =  132 bits (331), Expect = 2e-29
 Identities = 60/114 (52%), Positives = 67/114 (58%), Gaps = 6/114 (5%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            KPPV  PP+  PPVEKPPV  PP+ KPP   PP+ KPPV   P   PP   PPV  PPV 
Sbjct: 997  KPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVV 1056

Query: 189  KPPAEKPPVYKPPVYKPPVYKPP------VEKPPVYKPPVEKPPVYKPPVEKPP 332
            KPP   PP+ KPPV  PPV  PP      V  PP+  PP+ K P+  PPV  PP
Sbjct: 1057 KPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPP 1110

 Score =  131 bits (330), Expect = 2e-29
 Identities = 56/107 (52%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  P   KPPV  PP+  
Sbjct: 448 PPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAI 507

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPP
Sbjct: 508 PPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPP 554

 Score =  131 bits (330), Expect = 2e-29
 Identities = 57/110 (51%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP
Sbjct: 545 VATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPP 604

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PP   PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPP
Sbjct: 605 AATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPP 654

 Score =  131 bits (330), Expect = 2e-29
 Identities = 57/107 (53%), Positives = 65/107 (60%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  
Sbjct: 568 PPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIAT 627

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP
Sbjct: 628 PPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPP 674

 Score =  131 bits (330), Expect = 2e-29
 Identities = 57/108 (52%), Positives = 65/108 (60%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+ 
Sbjct: 837  KPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIA 896

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              P  KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP   PP
Sbjct: 897  TSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPP 944

 Score =  131 bits (330), Expect = 2e-29
 Identities = 58/106 (54%), Positives = 64/106 (60%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPV KPPV  PP+ KP
Sbjct: 964  PVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKP 1023

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P   PP+ KPPV   P   PP   PPV  PPV KPPV  PP+ KPP
Sbjct: 1024 PTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPP 1069

 Score =  131 bits (330), Expect = 2e-29
 Identities = 60/111 (54%), Positives = 66/111 (59%), Gaps = 1/111 (0%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+  PP  KPPV  PP+  PPVEKPPV  PP+ KPP   PP+ KPPV   P   PP
Sbjct: 985  VAMPPIATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPP 1044

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPP 332
               PP   PPV KPPV  PP+ KPPV  PPV  PP   PP V  PP+  PP
Sbjct: 1045 TATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPP 1095

 Score =  131 bits (330), Expect = 2e-29
 Identities = 58/111 (52%), Positives = 67/111 (60%), Gaps = 1/111 (0%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            +  PPVEKPPV  PP+ KPP   PP+ KPPV   P   PP   PPV  PPV KPPV  PP
Sbjct: 1005 IANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPP 1064

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPP 332
            + KPP   PPV  PP   PP+  PP +  PP+ K P+  PPV  PP+ KPP
Sbjct: 1065 ITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPP 1115

 Score =  131 bits (329), Expect = 3e-29
 Identities = 57/107 (53%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  KPPV  PP+ K P+  PP   PPV  PP+EKPPV  PP   PP   PPV KPPV  
Sbjct: 398 PPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVET 457

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP  KPP+  PP+ KPPV  PP   PP+  P   KPPV  PP
Sbjct: 458 PPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPP 504

 Score =  131 bits (329), Expect = 3e-29
 Identities = 58/110 (52%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + K P+  PP   PPV  PP+ KPPV  PP   PP   PPV KPPVE PP+  PP  KPP
Sbjct: 410 IAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPP 469

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +  PP  KPPV  PP   PP+  P   KPPV  PP+  PPV KPPV  PP
Sbjct: 470 ISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPP 519

 Score =  131 bits (329), Expect = 3e-29
 Identities = 56/107 (52%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  K
Sbjct: 528 PPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAK 587

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPP
Sbjct: 588 PPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPP 634

 Score =  131 bits (329), Expect = 3e-29
 Identities = 56/110 (50%), Positives = 63/110 (57%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP
Sbjct: 535 VATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPP 594

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           + K P   PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP
Sbjct: 595 ISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPP 644

 Score =  131 bits (329), Expect = 3e-29
 Identities = 56/107 (52%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  
Sbjct: 543 PPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVAT 602

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PPA  PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   P
Sbjct: 603 PPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSP 649

 Score =  131 bits (329), Expect = 3e-29
 Identities = 57/110 (51%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PP
Sbjct: 655 VATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPP 714

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP  KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPP
Sbjct: 715 VATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPP 764

 Score =  131 bits (329), Expect = 3e-29
 Identities = 56/107 (52%), Positives = 63/107 (58%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  
Sbjct: 728  PPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVAT 787

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP
Sbjct: 788  PPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPP 834

 Score =  131 bits (329), Expect = 3e-29
 Identities = 56/107 (52%), Positives = 63/107 (58%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   
Sbjct: 733  PPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTAT 792

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP
Sbjct: 793  PPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPPIATPPTAKPP 839

 Score =  131 bits (329), Expect = 3e-29
 Identities = 57/110 (51%), Positives = 63/110 (57%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPP
Sbjct: 765  VVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPP 824

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V  PP   PP  KPP+  PP+ KPPV  PP   PP+  PP  KPPV  PP
Sbjct: 825  VATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPPPAKPPVATPP 874

 Score =  131 bits (329), Expect = 3e-29
 Identities = 53/110 (48%), Positives = 67/110 (60%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            +  PP+ K P+  PPV  PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P
Sbjct: 1091 IVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSP 1150

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            + KPP   PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP+ KPP
Sbjct: 1151 IAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPPIIKPP 1200

 Score =  130 bits (328), Expect = 3e-29
 Identities = 57/110 (51%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP  KPP
Sbjct: 530 IAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPP 589

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +  PP  K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP
Sbjct: 590 ISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPP 639

 Score =  130 bits (328), Expect = 3e-29
 Identities = 56/110 (50%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP
Sbjct: 570 VAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPP 629

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           + KPP   PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PP
Sbjct: 630 IAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPP 679

 Score =  130 bits (328), Expect = 3e-29
 Identities = 57/107 (53%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   
Sbjct: 583 PPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTAT 642

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP    PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP
Sbjct: 643 PPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPP 689

 Score =  130 bits (328), Expect = 3e-29
 Identities = 57/110 (51%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP
Sbjct: 600 VATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPP 659

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +  PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP
Sbjct: 660 IKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPP 709

 Score =  130 bits (328), Expect = 3e-29
 Identities = 56/106 (52%), Positives = 64/106 (60%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  P
Sbjct: 649 PVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTP 708

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP
Sbjct: 709 PTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPP 754

 Score =  130 bits (328), Expect = 3e-29
 Identities = 57/107 (53%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ K
Sbjct: 663 PPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAK 722

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP
Sbjct: 723 PPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPP 769

 Score =  130 bits (328), Expect = 3e-29
 Identities = 56/110 (50%), Positives = 65/110 (59%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  PP
Sbjct: 805  VATPPTTAPPTATPPVAKPPVATPPIATPPTAKPPILTPPISKPPVATPPAATPPITTPP 864

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              KPP   PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP
Sbjct: 865  PAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPP 914

 Score =  130 bits (328), Expect = 3e-29
 Identities = 59/110 (53%), Positives = 63/110 (57%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP    PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPVEKPP
Sbjct: 955  VVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPP 1014

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V  PP  KPP   PP+ KPPV   P   PP   PPV  PPV KPPV  PP
Sbjct: 1015 VATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPP 1064

 Score =  130 bits (328), Expect = 3e-29
 Identities = 56/110 (50%), Positives = 66/110 (60%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + KPPV   P+  PPV KPPV  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP
Sbjct: 1221 IAKPPVATSPIETPPVAKPPVTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPP 1280

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            + KPP   PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PP
Sbjct: 1281 IAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPP 1330

 Score =  130 bits (327), Expect = 5e-29
 Identities = 55/107 (51%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+ + PV  PP    P+  PP  KPPV  PP+ K P+  PP   PPV  PP+EKPPV  
Sbjct: 378 PPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVAT 437

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP
Sbjct: 438 PPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPP 484

 Score =  130 bits (327), Expect = 5e-29
 Identities = 55/107 (51%), Positives = 62/107 (57%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   
Sbjct: 508 PPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTAT 567

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP
Sbjct: 568 PPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPP 614

 Score =  130 bits (327), Expect = 5e-29
 Identities = 56/108 (51%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+ 
Sbjct: 587 KPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIA 646

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             P  KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP   PP
Sbjct: 647 TSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPP 694

 Score =  130 bits (327), Expect = 5e-29
 Identities = 56/107 (52%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  
Sbjct: 628 PPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVAT 687

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PP
Sbjct: 688 PPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPP 734

 Score =  130 bits (327), Expect = 5e-29
 Identities = 56/110 (50%), Positives = 66/110 (60%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PPV  PP+ KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P
Sbjct: 1241 VTTPPVATPPIVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSP 1300

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            + KPP   PP   PPV KPPV  PP   PPV  PP+ KPP  +PPV  PP
Sbjct: 1301 IAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPPVATPP 1350

 Score =  130 bits (327), Expect = 5e-29
 Identities = 57/107 (53%), Positives = 66/107 (61%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  
Sbjct: 1264 PPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVAT 1323

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PPV  PP+ KPP  +PPV  PPV  PP+ K PV  PP+ KPP
Sbjct: 1324 PPTVTPPVATPPIAKPPGARPPVATPPVATPPIAKSPVATPPMTKPP 1370

 Score =  130 bits (327), Expect = 5e-29
 Identities = 57/107 (53%), Positives = 65/107 (60%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ K
Sbjct: 1279 PPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAK 1338

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  +PPV  PPV  PP+ K PV  PP+ KPPV   P+  PP+ K P
Sbjct: 1339 PPGARPPVATPPVATPPIAKSPVATPPMTKPPVASSPIATPPIAKTP 1385

 Score =  130 bits (326), Expect = 6e-29
 Identities = 57/110 (51%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + KPPV  PP   PP+  P   KPPV  PP+  PPV KPPV  PP   PP+  PP+ K P
Sbjct: 475 ISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSP 534

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP
Sbjct: 535 VATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPP 584

 Score =  130 bits (326), Expect = 6e-29
 Identities = 55/110 (50%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP
Sbjct: 555 VVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPP 614

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             KPP   PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP
Sbjct: 615 PAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPP 664

 Score =  130 bits (326), Expect = 6e-29
 Identities = 56/107 (52%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  
Sbjct: 563 PPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVAT 622

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPP
Sbjct: 623 PPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPP 669

 Score =  130 bits (326), Expect = 6e-29
 Identities = 55/107 (51%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  K
Sbjct: 608 PPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAK 667

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PP
Sbjct: 668 PPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPP 714

 Score =  130 bits (326), Expect = 6e-29
 Identities = 57/110 (51%), Positives = 63/110 (57%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP
Sbjct: 715  VATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPP 774

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP  K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPP
Sbjct: 775  IATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPP 824

 Score =  130 bits (326), Expect = 6e-29
 Identities = 55/110 (50%), Positives = 66/110 (60%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + KPP+  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP
Sbjct: 1251 IVKPPIVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPP 1310

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
               PP  KPPV  PP   PPV  PP+ KPP  +PPV  PPV  PP+ K P
Sbjct: 1311 PATPPVAKPPVATPPTVTPPVATPPIAKPPGARPPVATPPVATPPIAKSP 1360

 Score =  129 bits (325), Expect = 8e-29
 Identities = 56/110 (50%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PPV  PP
Sbjct: 650 VAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPP 709

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PP   PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PP
Sbjct: 710 TATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPP 759

 Score =  129 bits (325), Expect = 8e-29
 Identities = 56/110 (50%), Positives = 63/110 (57%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPP
Sbjct: 705  VVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPP 764

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP
Sbjct: 765  VVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPP 814

 Score =  129 bits (325), Expect = 8e-29
 Identities = 57/110 (51%), Positives = 64/110 (58%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V KPPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP   PP   PPV  PP
Sbjct: 930  VAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPP 989

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP  KPPV  PP+  PPV KPPV  PP+ KPP   PP+ KPPVE  P
Sbjct: 990  IATPPTAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSP 1039

 Score =  129 bits (325), Expect = 8e-29
 Identities = 57/107 (53%), Positives = 62/107 (57%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PPV  PP    PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  PP+  PPV K
Sbjct: 953  PPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEK 1012

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP+ KPP   PP+ KPPVE  P   PP   PPV  PPV KPP
Sbjct: 1013 PPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPP 1059

 Score =  129 bits (324), Expect = 1e-28
 Identities = 57/110 (51%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP
Sbjct: 500 VATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPP 559

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PP   PPV KPPV  PP+  PP  KPP+  PP+ K PV  PP   PP
Sbjct: 560 TTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPP 609

 Score =  129 bits (324), Expect = 1e-28
 Identities = 56/110 (50%), Positives = 63/110 (57%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PP
Sbjct: 510 VAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPP 569

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPP   PP+  PP  KPP+  PP+ K PV  PP   PP+  PP  KPP
Sbjct: 570 VAKPPVATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPP 619

 Score =  129 bits (324), Expect = 1e-28
 Identities = 55/107 (51%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  
Sbjct: 523 PPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIAT 582

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP+  PP
Sbjct: 583 PPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPPIATPP 629

 Score =  129 bits (324), Expect = 1e-28
 Identities = 56/110 (50%), Positives = 64/110 (58%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP
Sbjct: 680  VAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPP 739

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP
Sbjct: 740  IATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPP 789

 Score =  129 bits (324), Expect = 1e-28
 Identities = 56/110 (50%), Positives = 63/110 (57%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP
Sbjct: 720  IAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPP 779

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            + K P   PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP
Sbjct: 780  IAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPPVAKPPVATPP 829

 Score =  129 bits (324), Expect = 1e-28
 Identities = 56/107 (52%), Positives = 63/107 (58%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP++ PP  KPPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP    PV  
Sbjct: 908  PPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVAT 967

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  KPP   PP   PPV  PP+  PP  KPPV  PP+  PPVEKPP
Sbjct: 968  PPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVATPPIANPPVEKPP 1014

 Score =  129 bits (324), Expect = 1e-28
 Identities = 56/108 (51%), Positives = 66/108 (61%), Gaps = 1/108 (0%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            PPV KPPV  PP+ KPPV  PPV  PP   PP V  PP+  PP+ K P+  PPV  PP+ 
Sbjct: 1053 PPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIA 1112

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            KPP   PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP
Sbjct: 1113 KPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPP 1160

 Score =  129 bits (323), Expect = 1e-28
 Identities = 56/110 (50%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPP
Sbjct: 595 ISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPP 654

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP + PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  PP
Sbjct: 655 VATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIATPP 704

 Score =  129 bits (323), Expect = 1e-28
 Identities = 57/107 (53%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  
Sbjct: 613 PPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAI 672

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP
Sbjct: 673 PPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPP 719

 Score =  129 bits (323), Expect = 1e-28
 Identities = 56/110 (50%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PP
Sbjct: 620 VATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPP 679

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPP   PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP
Sbjct: 680 VAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPP 729

 Score =  129 bits (323), Expect = 1e-28
 Identities = 55/107 (51%), Positives = 62/107 (57%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  
Sbjct: 678 PPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAM 737

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP  KPP+  PP+  PPV KPPV  PP   PP+  PP+ K P
Sbjct: 738 PPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSP 784

 Score =  129 bits (323), Expect = 1e-28
 Identities = 54/107 (50%), Positives = 62/107 (57%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  
Sbjct: 698  PPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAI 757

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ KPP
Sbjct: 758  PPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPP 804

 Score =  129 bits (323), Expect = 1e-28
 Identities = 53/110 (48%), Positives = 66/110 (60%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+  PP+ K P+  PPV  PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP
Sbjct: 1086 VTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPP 1145

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            + K P  KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP+  PP
Sbjct: 1146 IAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPPIATPP 1195

 Score =  128 bits (322), Expect = 2e-28
 Identities = 51/110 (46%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP+  PP   PP+  PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  PP
Sbjct: 202 VASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPP 261

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +  PP   PPV  PP+  PP+ KPPV  PP   PP+ KPP+  PP+  PP
Sbjct: 262 IIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPP 311

 Score =  128 bits (322), Expect = 2e-28
 Identities = 54/106 (50%), Positives = 63/106 (59%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P++ PP  KPPV  PP+ K P+  PP   PPV  PP+ KPPV  PP   PP   PPV KP
Sbjct: 394 PIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKP 453

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E PP+  PP  KPP+  PP+ KPPV  PP   PP+  P   KPP
Sbjct: 454 PVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPP 499

 Score =  128 bits (322), Expect = 2e-28
 Identities = 58/112 (51%), Positives = 64/112 (57%), Gaps = 5/112 (4%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           PP  KPP+  PP+ KPPV  PP   PP+      KPPV  PP+  PPV KPPV  PP   
Sbjct: 463 PPTAKPPISTPPISKPPVATPPAATPPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTAT 522

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP+  PP  K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPP
Sbjct: 523 PPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPP 574

 Score =  128 bits (322), Expect = 2e-28
 Identities = 56/107 (52%), Positives = 62/107 (57%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+  P   KPPV  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  
Sbjct: 488 PPITTPTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVAT 547

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  KPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP
Sbjct: 548 PPIAKPPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPP 594

 Score =  128 bits (322), Expect = 2e-28
 Identities = 55/107 (51%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+ K PV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV K
Sbjct: 593 PPISKSPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAK 652

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+  PP
Sbjct: 653 PPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPP 699

 Score =  128 bits (322), Expect = 2e-28
 Identities = 57/110 (51%), Positives = 63/110 (57%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP
Sbjct: 630 IAKPPVATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPP 689

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PP   PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP
Sbjct: 690 TATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPP 739

 Score =  128 bits (322), Expect = 2e-28
 Identities = 56/108 (51%), Positives = 66/108 (61%), Gaps = 1/108 (0%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVY 188
            PPV  PPV KPPV  PP+ KPPV  PPV  PP   PP+  PP +  PP+ K P+  PPV 
Sbjct: 1048 PPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVS 1107

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PP  KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P+ KPP
Sbjct: 1108 TPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPP 1155

 Score =  128 bits (322), Expect = 2e-28
 Identities = 55/110 (50%), Positives = 65/110 (59%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            +  PP+  PP+ K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PP
Sbjct: 1256 IVTPPIATPPIAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPP 1315

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V KPP   PP   PPV  PP+ KPP  +PPV  PPV  PP+ K PV  PP
Sbjct: 1316 VAKPPVATPPTVTPPVATPPIAKPPGARPPVATPPVATPPIAKSPVATPP 1365

 Score =  128 bits (321), Expect = 2e-28
 Identities = 51/107 (47%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPV  PP+  PP + PP+  PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  
Sbjct: 200 PPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIAN 259

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP+  PPV  PP+  PP+ KPPV  PP   PP+ KPP+  PP
Sbjct: 260 PPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPP 306

 Score =  128 bits (321), Expect = 2e-28
 Identities = 53/108 (49%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           K P+  PP+ + PV  PP    P++ PP  KPPV  PP+ K P+  PP   PPV  PP+ 
Sbjct: 372 KSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIE 431

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP   PP   PP   PPV KPPVE PP+  PP  KPP+  PP+ KPP
Sbjct: 432 KPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPP 479

 Score =  128 bits (321), Expect = 2e-28
 Identities = 56/110 (50%), Positives = 62/110 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PPV KPP
Sbjct: 515 VVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVVTPPTTTPPTATPPVAKPP 574

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP   PP  KPP+  PP+ K PV  PP   PP+  PP  KPPV  PP
Sbjct: 575 VATPPIATPPTAKPPISTPPISKSPVATPPAATPPITTPPPAKPPVATPP 624

 Score =  128 bits (321), Expect = 2e-28
 Identities = 54/107 (50%), Positives = 62/107 (57%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+  PPV KPPV  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   
Sbjct: 673 PPIATPPVAKPPVATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTAT 732

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP+  PP  KPP+  PP+  PPV KPPV  PP   PP+  PP
Sbjct: 733 PPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPP 779

 Score =  128 bits (321), Expect = 2e-28
 Identities = 55/110 (50%), Positives = 64/110 (58%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            +  PP+ KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   P
Sbjct: 840  ILTPPISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSP 899

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V KPP   PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+   P
Sbjct: 900  VAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSP 949

 Score =  128 bits (321), Expect = 2e-28
 Identities = 56/110 (50%), Positives = 65/110 (59%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + KPPV  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPP
Sbjct: 845  ISKPPVATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPP 904

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V  PP + PP  KPPV  PP+  PPV KPPV  PP   PP+   P+  PP
Sbjct: 905  VAIPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPP 954

 Score =  127 bits (320), Expect = 3e-28
 Identities = 55/107 (51%), Positives = 62/107 (57%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV K
Sbjct: 703  PPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAK 762

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP   PP+  PP+ K PV  PP   PPV  PP+ KPPV  PP
Sbjct: 763  PPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPP 809

 Score =  127 bits (319), Expect = 4e-28
 Identities = 54/110 (49%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + + PV  PP    P++ PP  KPPV  PP+ K P+  PP   PPV  PP+ KPPV  PP
Sbjct: 380 ISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPP 439

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP
Sbjct: 440 TTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPP 489

 Score =  127 bits (319), Expect = 4e-28
 Identities = 55/107 (51%), Positives = 62/107 (57%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+   PV KPPV  PP+  PP  KPPV  PP+  PPV KPPV  PP   PP+  PP+  
Sbjct: 643 PPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATPPIAT 702

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP
Sbjct: 703 PPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPP 749

 Score =  127 bits (319), Expect = 4e-28
 Identities = 55/108 (50%), Positives = 64/108 (59%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+ 
Sbjct: 867  KPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIA 926

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PP  KPPV  PP   PP+   P+  PPV  PP    PV  PP+ KPP
Sbjct: 927  TPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPP 974

 Score =  127 bits (319), Expect = 4e-28
 Identities = 56/110 (50%), Positives = 65/110 (59%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + K P+  PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP
Sbjct: 1266 IAKSPIAPPPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPP 1325

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
               PP   PP+ KPP  +PPV  PPV  PP+ K PV  PP+ KPPV   P
Sbjct: 1326 TVTPPVATPPIAKPPGARPPVATPPVATPPIAKSPVATPPMTKPPVASSP 1375

 Score =  127 bits (319), Expect = 4e-28
 Identities = 57/107 (53%), Positives = 64/107 (59%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+  PP+ KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  
Sbjct: 1274 PPIGTPPIAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVAT 1333

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  KPP  +PPV  PPV  PP+ K PV  PP+ KPPV   P+  PP
Sbjct: 1334 PPIAKPPGARPPVATPPVATPPIAKSPVATPPMTKPPVASSPIATPP 1380

 Score =  127 bits (318), Expect = 5e-28
 Identities = 50/107 (46%), Positives = 62/107 (57%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+  PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV  
Sbjct: 215 PPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAA 274

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP+ KPPV  PP   PP+ KPP+  PP+  PP   PP   PP
Sbjct: 275 PPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPP 321

 Score =  127 bits (318), Expect = 5e-28
 Identities = 54/109 (49%), Positives = 62/109 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP    P+  PP  KPPV  PP+ K P+  PP   PPV  PP+EKPPV  PP   PP
Sbjct: 385 VATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPP 444

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
              PP  KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  P
Sbjct: 445 TATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTP 493

 Score =  127 bits (318), Expect = 5e-28
 Identities = 55/110 (50%), Positives = 62/110 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ KPPV  PP   PP+  P 
Sbjct: 435 VATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPPISKPPVATPPAATPPITTPT 494

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             KPP   PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PP
Sbjct: 495 PVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPP 544

 Score =  127 bits (318), Expect = 5e-28
 Identities = 56/110 (50%), Positives = 63/110 (57%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  PP   PP
Sbjct: 635 VATPPTATPPIATSPVAKPPVATPPIKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPP 694

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +  PP   PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP
Sbjct: 695 IATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPP 744

 Score =  127 bits (318), Expect = 5e-28
 Identities = 56/110 (50%), Positives = 64/110 (58%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP   PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP
Sbjct: 850  VATPPAATPPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPP 909

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP  KPPV  PP+  PPV KPPV  PP   PP+   P+  PPV  PP
Sbjct: 910  IKTPPPAKPPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPP 959

 Score =  127 bits (318), Expect = 5e-28
 Identities = 56/110 (50%), Positives = 65/110 (59%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            + KPPV  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ KPP
Sbjct: 1281 IAKPPVATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPP 1340

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              +PP   PPV  PP+ K PV  PP+ KPPV   P+  PP+ K P+  PP
Sbjct: 1341 GARPPVATPPVATPPIAKSPVATPPMTKPPVASSPIATPPIAKTPIATPP 1390

 Score =  126 bits (317), Expect = 7e-28
 Identities = 49/107 (45%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP + PP+  PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  
Sbjct: 210 PPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIAT 269

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP+  PP+ KPPV  PP   PP+ KPP+  PP+  PP   PP
Sbjct: 270 PPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPP 316

 Score =  126 bits (317), Expect = 7e-28
 Identities = 55/107 (51%), Positives = 61/107 (57%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  PP+  PPV KPPV  PP   
Sbjct: 713  PPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIATPPIAIPPVAKPPVVTPPTAT 772

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP+ K PV  PP   PPV  PP+ KPPV  PP   PP   PP
Sbjct: 773  PPIATPPIAKSPVATPPTATPPVATPPIAKPPVATPPTTAPPTATPP 819

 Score =  126 bits (316), Expect = 9e-28
 Identities = 54/116 (46%), Positives = 67/116 (57%), Gaps = 6/116 (5%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPP------VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 164
            + KPPV  PPV  PP      V  PP+  PP+ K P+  PPV  PP+ KPP+  PPV   
Sbjct: 1065 ITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATT 1124

Query: 165  PVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P+ KPP+  PP   PPV  PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP
Sbjct: 1125 PIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPP 1180

 Score =  126 bits (316), Expect = 9e-28
 Identities = 52/107 (48%), Positives = 64/107 (59%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            P V  PP+  PP+ K P+  PPV  PP+ KPP+  PPV   P+ KPP+  PP   PPV  
Sbjct: 1084 PIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVAN 1143

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPPV  PP
Sbjct: 1144 PPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPPVASPP 1190

 Score =  125 bits (315), Expect = 1e-27
 Identities = 54/107 (50%), Positives = 61/107 (57%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP  KPP+  
Sbjct: 693  PPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPPTAKPPIAT 752

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP
Sbjct: 753  PPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPP 799

 Score =  125 bits (315), Expect = 1e-27
 Identities = 61/126 (48%), Positives = 70/126 (55%), Gaps = 16/126 (12%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEK---------------PPVYKPPVEKPPVYKPP 137
            V KPPV  PP+ KPP   PP+ KPPVE                PPV KPPV  PP+ KPP
Sbjct: 1010 VEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPP 1069

Query: 138  VEKPPVYKPPVEKPP-VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
            V  PPV  PP   PP V  PP   PP+ K P+  PPV  PP+ KPP+  PPV   P+ KP
Sbjct: 1070 VATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKP 1129

Query: 315  PVEKPP 332
            P+  PP
Sbjct: 1130 PIATPP 1135

 Score =  125 bits (315), Expect = 1e-27
 Identities = 57/111 (51%), Positives = 65/111 (58%), Gaps = 1/111 (0%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKP 179
            + KPPVE  P   PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP   PP V  P
Sbjct: 1030 IAKPPVETSPTATPPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPP 1089

Query: 180  PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P+  PP  K P+  PPV  PP+ KPP+  PPV   P+ KPP+  PP   PP
Sbjct: 1090 PIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPP 1140

 Score =  125 bits (314), Expect = 1e-27
 Identities = 55/107 (51%), Positives = 62/107 (57%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           P   KPPV  PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PPV  PP+ K
Sbjct: 493 PTPVKPPVATPPLAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPPVATPPIAK 552

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP   PP   PPV KPPV  PP+  PP  KPP+  PP+ K P
Sbjct: 553 PPVVTPPTTTPPTATPPVAKPPVATPPIATPPTAKPPISTPPISKSP 599

 Score =  125 bits (314), Expect = 1e-27
 Identities = 54/110 (49%), Positives = 61/110 (55%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP   PP+  PP+  PPV  PP   PPV  PP+ KPP   PP   PPV  PP+  PP
Sbjct: 685  VATPPTATPPIATPPIATPPVVTPPTATPPVATPPIAKPPTTIPPTATPPVAMPPIATPP 744

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              KPP   PP+  PPV KPPV  PP   PP+  PP+ K PV  PP   PP
Sbjct: 745  TAKPPIATPPIAIPPVAKPPVVTPPTATPPIATPPIAKSPVATPPTATPP 794

 Score =  125 bits (314), Expect = 1e-27
 Identities = 55/108 (50%), Positives = 64/108 (59%), Gaps = 1/108 (0%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVY 188
            PP   PPV  PPV KPPV  PP+ KPPV  PPV  PP   PP V  PP+  PP+ K P+ 
Sbjct: 1043 PPTATPPVAIPPVVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIA 1102

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PP   PP+ KPP+  PPV   P+ KPP+  PP   PPV  PP+ K P
Sbjct: 1103 TPPVSTPPIAKPPIATPPVATTPIAKPPIATPPTANPPVANPPIAKSP 1150

 Score =  125 bits (313), Expect = 2e-27
 Identities = 53/110 (48%), Positives = 63/110 (57%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP+  PP  K P+  PP+ + PV  PP    P++ PP  KPPV  PP+ K P+  PP
Sbjct: 360 VATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPP 419

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PP   PP+ KPPV  PP   PP   PPV KPPVE PP+  PP  KPP
Sbjct: 420 TATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPP 469

 Score =  125 bits (313), Expect = 2e-27
 Identities = 55/116 (47%), Positives = 66/116 (56%), Gaps = 6/116 (5%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPP------VEKPPVYKPPVEKPPVYKPPVEKPPVYKP 164
            V KPPV  PP+ KPPV  PPV  PP      V  PP+  PP+ K P+  PPV  PP+ KP
Sbjct: 1055 VVKPPVAIPPITKPPVATPPVTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKP 1114

Query: 165  PVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P+  PPV   P  KPP+  PP   PPV  PP+ K P+ KPP+  PP   P +  PP
Sbjct: 1115 PIATPPVATTPIAKPPIATPPTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPP 1170

 Score =  124 bits (312), Expect = 3e-27
 Identities = 52/111 (46%), Positives = 64/111 (57%), Gaps = 2/111 (1%)
 Frame = +3

Query: 6   YKPP--VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           +KPP     PPV  PP+  PP   PP+  PP+ K PV  PP+  PP   PP+  PPV  P
Sbjct: 191 HKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATP 250

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P+  PP   PP+  PP+  PPV  PP+  PP+ KPPV  PP   PP+ KPP
Sbjct: 251 PITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPP 301

 Score =  124 bits (312), Expect = 3e-27
 Identities = 53/107 (49%), Positives = 61/107 (57%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  K P+  PP+ + PV  PP    P+  PP  KPPV  PP+ K P+  PP   PPV  
Sbjct: 368 PPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIATPPTATPPVAT 427

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP EKPPV  PP   PP   PPV KPPV  PP+  PP  KPP+  PP
Sbjct: 428 PPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPPTAKPPISTPP 474

 Score =  124 bits (311), Expect = 3e-27
 Identities = 54/107 (50%), Positives = 62/107 (57%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  KPPV  PP+  PPV KPPV  
Sbjct: 878  PPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPPVAKPPVAT 937

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP+   P+  PPV  PP    PV  PP+ KPP   PP   PP
Sbjct: 938  PPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPP 984

 Score =  124 bits (310), Expect = 4e-27
 Identities = 54/107 (50%), Positives = 60/107 (56%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+   P+  PPV  PP    PV  PP+ KPP   PP   PPV  PP+  PP  KPPV  
Sbjct: 943  PPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPPTAKPPVAT 1002

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PPV KPPV  PP+ KPP   PP+ KPPVE  P   PP   PP
Sbjct: 1003 PPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPPTATPP 1049

 Score =  123 bits (309), Expect = 6e-27
 Identities = 49/110 (44%), Positives = 62/110 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV  PP+  PP
Sbjct: 222 IAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPP 281

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           + KPP   PP   PP+ KPP+  PP+  PP   PP   PP+   P  KPP
Sbjct: 282 ISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPP 331

 Score =  123 bits (309), Expect = 6e-27
 Identities = 53/110 (48%), Positives = 60/110 (54%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP   PP+   P+  PPV  PP    PV  PP+ KPP   PP   PPV  PP+  PP
Sbjct: 935  VATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPPTATPPVAMPPIATPP 994

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              KPP   PP+  PPV KPPV  PP+ KPP   PP+ KPPV   P   PP
Sbjct: 995  TAKPPVATPPIANPPVEKPPVATPPIAKPPTVLPPIAKPPVETSPTATPP 1044

 Score =  123 bits (308), Expect = 7e-27
 Identities = 53/110 (48%), Positives = 62/110 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + +PPV  PP   PPV  PP+  PP  K P+  PP+ + PV  PP    P+  PP  KPP
Sbjct: 345 IAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPP 404

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP  K P+  PP   PPV  PP+EKPPV  PP   PP   PPV KPP
Sbjct: 405 VATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPP 454

 Score =  123 bits (308), Expect = 7e-27
 Identities = 54/110 (49%), Positives = 62/110 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP   PPV  PP+  PP  K P+  PP+ + PV  PP    P++ PP  KPPV  PP
Sbjct: 350 VATPPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPP 409

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           + K P   PP   PPV  PP+ KPPV  PP   PP   PPV KPPVE PP
Sbjct: 410 IAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPP 459

 Score =  123 bits (308), Expect = 7e-27
 Identities = 53/107 (49%), Positives = 62/107 (57%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP+  PP  KPPV  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP++ PP  K
Sbjct: 858  PPITTPPPAKPPVATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAK 917

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP+  PPV KPPV  PP   PP+   P+  PPV  PP    P
Sbjct: 918  PPVAIPPIATPPVAKPPVATPPTATPPIATSPIATPPVVTPPTATSP 964

 Score =  123 bits (308), Expect = 7e-27
 Identities = 51/111 (45%), Positives = 65/111 (58%), Gaps = 1/111 (0%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
            V  PP   PP+  PP +  PP+ K P+  PPV  PP+ KPP+  PPV   P+ KPP+  P
Sbjct: 1075 VTNPPTAMPPIVTPPPIVTPPIAKSPIATPPVSTPPIAKPPIATPPVATTPIAKPPIATP 1134

Query: 180  PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P   PP   PP+ K P+ KPP+  PP   P +  PP+ KPPV  PP+ KPP
Sbjct: 1135 PTANPPVANPPIAKSPIAKPPIATPPTAMPSIATPPIGKPPVATPPMAKPP 1185

 Score =  122 bits (307), Expect = 1e-26
 Identities = 52/107 (48%), Positives = 61/107 (57%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPV  PP+  PP  K P+  PP+ + PV  PP    P+  PP  KPPV  PP+ K P+  
Sbjct: 358 PPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKPPVATPPIAKSPIAT 417

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PPV  PP+ KPPV  PP   PP   PPV KPPV  PP+  PP
Sbjct: 418 PPTATPPVATPPIEKPPVATPPTTTPPTATPPVAKPPVETPPIATPP 464

 Score =  122 bits (307), Expect = 1e-26
 Identities = 54/110 (49%), Positives = 62/110 (56%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP+  PP+ KPPV  PP   PP+   PV KPPV  PP+  PP  KPPV  PP+  PP
Sbjct: 870  VATPPIATPPIAKPPVATPPTATPPIATSPVAKPPVAIPPIKTPPPAKPPVAIPPIATPP 929

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V KPP   PP   PP+   P+  PPV  PP    PV  PP+ KPP   PP
Sbjct: 930  VAKPPVATPPTATPPIATSPIATPPVVTPPTATSPVATPPIAKPPTTTPP 979

 Score =  122 bits (305), Expect = 2e-26
 Identities = 49/107 (45%), Positives = 61/107 (57%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV  PP+  
Sbjct: 220 PPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITN 279

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  KPPV  PP   PP+ KPP+  PP+  PP   PP   PP+   P
Sbjct: 280 PPISKPPVTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLP 326

 Score =  121 bits (304), Expect = 2e-26
 Identities = 54/109 (49%), Positives = 62/109 (56%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V  PP   PPV   P+ KPPV  PP   PPV KPPV  PP   PPV  PP+ KPP  +PP
Sbjct: 1286 VATPPTATPPVATSPIAKPPVATPPPATPPVAKPPVATPPTVTPPVATPPIAKPPGARPP 1345

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            V  PP   PP+ K PV  PP+ KPPV   P+  PP+ K P+  PP   P
Sbjct: 1346 VATPPVATPPIAKSPVATPPMTKPPVASSPIATPPIAKTPIATPPTTMP 1394

 Score =  121 bits (303), Expect = 3e-26
 Identities = 50/110 (45%), Positives = 62/110 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV  PP+  PP+ KPP
Sbjct: 227 VATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPP 286

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP   PP+ KPP+  PP+  PP   PP   PP+   P  KPPV   P
Sbjct: 287 VTTPPTTTPPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPPVAISP 336

 Score =  119 bits (299), Expect = 8e-26
 Identities = 49/107 (45%), Positives = 60/107 (56%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV  PP+  PP+ KPPV  PP   
Sbjct: 235 PPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTT 294

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  KPP+  PP+  PP   PP   PP+   P  KPPV   P+  PP
Sbjct: 295 PPIAKPPIATPPISTPPAATPPAATPPITTLPPAKPPVAISPIVTPP 341

 Score =  119 bits (299), Expect = 8e-26
 Identities = 52/113 (46%), Positives = 64/113 (56%), Gaps = 3/113 (2%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP+  PP+  PP+  PP+  PPV  PP+  PP+ KPPV  PP   PP+ KPP+  PP
Sbjct: 247 VATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAKPPIATPP 306

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPV---EKPPVYKPPVEKPP 332
           +  PPA  PP   PP+   P  KPPV   P+  PPV    +PPV  PP   PP
Sbjct: 307 ISTPPAATPPAATPPITTLPPAKPPVAISPIVTPPVTPIAQPPVATPPTATPP 359

 Score =  116 bits (291), Expect = 7e-25
 Identities = 48/103 (46%), Positives = 59/103 (57%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+  PPV  PP+  PP+  PP+  PP+  PPV  PP+  PP+ KPPV  PP   PP+ K
Sbjct: 240 PPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPPITNPPISKPPVTTPPTTTPPIAK 299

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 320
           PP   PP+  PP   PP   PP+   P  KPPV   P+  PPV
Sbjct: 300 PPIATPPISTPPAATPPAATPPITTLPPAKPPVAISPIVTPPV 342

 Score =  115 bits (289), Expect = 1e-24
 Identities = 48/106 (45%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P+ +PPV  PP   PPV  PP+  PP  K P+  PP+ + PV  PP    P++ PP  KP
Sbjct: 344 PIAQPPVATPPTATPPVATPPIATPPTSKSPISTPPISESPVATPPTATSPIKTPPPAKP 403

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P   PP+ K P+  PP   PPV  PP+ KPPV  PP   PP   PP
Sbjct: 404 PVATPPIAKSPIATPPTATPPVATPPIEKPPVATPPTTTPPTATPP 449

 Score =  109 bits (273), Expect = 8e-23
 Identities = 52/114 (45%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
 Frame = +3

Query: 9   KPPVEKPP--VYKPPVEKPP--VYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPV 170
           KPP  KPP    KPP   PP    +PP  KPP     PPV  PP+  PP + PP+  PP+
Sbjct: 163 KPPSVKPPPSTPKPPTTNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPI 222

Query: 171 EKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            K PV  PP   PP   PP+  PPV  PP+  PP+  PP+  PP+  PPV  PP
Sbjct: 223 AKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPPIATPPVAAPP 276

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/119 (45%), Positives = 63/119 (52%), Gaps = 11/119 (9%)
 Frame = +3

Query: 9   KPPVE-----KPPVYKPPVEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP--VEKPPV 155
           KPP +     KPP  KPP  KPP  KPP    KPP   PP    +PP +KPP     PPV
Sbjct: 144 KPPTKHHPHPKPPTIKPP-PKPPSVKPPPSTPKPPTTNPPPSTPQPPTHKPPPCTPTPPV 202

Query: 156 YKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PP+  PP   PP   PP+ K PV  PP+  PP   PP+  PPV  PP+  PP+  PP
Sbjct: 203 ASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPP 261

 Score =  106 bits (264), Expect = 9e-22
 Identities = 51/113 (45%), Positives = 61/113 (53%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPP-VYKPPVEKPP--VYKPPVEKPP--VYKPPVEKPPVYKPPVE 173
           KPP  KPP   P V+ PP   KPP   PP    +PP  KPP     PPV  PP+  PP +
Sbjct: 154 KPPTIKPPPKPPSVKPPPSTPKPPTTNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQ 213

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP+  PP  K PV  PP+  PP   PP+  PPV  PP+  PP+  PP+  PP
Sbjct: 214 MPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPITTPPIANPPIIMPP 266

 Score =  103 bits (256), Expect = 8e-21
 Identities = 54/124 (43%), Positives = 65/124 (52%), Gaps = 16/124 (12%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPP--VEKPPVYKPP--VEKPPVYK 161
           KPP +  P  KPP +     KPP  KPP  KPP  KPP    KPP   PP    +PP +K
Sbjct: 134 KPPTKPHPHPKPPTKHHPHPKPPTIKPP-PKPPSVKPPPSTPKPPTTNPPPSTPQPPTHK 192

Query: 162 -------PPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 320
                  PPV  PP+  PP + PP+  PP+ K PV  PP+  PP   PP+  PPV  PP+
Sbjct: 193 PPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPPITIPPVATPPI 252

Query: 321 EKPP 332
             PP
Sbjct: 253 TTPP 256

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 51/112 (45%), Positives = 57/112 (50%), Gaps = 6/112 (5%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP--VEKPPVYKPP--VEKPP 182
           P  KPP    P  KPP    P  KPP  KPP  KPP  KPP    KPP   PP    +PP
Sbjct: 131 PHPKPPTKPHPHPKPPTKHHPHPKPPTIKPP-PKPPSVKPPPSTPKPPTTNPPPSTPQPP 189

Query: 183 VYKPP--AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +KPP     PPV  PP+  PP   PP+  PP+ K PV  PP+  PP   PP
Sbjct: 190 THKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPPTATPP 241

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/115 (46%), Positives = 62/115 (53%), Gaps = 7/115 (6%)
 Frame = +3

Query: 9   KPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKP 179
           KPP  KP P  KPP +  P  KPP +  P  KPP  KPP  KPP  KPP    KPP   P
Sbjct: 123 KPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPPP-KPPSVKPPPSTPKPPTTNP 181

Query: 180 P--VYKPPAEKPP--VYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P    +PP  KPP     PPV  PP+  PP + PP+  PP+ K PV  PP+  PP
Sbjct: 182 PPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAKSPVATPPIATPP 236

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 55/122 (45%), Positives = 64/122 (52%), Gaps = 14/122 (11%)
 Frame = +3

Query: 9   KPPVEKPPVY-------KPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 164
           KPP  KPP +       KPP  KP P  KPP +  P  KPP +  P  KPP  KPP  KP
Sbjct: 106 KPPTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPPP-KP 164

Query: 165 PVEKPP--VYKPPAEKPP--VYKPPVYKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           P  KPP    KPP   PP    +PP +KPP     PPV  PP+  PP + PP+  PP+ K
Sbjct: 165 PSVKPPPSTPKPPTTNPPPSTPQPPTHKPPPCTPTPPVASPPMATPPTQMPPIATPPIAK 224

Query: 327 PP 332
            P
Sbjct: 225 SP 226

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 54/113 (47%), Positives = 58/113 (51%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVY-KP-PVEKPPVYKP-PVEKPPVYKPPVEKP 179
           KPP +  P  KPP +  P  KPP  KPP + KP P  KPP  KP P  KPP    P  KP
Sbjct: 86  KPPTKPHPHPKPPTKPHPHPKPPTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKP 145

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPP 332
           P    P  KPP  KPP  KPP  KPP   P   KPP   PP    +PP  KPP
Sbjct: 146 PTKHHPHPKPPTIKPPP-KPPSVKPPPSTP---KPPTTNPPPSTPQPPTHKPP 194

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/112 (49%), Positives = 58/112 (51%), Gaps = 4/112 (3%)
 Frame = +3

Query: 9   KPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY-KP-PVEKPPVYKP-PVEK 176
           KPP  KP P  KPP +  P  KPP +  P  KPP  KPP + KP P  KPP  KP P  K
Sbjct: 75  KPPTVKPHPHPKPPTKPHPHPKPPTKPHPHPKPPTIKPPPHPKPRPHPKPPNVKPHPHPK 134

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP    P  KPP    P  KPP  KPP  KPP  KPP   P   KPP   PP
Sbjct: 135 PPTKPHPHPKPPTKHHPHPKPPTIKPP-PKPPSVKPPPSTP---KPPTTNPP 182

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 58/124 (46%), Positives = 62/124 (50%), Gaps = 16/124 (12%)
 Frame = +3

Query: 9   KPPVEKP-PVYKPPVEKPPVYK------PPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKP 164
           KPP  KP P  KPP  KPP  K      PP  KP P  KPP +  P  KPP +  P  KP
Sbjct: 48  KPPAVKPHPHPKPPTIKPPPPKRHPHPKPPTVKPHPHPKPPTKPHPHPKPPTKPHPHPKP 107

Query: 165 PVEKPPVY-------KPPAEKP-PVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 320
           P  KPP +       KPP  KP P  KPP    P  KPP +  P  KPP  KPP  KPP 
Sbjct: 108 PTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPPTKHHPHPKPPTIKPPP-KPPS 166

Query: 321 EKPP 332
            KPP
Sbjct: 167 VKPP 170

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 56/118 (47%), Positives = 60/118 (50%), Gaps = 11/118 (9%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVE-----KPPVYKP-PVEKPPVYKPPVEKP-PVYKPPVEKP-PVYKPP 167
           PP   P  +KPP       KPP  KP P  KPP  KPP  K  P  KPP  KP P  KPP
Sbjct: 29  PPKPSPKPHKPPKHSVVPPKPPAVKPHPHPKPPTIKPPPPKRHPHPKPPTVKPHPHPKPP 88

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVY-KP-PVEKPPVYKP-PVEKPPVYKPPVEKPP 332
            +  P  KPP +  P  KPP  KPP + KP P  KPP  KP P  KPP    P  KPP
Sbjct: 89  TKPHPHPKPPTKPHPHPKPPTIKPPPHPKPRPHPKPPNVKPHPHPKPPTKPHPHPKPP 146

[26][TOP]
>UniRef100_Q7M1Z7 Extensin (Fragment) n=1 Tax=Daucus carota RepID=Q7M1Z7_DAUCA
          Length = 154

 Score =  143 bits (360), Expect = 7e-33
 Identities = 71/122 (58%), Positives = 82/122 (67%), Gaps = 14/122 (11%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKP--------PV 155
           ++KPPV  PPV+KPP+ KPPVY PPV KPPVY PPV KPP  YKPPVE          P+
Sbjct: 22  IHKPPVYTPPVHKPPIHKPPVYTPPVHKPPVYTPPVHKPPSEYKPPVEATNSVTEDHYPI 81

Query: 156 YKPPVEKPPVYKP-PAEKPPVYKPPVYKPP----VYKPPVEKPPVYKPPVEKPPVYKPPV 320
           +KPPV KPPV KP P  KPPV+KPP++KPP    VYK     PP++ PP   PPVY PP 
Sbjct: 82  HKPPVYKPPVQKPAPEHKPPVHKPPIHKPPVHTLVYKYKSPPPPMHSPP---PPVYSPPP 138

Query: 321 EK 326
            K
Sbjct: 139 PK 140

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = +3

Query: 207 PPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP++KPPVY PPV+KPP+ KPPVY PPV KPPVY PPV KPP
Sbjct: 20  PPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPPVYTPPVHKPP 61

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 34/48 (70%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +3

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPP 332
           PP  KPPVY PPV+KPP++KPPV  PPV+KPPV  PPV+KPP E KPP
Sbjct: 20  PPIHKPPVYTPPVHKPPIHKPPVYTPPVHKPPVYTPPVHKPPSEYKPP 67

[27][TOP]
>UniRef100_B8CCT2 Predicted protein n=1 Tax=Thalassiosira pseudonana CCMP1335
           RepID=B8CCT2_THAPS
          Length = 937

 Score =  139 bits (350), Expect = 1e-31
 Identities = 62/107 (57%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP++K    KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP  K
Sbjct: 578 PPIQKQTAGKPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAK 637

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PA KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP
Sbjct: 638 LPAAKPPAAKPPAAKPPAAKPPTAKPPTAKPPTAKPPAAKPPTVKPP 684

 Score =  137 bits (344), Expect = 5e-31
 Identities = 62/108 (57%), Positives = 62/108 (57%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP  K P  KPP  
Sbjct: 587 KPPAGKPPAAKPPPAKPPAAKPPTAKPPTAKPPAAKPPPAKPSTAKPPAAKLPAAKPPAA 646

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPPA KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP     P
Sbjct: 647 KPPAAKPPAAKPPTAKPPTAKPPTAKPPAAKPPTVKPPTVKPTAAVKP 694

[28][TOP]
>UniRef100_P08297 Early nodulin-75 n=1 Tax=Glycine max RepID=NO75_SOYBN
          Length = 309

 Score =  137 bits (346), Expect = 3e-31
 Identities = 73/124 (58%), Positives = 87/124 (70%), Gaps = 15/124 (12%)
 Frame = +3

Query: 6   YKPPVEKPPV-YKPPVEKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVE- 173
           Y+PP EKPP  ++PP EKPP ++PP EKPP  Y+PP EKPP  Y+PP EKPP  KPP E 
Sbjct: 170 YQPPHEKPPPEHQPPHEKPPEHQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPHEKPPPEY 229

Query: 174 ------KPPVYKPPAEKPPVYKPPVYK--PPVYKPPVEKPP--VYKPPVEKPPVYK-PPV 320
                  PP ++PP EKPP   PP Y+  PPVY+PP EKPP  VY PP EKPP+Y+ PP+
Sbjct: 230 QPPHEKPPPEHQPPHEKPPPVYPPPYEKPPPVYEPPYEKPPPVVYPPPHEKPPIYEPPPL 289

Query: 321 EKPP 332
           EKPP
Sbjct: 290 EKPP 293

 Score =  135 bits (340), Expect = 1e-30
 Identities = 72/118 (61%), Positives = 84/118 (71%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPVYKPPVE-------KPPVY 158
           ++PP EKPP ++PP EKPP  Y+PP EKPP  Y+PP EKPP  KPP E        PP +
Sbjct: 181 HQPPHEKPPEHQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPHEKPPPEYQPPHEKPPPEH 240

Query: 159 KPPVEKPP-VYKPPAEKPP-VYKPPVYKPP--VYKPPVEKPPVYK-PPVEKPPVYKPP 317
           +PP EKPP VY PP EKPP VY+PP  KPP  VY PP EKPP+Y+ PP+EKPPVY PP
Sbjct: 241 QPPHEKPPPVYPPPYEKPPPVYEPPYEKPPPVVYPPPHEKPPIYEPPPLEKPPVYNPP 298

 Score =  125 bits (315), Expect = 1e-27
 Identities = 71/123 (57%), Positives = 85/123 (69%), Gaps = 14/123 (11%)
 Frame = +3

Query: 6   YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKPPV 170
           ++PP EKPP  Y+PP EKPP  Y+PP EKPP  Y+PP EKPP  Y+PP EKPP  ++PP 
Sbjct: 126 HQPPHEKPPPEYEPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEYQPPHEKPPPEHQPPH 185

Query: 171 EKPPVYKPPAEK-PPVYKPPVYK-PPVYKPPVEKPPVYKPPVE-------KPPVYKPPVE 323
           EKPP ++PP EK PP Y+PP  K PP Y+PP EKPP  KPP E        PP ++PP E
Sbjct: 186 EKPPEHQPPHEKPPPEYQPPHEKPPPEYQPPQEKPPHEKPPPEYQPPHEKPPPEHQPPHE 245

Query: 324 KPP 332
           KPP
Sbjct: 246 KPP 248

 Score =  124 bits (311), Expect = 3e-27
 Identities = 69/121 (57%), Positives = 80/121 (66%), Gaps = 14/121 (11%)
 Frame = +3

Query: 12  PPVEKPPVYK-PPVEKPPVYKPPV-EKPPVYKPPVEK-PPVYKPPVEK--PPVYKPPVEK 176
           PP+EKPP Y+ PP  KPP Y PPV   PP Y+PP EK PP Y PP  +  PP Y PP EK
Sbjct: 36  PPIEKPPTYEPPPFYKPPYYPPPVHHPPPEYQPPHEKTPPEYLPPPHEKPPPEYLPPHEK 95

Query: 177 -PPVYKPPAEK------PPVYKPPVYKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKP 329
            PP Y+PP EK      PP ++PP  KPP ++PP EK PP Y+PP EK PP Y+PP EKP
Sbjct: 96  PPPEYQPPHEKPPHENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPHEKPPPEYQPPHEKP 155

Query: 330 P 332
           P
Sbjct: 156 P 156

 Score =  121 bits (303), Expect = 3e-26
 Identities = 71/132 (53%), Positives = 81/132 (61%), Gaps = 25/132 (18%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPV-YKPPVEK-------------PPVYKPPVEKPPV-YKPPVEK 146
           PP  KPP Y PPV  PP  Y+PP EK             PP Y PP EKPP  Y+PP EK
Sbjct: 47  PPFYKPPYYPPPVHHPPPEYQPPHEKTPPEYLPPPHEKPPPEYLPPHEKPPPEYQPPHEK 106

Query: 147 PP------VYKPPVEKPPVYKPPAEK-PPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEK- 296
           PP       ++PP EKPP ++PP EK PP Y+PP  K PP Y+PP EK PP Y+PP EK 
Sbjct: 107 PPHENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPHEKPPPEYQPPHEKPPPEYQPPHEKP 166

Query: 297 PPVYKPPVEKPP 332
           PP Y+PP EKPP
Sbjct: 167 PPEYQPPHEKPP 178

 Score =  119 bits (299), Expect = 8e-26
 Identities = 71/130 (54%), Positives = 82/130 (63%), Gaps = 20/130 (15%)
 Frame = +3

Query: 3   VYKPPV-EKPPVYKPPVEKPPV------YKPPVEK-PPVYKPPVEK--PPVYKPPVEK-P 149
           + KPP  E PP YKPP   PPV      Y+PP EK PP Y PP  +  PP Y PP EK P
Sbjct: 38  IEKPPTYEPPPFYKPPYYPPPVHHPPPEYQPPHEKTPPEYLPPPHEKPPPEYLPPHEKPP 97

Query: 150 PVYKPPVEK------PPVYKPPAEKPPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEK-PP 302
           P Y+PP EK      PP ++PP EKPP ++PP  K PP Y+PP EK PP Y+PP EK PP
Sbjct: 98  PEYQPPHEKPPHENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPHEKPPPEYQPPHEKPPP 157

Query: 303 VYKPPVEKPP 332
            Y+PP EKPP
Sbjct: 158 EYQPPHEKPP 167

 Score =  115 bits (289), Expect = 1e-24
 Identities = 66/119 (55%), Positives = 75/119 (63%), Gaps = 12/119 (10%)
 Frame = +3

Query: 6   YKPPVEKPPV-YKPPVEKPPVYKPPVE-------KPPVYKPPVEKPP-VYKPPVEKPP-V 155
           Y+PP EKPP  Y+PP EKPP  KPP E        PP ++PP EKPP VY PP EKPP V
Sbjct: 202 YQPPHEKPPPEYQPPQEKPPHEKPPPEYQPPHEKPPPEHQPPHEKPPPVYPPPYEKPPPV 261

Query: 156 YKPPVEKPP--VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           Y+PP EKPP  VY PP EKPP+Y+P         PP+EKPPVY PP   P    PP +K
Sbjct: 262 YEPPYEKPPPVVYPPPHEKPPIYEP---------PPLEKPPVYNPP---PYGRYPPSKK 308

 Score =  104 bits (259), Expect = 4e-21
 Identities = 60/112 (53%), Positives = 69/112 (61%), Gaps = 18/112 (16%)
 Frame = +3

Query: 51  EKPPVYKPPV-EKPPVYKPPVEKPPV------YKPPVEK-PPVYKPPVEK--PPVYKPPA 200
           E PP+ KPP  E PP YKPP   PPV      Y+PP EK PP Y PP  +  PP Y PP 
Sbjct: 34  EPPPIEKPPTYEPPPFYKPPYYPPPVHHPPPEYQPPHEKTPPEYLPPPHEKPPPEYLPPH 93

Query: 201 EK-PPVYKPPVYK------PPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPP 332
           EK PP Y+PP  K      PP ++PP EKPP ++PP EK PP Y+PP EKPP
Sbjct: 94  EKPPPEYQPPHEKPPHENPPPEHQPPHEKPPEHQPPHEKPPPEYEPPHEKPP 145

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 40/71 (56%), Positives = 46/71 (64%), Gaps = 3/71 (4%)
 Frame = +3

Query: 3   VYKPPVEK-PPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           VY PP EK PPVY+PP EKPP  VY PP EKPP+Y+P         PP+EKPPVY PP  
Sbjct: 250 VYPPPYEKPPPVYEPPYEKPPPVVYPPPHEKPPIYEP---------PPLEKPPVYNPP-- 298

Query: 174 KPPVYKPPAEK 206
            P    PP++K
Sbjct: 299 -PYGRYPPSKK 308

[29][TOP]
>UniRef100_Q9ZQI0 Putative uncharacterized protein At2g27380 n=1 Tax=Arabidopsis
           thaliana RepID=Q9ZQI0_ARATH
          Length = 761

 Score =  137 bits (345), Expect = 4e-31
 Identities = 59/117 (50%), Positives = 74/117 (63%), Gaps = 10/117 (8%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKP 179
           PP+  PP+Y PP++KPP Y PP+  PP+ KPP     PP+Y PP++KP  P Y PP+  P
Sbjct: 60  PPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPP 119

Query: 180 PVYKPPAE--KPPVYKPPVYKPPV--YKPPVEKPPVYKPPVE--KPPVYKPPVEKPP 332
           P+ KPP     PP+Y PP+ KPP   Y PPV+ PPV  PP     PP+  PPV KPP
Sbjct: 120 PIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPP 176

 Score =  136 bits (342), Expect = 8e-31
 Identities = 67/130 (51%), Positives = 84/130 (64%), Gaps = 22/130 (16%)
 Frame = +3

Query: 9   KPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEK 176
           KPPV KPP  +Y PP++ PPV+KPP    P+Y PP++ PPV+KPP     PPV  PPV K
Sbjct: 185 KPPVHKPPTPIYSPPIKPPPVHKPPT---PIYSPPIKPPPVHKPPTPTYSPPVKPPPVHK 241

Query: 177 P--PVYKPPAEKPPVYKP--PVYKPPVYKPPVEKP--PVYKPPVEKPPVYK--------- 311
           P  P+Y PP + PPV+KP  P+Y PPV  PPV+ P  P+Y PPV+ PPV+K         
Sbjct: 242 PPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPP 301

Query: 312 ---PPVEKPP 332
              PPV+KPP
Sbjct: 302 VKSPPVQKPP 311

 Score =  135 bits (341), Expect = 1e-30
 Identities = 65/129 (50%), Positives = 83/129 (64%), Gaps = 19/129 (14%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKP--PVEKPPVYKP 164
           +Y PP++ PPV+KPP     PPV  PPV KP  P+Y PP++ PPV+KP  P+  PPV  P
Sbjct: 212 IYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPP 271

Query: 165 PVEKP--PVYKPPAEKPPVYKP--PVYKPPVYKPPVEKP--PVYKPPVEKPPV------- 305
           PV+ P  P+Y PP + PPV+KP  P Y PPV  PPV+KP  P Y PP++ PPV       
Sbjct: 272 PVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPT 331

Query: 306 YKPPVEKPP 332
           Y PP++ PP
Sbjct: 332 YSPPIKPPP 340

 Score =  135 bits (340), Expect = 1e-30
 Identities = 61/126 (48%), Positives = 77/126 (61%), Gaps = 16/126 (12%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKPPV 170
           +Y PP+  PP+ KPP   PP+Y PP++KP  P Y PP+  PP+ KPP     PP+Y PP+
Sbjct: 62  IYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPI 121

Query: 171 EKP--PVYKPPAEKPPVYKPPV--YKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--- 323
           +KP  P Y PP   PP+ KPP   Y PPV  PPV+ P  P Y PP++ PPV+KPP     
Sbjct: 122 QKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYS 181

Query: 324 ---KPP 332
              KPP
Sbjct: 182 PPIKPP 187

 Score =  132 bits (332), Expect = 1e-29
 Identities = 68/133 (51%), Positives = 82/133 (61%), Gaps = 23/133 (17%)
 Frame = +3

Query: 3   VYKPPVEKPPV-------YKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKP 149
           +Y PPV+ PPV       Y PPV+ PPV+KPP     PPV  PPV+KP  P Y PP++ P
Sbjct: 263 IYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPP 322

Query: 150 PVYKPPVE------KPPVYKPPAE--KPPVYKPPVYKP--PVYKPPVEKPPVYKP--PVE 293
           PV KPP        KPP  KPP     PPV  PPV+KP  P+Y PPV+ PPV+KP  P+ 
Sbjct: 323 PVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIY 382

Query: 294 KPPVYKPPVEKPP 332
            PPV  PP++KPP
Sbjct: 383 SPPVKPPPIQKPP 395

 Score =  131 bits (330), Expect = 2e-29
 Identities = 65/132 (49%), Positives = 83/132 (62%), Gaps = 22/132 (16%)
 Frame = +3

Query: 3   VYKPPVEKPP-------VYKPPVEKPPV--YKPPVEKPPV-------YKPPVEKPPVYKP 134
           +Y PP++KPP       +Y PP++KPP   Y PPV+ PPV       Y PP++ PPV+KP
Sbjct: 116 IYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKP 175

Query: 135 PVEKPPVYKPPVEKPPVYKPPAE--KPPVYKPPVYKP--PVYKPPVEKPPVYKPPVE--K 296
           P    P Y PP+ KPPV+KPP     PP+  PPV+KP  P+Y PP++ PPV+KPP     
Sbjct: 176 PT---PTYSPPI-KPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYS 231

Query: 297 PPVYKPPVEKPP 332
           PPV  PPV KPP
Sbjct: 232 PPVKPPPVHKPP 243

 Score =  130 bits (326), Expect = 6e-29
 Identities = 62/128 (48%), Positives = 80/128 (62%), Gaps = 18/128 (14%)
 Frame = +3

Query: 3   VYKPPVEKPPV--YKPPVEKPPV------YKPPVEKPPVYKPPVE--KPPVYKPPVEKP- 149
           V  PP++KPP   Y PP++ PPV      Y PP++ PPV+KPP     PP+  PP+ KP 
Sbjct: 503 VKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPP 562

Query: 150 -PVYKPPVEKPPVYKPPAE--KPPVYKPPVYKP--PVYKPPVEKPPVYKPPVE--KPPVY 308
            P Y PP++ PPV+KPP     PP+  PPV+KP  P Y PP++ PPV+KPP     PP+ 
Sbjct: 563 TPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIK 622

Query: 309 KPPVEKPP 332
            PPV KPP
Sbjct: 623 PPPVHKPP 630

 Score =  129 bits (324), Expect = 1e-28
 Identities = 65/132 (49%), Positives = 79/132 (59%), Gaps = 22/132 (16%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKP--PVEKPPVYKPPVEKP--PVYKPPVEKPPV------YKPPVEKPP 152
           +Y PPV+ PPV+KP  P+  PPV  PPV KP  P Y PP++ PPV      Y PPV+ PP
Sbjct: 431 IYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPP 490

Query: 153 VYKPPVE--KPPVYKPPAEKP--PVYKPPVYKPPV------YKPPVEKPPVYKPPVE--K 296
           V KPP     PPV  PP +KP  P Y PP+  PPV      Y PP++ PPV+KPP     
Sbjct: 491 VQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYS 550

Query: 297 PPVYKPPVEKPP 332
           PP+  PP+ KPP
Sbjct: 551 PPIKPPPIHKPP 562

 Score =  129 bits (323), Expect = 1e-28
 Identities = 63/128 (49%), Positives = 79/128 (61%), Gaps = 19/128 (14%)
 Frame = +3

Query: 6   YKPPVEKPPV------YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYK 161
           Y PP++ PPV      Y PPV+ PPV+KPP    P+Y PPV+ PPV+KPP     PP+  
Sbjct: 416 YSPPIKLPPVKPPTPIYSPPVKPPPVHKPPT---PIYSPPVKPPPVHKPPTPTYSPPIKP 472

Query: 162 PPVEKP-PVYKPPAEKPPVYKP--PVYKPPVYKPPVEKP--PVYKPPVEKPPV------Y 308
           PPV+ P P Y PP + PPV KP  P Y PPV  PP++KP  P Y PP++ PPV      Y
Sbjct: 473 PPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTY 532

Query: 309 KPPVEKPP 332
            PP++ PP
Sbjct: 533 SPPIKPPP 540

 Score =  128 bits (321), Expect = 2e-28
 Identities = 62/125 (49%), Positives = 79/125 (63%), Gaps = 18/125 (14%)
 Frame = +3

Query: 12  PPVEKPPV--YKPPVEKPPV------YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 167
           PPV+KPP   Y PP++ PPV      Y PPV+ PPV+KPP    P+Y PPV+ PPV+KPP
Sbjct: 322 PPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPT---PIYSPPVKPPPVHKPP 378

Query: 168 VEKPPVYKPPAEKPPVYKP--PVYKPPVYKPPVEKP--PVYKPPVEKPPV------YKPP 317
               P+Y PP + PP+ KP  P Y PP+  PP++KP  P Y PP++ PPV      Y PP
Sbjct: 379 T---PIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPP 435

Query: 318 VEKPP 332
           V+ PP
Sbjct: 436 VKPPP 440

 Score =  128 bits (321), Expect = 2e-28
 Identities = 61/117 (52%), Positives = 76/117 (64%), Gaps = 8/117 (6%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVE--KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           Y PP++ PP+ KPP     PP+  PPV+ P P+Y PPV+ PPV+KPP    P+Y PPV+ 
Sbjct: 399 YSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPT---PIYSPPVKP 455

Query: 177 PPVYKPPAE--KPPVYKPPVYKP-PVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPP 332
           PPV+KPP     PP+  PPV  P P Y PPV+ PPV KPP     PPV  PP++KPP
Sbjct: 456 PPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPP 512

 Score =  118 bits (295), Expect = 2e-25
 Identities = 59/117 (50%), Positives = 69/117 (58%), Gaps = 10/117 (8%)
 Frame = +3

Query: 12  PPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE 173
           PPV KPP   Y PP++ PPV+KPP     PP+  PPV+KP  P Y PPV+ PPV  PP  
Sbjct: 624 PPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPT- 682

Query: 174 KPPVYKPPAEKPPVYKP--PVYKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPP 332
             P Y PP + PPV  P  P Y PPV  PPV+ P  P Y PP++ PPV  PP    P
Sbjct: 683 --PTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTP 737

 Score =  100 bits (248), Expect = 7e-20
 Identities = 50/104 (48%), Positives = 57/104 (54%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP++ PPV KPP    P Y PPV+ PPV  PP    P Y PPV+ PPV  PP    P 
Sbjct: 651 YSPPIKPPPVQKPPT---PTYSPPVKPPPVQLPPT---PTYSPPVKPPPVQVPPT---PT 701

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           Y PP + PPV  PP    P Y PP++ PPV  PP    P   PP
Sbjct: 702 YSPPVKPPPVQVPPT---PTYSPPIKPPPVQVPPTPTTP--SPP 740

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 32/69 (46%), Positives = 42/69 (60%), Gaps = 7/69 (10%)
 Frame = +3

Query: 147 PPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEK-------PPV 305
           PP+Y  P    P Y  P   PP+Y PP+Y PP+ KPP   PP+Y PP++K       PP+
Sbjct: 46  PPIYGAP----PSYTTPP--PPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPI 99

Query: 306 YKPPVEKPP 332
           Y PP++KPP
Sbjct: 100 YPPPIQKPP 108

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 41/93 (44%), Positives = 48/93 (51%), Gaps = 19/93 (20%)
 Frame = +3

Query: 12  PPVEKPPV--YKPPVEKPPV-------YKPPVEKPPV-------YKPPVEKPPVYKPPVE 143
           PPV+KPP   Y PPV+ PPV       Y PPV+ PPV       Y PPV+ PPV  PP  
Sbjct: 658 PPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTP 717

Query: 144 --KPPVYKPPVEKPPVYKPPAEKPPVY-KPPVY 233
              PP+  PPV+ PP    P+     Y  PP Y
Sbjct: 718 TYSPPIKPPPVQVPPTPTTPSPPQGGYGTPPPY 750

[30][TOP]
>UniRef100_A7PF96 Chromosome chr11 scaffold_13, whole genome shotgun sequence n=1
           Tax=Vitis vinifera RepID=A7PF96_VITVI
          Length = 266

 Score =  135 bits (341), Expect = 1e-30
 Identities = 58/116 (50%), Positives = 74/116 (63%), Gaps = 8/116 (6%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVY----KPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKP 164
           KPP+ +PP+ KPP+  PPV     KPP+  PPV     KPP+  PP+  PP+ KPP+  P
Sbjct: 54  KPPITRPPIVKPPITVPPVVPPIVKPPITLPPVVPPIVKPPITVPPITVPPIVKPPITVP 113

Query: 165 PVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P+  PP+ KPP   PP+  PP+ KPPV  PP+  PP+ KPP+  PPV  PPV KPP
Sbjct: 114 PITVPPIVKPPITVPPITVPPIVKPPVTVPPITVPPIIKPPITVPPVVTPPVNKPP 169

 Score =  129 bits (324), Expect = 1e-28
 Identities = 56/114 (49%), Positives = 74/114 (64%), Gaps = 5/114 (4%)
 Frame = +3

Query: 6   YKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV----YKPPVEKPPVYKPPV 170
           +KPP   KPP  KPP+ +PP+ KPP+  PPV  PP+ KPP+      PP+ KPP+  PP+
Sbjct: 42  HKPPSHHKPPKGKPPITRPPIVKPPITVPPVV-PPIVKPPITLPPVVPPIVKPPITVPPI 100

Query: 171 EKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PP+ KPP   PP+  PP+ KPP+  PP+  PP+ KPPV  PP+  PP+ KPP
Sbjct: 101 TVPPIVKPPITVPPITVPPIVKPPITVPPITVPPIVKPPVTVPPITVPPIIKPP 154

 Score =  126 bits (316), Expect = 9e-28
 Identities = 57/111 (51%), Positives = 74/111 (66%), Gaps = 2/111 (1%)
 Frame = +3

Query: 6   YKPPVE-KPPVY-KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           +KPP   KPP + KPP  KPP+ +PP+ KPP+  PPV  PP+ KPP+  PPV  PP+ KP
Sbjct: 36  HKPPFHHKPPSHHKPPKGKPPITRPPIVKPPITVPPVV-PPIVKPPITLPPVV-PPIVKP 93

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P+  PP   PP+ KPP+  PP+  PP+ KPP+  PP+  PP+ KPPV  PP
Sbjct: 94  PITVPPITVPPIVKPPITVPPITVPPIVKPPITVPPITVPPIVKPPVTVPP 144

 Score =  125 bits (313), Expect = 2e-27
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 2/109 (1%)
 Frame = +3

Query: 12  PPVEKPPVY-KPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           PP  KPP + KPP   KPP  KPP+ +PP+ KPP+  PPV  PP+ KPP+  PPV  PP+
Sbjct: 33  PPQHKPPFHHKPPSHHKPPKGKPPITRPPIVKPPITVPPVV-PPIVKPPITLPPV-VPPI 90

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            KPP   PP+  PP+ KPP+  PP+  PP+ KPP+  PP+  PP+ KPP
Sbjct: 91  VKPPITVPPITVPPIVKPPITVPPITVPPIVKPPITVPPITVPPIVKPP 139

 Score =  116 bits (291), Expect = 7e-25
 Identities = 51/111 (45%), Positives = 66/111 (59%), Gaps = 4/111 (3%)
 Frame = +3

Query: 3   VYKPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 170
           + KPP+  PPV     KPP+  PP+  PP+ KPP+  PP+  PP+ KPP+  PP+  PP+
Sbjct: 76  IVKPPITLPPVVPPIVKPPITVPPITVPPIVKPPITVPPITVPPIVKPPITVPPITVPPI 135

Query: 171 EKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
            KPPV  PP   PP+ KPP+  PPV  PPV KPPV  P    P     P++
Sbjct: 136 VKPPVTVPPITVPPIIKPPITVPPVVTPPVNKPPVGTPCPPPPASATCPID 186

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 25/54 (46%), Positives = 34/54 (62%), Gaps = 7/54 (12%)
 Frame = +3

Query: 192 PPAEKPPVYKPPV-------YKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P ++ PP +KPP        +KPP  KPP+ +PP+ KPP+  PPV  PP+ KPP
Sbjct: 28  PCSKPPPQHKPPFHHKPPSHHKPPKGKPPITRPPIVKPPITVPPVV-PPIVKPP 80

[31][TOP]
>UniRef100_C9SV57 Repetitive proline-rich cell wall protein n=1 Tax=Verticillium
           albo-atrum VaMs.102 RepID=C9SV57_9PEZI
          Length = 345

 Score =  134 bits (338), Expect = 2e-30
 Identities = 62/108 (57%), Positives = 72/108 (66%), Gaps = 2/108 (1%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P   PPVY+PP E  PVY+PP E  P  +PP E  PVY+PPVE  PVY+PPVE  PVY+P
Sbjct: 20  PAPDPPVYEPPAESHPVYEPPKESYPPVEPPKESHPVYEPPVESHPVYEPPVESHPVYEP 79

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPP 332
           P E  PVY+PP    PVY+PP E  PVY+PP E  PVY+P  E   PP
Sbjct: 80  PKESHPVYEPPKESHPVYEPPKESHPVYEPPKESHPVYEPLKESYSPP 127

 Score =  132 bits (333), Expect = 9e-30
 Identities = 64/112 (57%), Positives = 74/112 (66%), Gaps = 2/112 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY+PP E  PVY+PP E  P  +PP E  PVY+PPVE  PVY+PPVE  PVY+PP E  P
Sbjct: 26  VYEPPAESHPVYEPPKESYPPVEPPKESHPVYEPPVESHPVYEPPVESHPVYEPPKESHP 85

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKPP 332
           VY+PP E  PVY+PP    PVY+PP E  PVY+P  E   PP   PP E PP
Sbjct: 86  VYEPPKESHPVYEPPKESHPVYEPPKESHPVYEPLKESYSPP---PPHEYPP 134

 Score =  119 bits (299), Expect = 8e-26
 Identities = 59/107 (55%), Positives = 68/107 (63%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY+PP E  P  +PP E  PVY+PPVE  PVY+PPVE  PVY+PP E  PVY+PP E  P
Sbjct: 36  VYEPPKESYPPVEPPKESHPVYEPPVESHPVYEPPVESHPVYEPPKESHPVYEPPKESHP 95

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           VY+PP E  PVY+PP    PVY+P  E    Y PP   PP   PP E
Sbjct: 96  VYEPPKESHPVYEPPKESHPVYEPLKES---YSPP---PPHEYPPPE 136

[32][TOP]
>UniRef100_C6TN18 Putative uncharacterized protein n=1 Tax=Glycine max
           RepID=C6TN18_SOYBN
          Length = 143

 Score =  134 bits (337), Expect = 3e-30
 Identities = 68/110 (61%), Positives = 83/110 (75%), Gaps = 8/110 (7%)
 Frame = +3

Query: 27  PPVYKPP-VEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVEK-PPVYKP 194
           PP+Y+PP +EKPP+Y+PP    P Y+PP  +  PP+YKPP   PPVY+PP EK PPVY+P
Sbjct: 27  PPIYEPPPIEKPPIYEPP----PSYEPPPTENPPPLYKPPFYPPPVYQPPYEKPPPVYQP 82

Query: 195 PAEK-PPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPP 332
           P EK PPVY+PP  K PPVY+PP EK PPVY+PP EK PP Y+PP+  PP
Sbjct: 83  PYEKPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPNEKPPPEYQPPIYNPP 132

 Score =  132 bits (332), Expect = 1e-29
 Identities = 69/114 (60%), Positives = 83/114 (72%), Gaps = 9/114 (7%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPPVYKPPVEK-PPVYKPPVEK-P 179
           PP+EKPP+Y+P    PP Y+PP  +  PP+YKPP   PPVY+PP EK PPVY+PP EK P
Sbjct: 33  PPIEKPPIYEP----PPSYEPPPTENPPPLYKPPFYPPPVYQPPYEKPPPVYQPPYEKPP 88

Query: 180 PVYKPPAEK-PPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEKPPVY--KPPVEK 326
           PVY+PP EK PPVY+PP  K PPVY+PP EK PP Y+PP+  PP Y   PP +K
Sbjct: 89  PVYQPPYEKPPPVYQPPYEKPPPVYQPPNEKPPPEYQPPIYNPPPYGHYPPSKK 142

 Score =  109 bits (273), Expect = 8e-23
 Identities = 58/101 (57%), Positives = 68/101 (67%), Gaps = 3/101 (2%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPPVYKPPVE 173
           +YKPP   PPVY+PP EK PPVY+PP EK PPVY+PP EK PPVY+PP EKP        
Sbjct: 58  LYKPPFYPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPYEKPPPVYQPPYEKP-------- 109

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEK 296
            PPVY+PP EKP    PP Y+PP+Y PP   P  + PP +K
Sbjct: 110 -PPVYQPPNEKP----PPEYQPPIYNPP---PYGHYPPSKK 142

[33][TOP]
>UniRef100_Q94G51 Proline-rich protein-1 n=1 Tax=Gossypium hirsutum
           RepID=Q94G51_GOSHI
          Length = 299

 Score =  134 bits (336), Expect = 4e-30
 Identities = 67/129 (51%), Positives = 86/129 (66%), Gaps = 19/129 (14%)
 Frame = +3

Query: 3   VYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPP 152
           VY PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP +KPP
Sbjct: 159 VYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPP 216

Query: 153 VYKPPVEKPPVYKPPAEKPPVYKPPVYK----PPVYKPPVEKPPVYKPPVE-----KPPV 305
           +Y+P   KPPVY PP ++ P  KPP+Y+    PP+Y+P   KPPVY PP E     KPPV
Sbjct: 217 MYEPKPPKPPVYTPPKKEKPEPKPPMYQPPNNPPIYEPKPPKPPVYAPPKEEKPKPKPPV 276

Query: 306 YKPPVEKPP 332
           Y+PP  +PP
Sbjct: 277 YEPPAHEPP 285

 Score =  127 bits (318), Expect = 5e-28
 Identities = 66/134 (49%), Positives = 86/134 (64%), Gaps = 24/134 (17%)
 Frame = +3

Query: 3   VYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPP 122
           VY+PP +     KPP+Y PP +     KPPVY+PP +     KPPVY PP +     KPP
Sbjct: 114 VYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPP 173

Query: 123 VYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVY----KPPVYKPPVEKPPVYKPPV 290
           VY+PP +KPP+Y+P   KPPVY PP ++ P  KPP+Y    KPP+Y+P   KPPVY PP 
Sbjct: 174 VYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPPKKPPMYEPKPPKPPVYTPPK 232

Query: 291 EKPPVYKPPVEKPP 332
           ++ P  KPP+ +PP
Sbjct: 233 KEKPEPKPPMYQPP 246

 Score =  125 bits (315), Expect = 1e-27
 Identities = 65/128 (50%), Positives = 83/128 (64%), Gaps = 20/128 (15%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE----- 143
           KPPV +PP  + P  KPP+Y PP +     KPPVY+PP +     KPPVY PP +     
Sbjct: 111 KPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEP 170

Query: 144 KPPVYKPPVEKPPVYKPPAEKPPVYKPPVY-----KPPVYKPPVEKPPVYKPPVEKPPVY 308
           KPPVY+PP +KPP+Y+P   KPPVY PP       KPP+Y+PP +KPP+Y+P   KPPVY
Sbjct: 171 KPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPPMYEPKPPKPPVY 228

Query: 309 KPPVEKPP 332
            PP ++ P
Sbjct: 229 TPPKKEKP 236

 Score =  124 bits (310), Expect = 4e-27
 Identities = 67/133 (50%), Positives = 85/133 (63%), Gaps = 25/133 (18%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE----- 143
           KPPV  PP  + P  KPPVY+PP +     KPP+Y PP +     KPPVY+PP +     
Sbjct: 96  KPPVYTPPKKEVPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEP 155

Query: 144 KPPVYKPPVE-----KPPVYKPPAEKPPVYKPPVYKPPVYKPPVE-----KPPVYKPPVE 293
           KPPVY PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP +
Sbjct: 156 KPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-K 213

Query: 294 KPPVYKPPVEKPP 332
           KPP+Y+P   KPP
Sbjct: 214 KPPMYEPKPPKPP 226

 Score =  122 bits (307), Expect = 1e-26
 Identities = 63/127 (49%), Positives = 79/127 (62%), Gaps = 17/127 (13%)
 Frame = +3

Query: 3   VYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE-----K 146
           V+KPP  KPP Y  KPPV +PP  + P  KPPVY PP +     KP +Y+PP +     K
Sbjct: 37  VFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPTMYEPPKKEKPEPK 96

Query: 147 PPVYKPPVE-----KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
           PPVY PP +     KPPVY+PP ++ P  KPP+Y PP  + P  KPPVY+PP ++ P  K
Sbjct: 97  PPVYTPPKKEVPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPK 156

Query: 312 PPVEKPP 332
           PPV  PP
Sbjct: 157 PPVYTPP 163

 Score =  122 bits (305), Expect = 2e-26
 Identities = 67/140 (47%), Positives = 86/140 (61%), Gaps = 30/140 (21%)
 Frame = +3

Query: 3   VYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPP 122
           VY+PP +     KPPVY PP +     KP +Y+PP +     KPPVY PP +     KPP
Sbjct: 54  VYEPPKKEKPEPKPPVYAPPKKEKHGPKPTMYEPPKKEKPEPKPPVYTPPKKEVPKPKPP 113

Query: 123 VYKPPVE-----KPPVYKPPVE-----KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPP 272
           VY+PP +     KPP+Y PP +     KPPVY+PP ++ P  KPPVY PP  + P  KPP
Sbjct: 114 VYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPP 173

Query: 273 VYKPPVEKPPVYKPPVEKPP 332
           VY+PP +KPP+Y+P   KPP
Sbjct: 174 VYEPP-KKPPMYEPKPPKPP 192

 Score =  120 bits (302), Expect = 4e-26
 Identities = 59/120 (49%), Positives = 77/120 (64%), Gaps = 10/120 (8%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +Y+PP ++ P  KPPV  PP  + P  KPPVY+PP ++ P  KPP+  PP  + P  KPP
Sbjct: 84  MYEPPKKEKPEPKPPVYTPPKKEVPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPP 143

Query: 183 VYKPPAE-----KPPVYKPPVY-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VY+PP +     KPPVY PP       KPPVY+PP +KPP+Y+P   KPPVY PP ++ P
Sbjct: 144 VYEPPKKEKPEPKPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKP 202

 Score =  117 bits (292), Expect = 5e-25
 Identities = 60/120 (50%), Positives = 75/120 (62%), Gaps = 12/120 (10%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPP 167
           KPP    PV+KPP  KPP Y  KPPV +PP  + P  KPPVY PP +     KP +Y+PP
Sbjct: 32  KPPT---PVFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPTMYEPP 88

Query: 168 VE-----KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +     KPPVY PP ++ P  KPPVY+PP  + P  KPP+Y PP ++ P  KPPV +PP
Sbjct: 89  KKEKPEPKPPVYTPPKKEVPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPP 148

 Score =  116 bits (291), Expect = 7e-25
 Identities = 58/119 (48%), Positives = 77/119 (64%), Gaps = 10/119 (8%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPP 152
           +Y+P   KPPVY PP +     KPP+Y+PP +KPP+Y+P   KPPVY PP +     KPP
Sbjct: 183 MYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPP 241

Query: 153 VYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           +Y+PP   PP+Y+P   KPPVY PP  + P  KPPV +PP ++PP    P + PP+ KP
Sbjct: 242 MYQPP-NNPPIYEPKPPKPPVYAPPKEEKPKPKPPVYEPPAHEPPYGHYPGH-PPLGKP 298

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 35/71 (49%), Positives = 43/71 (60%), Gaps = 7/71 (9%)
 Frame = +3

Query: 141 EKPPVYKPPVEKPPVYKPPAEKPPVY--KPPVYKPPVYKPPVEKPPVYKPPVE-----KP 299
           E P   KPP    PV+KPP  KPP Y  KPPVY+PP  + P  KPPVY PP +     KP
Sbjct: 26  ESPNYGKPPT---PVFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKP 82

Query: 300 PVYKPPVEKPP 332
            +Y+PP ++ P
Sbjct: 83  TMYEPPKKEKP 93

[34][TOP]
>UniRef100_UPI0001AF2AEF putative secreted protein n=1 Tax=Streptomyces roseosporus NRRL
           11379 RepID=UPI0001AF2AEF
          Length = 227

 Score =  132 bits (332), Expect = 1e-29
 Identities = 58/106 (54%), Positives = 83/106 (78%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           P  E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 75  PKHEHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 133

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PP ++PPV +PPV +PPV +PPV++PPV +PP + P    P  + P
Sbjct: 134 PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTP 179

 Score =  127 bits (320), Expect = 3e-28
 Identities = 55/107 (51%), Positives = 80/107 (74%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV 
Sbjct: 83  KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVD 142

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           +PP ++PPV +PPV +PPV +PP + P    P  + P    P    P
Sbjct: 143 EPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTP 189

 Score =  125 bits (315), Expect = 1e-27
 Identities = 52/91 (57%), Positives = 77/91 (84%)
 Frame = +3

Query: 60  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKP 239
           P ++ P  KPPV +PPV++PPV +PPV++PPV +PPV++PPV +PP ++PPV +PPV +P
Sbjct: 75  PKHEHPPVKPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEP 134

Query: 240 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 135 PVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 165

 Score =  118 bits (296), Expect = 2e-25
 Identities = 49/89 (55%), Positives = 73/89 (82%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 86  VDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 145

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKP 269
           V +PP ++PPV +PPV +PP   P  + P
Sbjct: 146 VDEPPVDEPPVDEPPVDEPPTDTPGTDTP 174

 Score =  112 bits (281), Expect = 1e-23
 Identities = 49/102 (48%), Positives = 73/102 (71%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 91  VDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 150

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
           V +PP ++PPV +PP   P    P  + P    P    P  +
Sbjct: 151 VDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTPDAH 192

[35][TOP]
>UniRef100_UPI0001AECDFF putative secreted protein n=1 Tax=Streptomyces roseosporus NRRL
           15998 RepID=UPI0001AECDFF
          Length = 207

 Score =  132 bits (332), Expect = 1e-29
 Identities = 58/106 (54%), Positives = 83/106 (78%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           P  E PPV KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 75  PKHEHPPV-KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 133

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PP ++PPV +PPV +PPV +PPV++PPV +PP + P    P  + P
Sbjct: 134 PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTP 179

 Score =  127 bits (320), Expect = 3e-28
 Identities = 55/107 (51%), Positives = 80/107 (74%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV 
Sbjct: 83  KPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVD 142

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           +PP ++PPV +PPV +PPV +PP + P    P  + P    P    P
Sbjct: 143 EPPVDEPPVDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTP 189

 Score =  125 bits (315), Expect = 1e-27
 Identities = 52/91 (57%), Positives = 77/91 (84%)
 Frame = +3

Query: 60  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKP 239
           P ++ P  KPPV +PPV++PPV +PPV++PPV +PPV++PPV +PP ++PPV +PPV +P
Sbjct: 75  PKHEHPPVKPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEP 134

Query: 240 PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 135 PVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 165

 Score =  118 bits (296), Expect = 2e-25
 Identities = 49/89 (55%), Positives = 73/89 (82%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 86  VDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 145

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKP 269
           V +PP ++PPV +PPV +PP   P  + P
Sbjct: 146 VDEPPVDEPPVDEPPVDEPPTDTPGTDTP 174

 Score =  112 bits (281), Expect = 1e-23
 Identities = 49/102 (48%), Positives = 73/102 (71%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 91  VDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPP 150

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
           V +PP ++PPV +PP   P    P  + P    P    P  +
Sbjct: 151 VDEPPVDEPPVDEPPTDTPGTDTPGSDTPGSGTPGSNTPDAH 192

[36][TOP]
>UniRef100_Q89392 A57R protein n=1 Tax=Paramecium bursaria Chlorella virus 1
           RepID=Q89392_PBCV1
          Length = 544

 Score =  132 bits (332), Expect = 1e-29
 Identities = 64/108 (59%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 39  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 98

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP+ KPP  KPP  KPP  KPP  KPP  KPP  KPP  +PP  +PP
Sbjct: 99  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPP 146

 Score =  131 bits (330), Expect = 2e-29
 Identities = 63/108 (58%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 44  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 103

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP+ KPP  KPP  KPP  KPP  KPP  KPP  +PP  +PP  +PP
Sbjct: 104 KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPP 151

 Score =  130 bits (328), Expect = 3e-29
 Identities = 62/108 (57%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 49  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 108

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP+ KPP  KPP  KPP  KPP  KPP  +PP  +PP  +PP  +PP
Sbjct: 109 KPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPP 156

 Score =  130 bits (326), Expect = 6e-29
 Identities = 61/108 (56%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 54  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 113

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP+ KPP  KPP  KPP  KPP  +PP  +PP  +PP  +PP  +PP
Sbjct: 114 KPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPP 161

 Score =  129 bits (324), Expect = 1e-28
 Identities = 60/108 (55%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 59  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 118

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP+ KPP  KPP  KPP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 119 KPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPPAPEPP 166

 Score =  128 bits (322), Expect = 2e-28
 Identities = 58/108 (53%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 69  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 128

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP+ KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 129 KPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPPAPEPPALEPPAPEPP 176

 Score =  127 bits (320), Expect = 3e-28
 Identities = 59/108 (54%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 64  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 123

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP+ KPP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 124 KPPSPKPPSPKPPAPEPPAPEPPAPEPPAPEPPAPEPPAPEPPALEPP 171

 Score =  127 bits (319), Expect = 4e-28
 Identities = 57/108 (52%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 79  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPAP 138

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PPA +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 139 EPPAPEPPAPEPPAPEPPAPEPPAPEPPALEPPAPEPPAPEPPAPEPP 186

 Score =  126 bits (317), Expect = 7e-28
 Identities = 58/108 (53%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  
Sbjct: 74  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSP 133

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPPA +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 134 KPPAPEPPAPEPPAPEPPAPEPPAPEPPAPEPPALEPPAPEPPAPEPP 181

 Score =  110 bits (276), Expect = 4e-23
 Identities = 49/100 (49%), Positives = 60/100 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  KPP  +PP  +PP  +PP  
Sbjct: 94  KPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPSPKPPAPEPPAPEPPAPEPPAP 153

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
           +PPA +PP  +PP  +PP  +PP  +PP  +PP  +   Y
Sbjct: 154 EPPAPEPPAPEPPALEPPAPEPPAPEPPAPEPPAPEQNFY 193

[37][TOP]
>UniRef100_Q9FEW3 Putative repetitive proline-rich protein n=1 Tax=Medicago
           truncatula RepID=Q9FEW3_MEDTR
          Length = 174

 Score =  130 bits (327), Expect = 5e-29
 Identities = 59/111 (53%), Positives = 75/111 (67%), Gaps = 1/111 (0%)
 Frame = +3

Query: 3   VYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           VY PP+ KPP  YKPP++K P+ K P +KP + KPP+ KPP  +PP  K P+  PP +KP
Sbjct: 52  VYNPPIYKPPPTYKPPIKKQPINKSPNKKPLLLKPPLPKPPHKEPPSRKRPINTPPDKKP 111

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P+ KPP  KPP  KPP  K P+  PP +KPP+ KPPV KPP  KP  ++PP
Sbjct: 112 PLLKPPFPKPPQKKPPSRKRPINTPPNKKPPLPKPPVNKPPHKKPSNKRPP 162

 Score =  129 bits (323), Expect = 1e-28
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEK----PPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 167
           +Y  P+ K     PVY PP+ KPP  YKPP++K P+ K P +KP + KPP+ KPP  +PP
Sbjct: 38  IYTTPIHKNPTNTPVYNPPIYKPPPTYKPPIKKQPINKSPNKKPLLLKPPLPKPPHKEPP 97

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             K P+  PP +KPP+ KPP  KPP  KPP  K P+  PP +KPP+ KPPV KPP
Sbjct: 98  SRKRPINTPPDKKPPLLKPPFPKPPQKKPPSRKRPINTPPNKKPPLPKPPVNKPP 152

 Score =  121 bits (304), Expect = 2e-26
 Identities = 55/106 (51%), Positives = 71/106 (66%), Gaps = 2/106 (1%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKPP++K P+ K P +KP + KPP+ KPP  +PP  K P+  PP +KPP+ KPP  KPP 
Sbjct: 64  YKPPIKKQPINKSPNKKPLLLKPPLPKPPHKEPPSRKRPINTPPDKKPPLLKPPFPKPPQ 123

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY--KPP 317
            KPP+ K P+  PP  KPP+ KPPV KPP  KP  ++PP Y  +PP
Sbjct: 124 KKPPSRKRPINTPPNKKPPLPKPPVNKPPHKKPSNKRPPPYGNQPP 169

 Score =  107 bits (268), Expect = 3e-22
 Identities = 50/101 (49%), Positives = 62/101 (61%)
 Frame = +3

Query: 30  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKP 209
           P+Y  P+ K P    PV  PP+YKPP    P YKPP++K P+ K P +KP + KPP  KP
Sbjct: 37  PIYTTPIHKNPT-NTPVYNPPIYKPP----PTYKPPIKKQPINKSPNKKPLLLKPPLPKP 91

Query: 210 PVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P  +PP  K P+  PP +KPP+ KPP  KPP  KPP  K P
Sbjct: 92  PHKEPPSRKRPINTPPDKKPPLLKPPFPKPPQKKPPSRKRP 132

[38][TOP]
>UniRef100_B1VVM2 Putative secreted protein n=1 Tax=Streptomyces griseus subsp.
           griseus NBRC 13350 RepID=B1VVM2_STRGG
          Length = 231

 Score =  130 bits (326), Expect = 6e-29
 Identities = 54/106 (50%), Positives = 80/106 (75%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP++ PP+  PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 88  PPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 147

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PP ++PPV +PPV +PPV +PPV++PP   P  + P    P    P
Sbjct: 148 PPVDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTPGSGTPGSNTP 193

 Score =  129 bits (324), Expect = 1e-28
 Identities = 53/101 (52%), Positives = 79/101 (78%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           P  + PP+  PP++ PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 83  PKHDHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 142

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           PP ++PPV +PPV +PPV +PPV++PPV +PP + P    P
Sbjct: 143 PPVDEPPVDQPPVDEPPVDQPPVDEPPVDQPPTDTPGTDTP 183

 Score =  129 bits (323), Expect = 1e-28
 Identities = 52/96 (54%), Positives = 78/96 (81%)
 Frame = +3

Query: 42  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYK 221
           P  + PP+  PP++ PPV +PPV++PPV +PPV++PPV +PPV++PPV +PP ++PPV +
Sbjct: 83  PKHDHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 142

Query: 222 PPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PPV +PPV +PPV++PPV +PPV++PPV +PP + P
Sbjct: 143 PPVDEPPVDQPPVDEPPVDQPPVDEPPVDQPPTDTP 178

 Score =  126 bits (316), Expect = 9e-28
 Identities = 50/87 (57%), Positives = 75/87 (86%)
 Frame = +3

Query: 72  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYK 251
           PP++ PP+  PPV++PPV +PPV++PPV +PPV++PPV +PP ++PPV +PPV +PPV +
Sbjct: 88  PPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 147

Query: 252 PPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 148 PPVDQPPVDEPPVDQPPVDEPPVDQPP 174

 Score =  119 bits (299), Expect = 8e-26
 Identities = 48/87 (55%), Positives = 72/87 (82%)
 Frame = +3

Query: 72  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYK 251
           P  + PP+  PP++ PPV +PPV++PPV +PPV++PPV +PP ++PPV +PPV +PPV +
Sbjct: 83  PKHDHPPIDHPPIDHPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDE 142

Query: 252 PPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 143 PPVDEPPVDQPPVDEPPVDQPPVDEPP 169

 Score =  118 bits (296), Expect = 2e-25
 Identities = 50/99 (50%), Positives = 74/99 (74%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +
Sbjct: 98  PPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDQPPVDE 157

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
           PP ++PPV +PPV +PP   P  + P    P    P  +
Sbjct: 158 PPVDQPPVDEPPVDQPPTDTPGTDTPGSGTPGSNTPDAH 196

 Score =  110 bits (275), Expect = 5e-23
 Identities = 46/84 (54%), Positives = 68/84 (80%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 100 VDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDQPPVDEPP 159

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKP 254
           V +PP ++PPV +PP   P    P
Sbjct: 160 VDQPPVDEPPVDQPPTDTPGTDTP 183

 Score =  105 bits (261), Expect = 2e-21
 Identities = 45/92 (48%), Positives = 67/92 (72%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PPV +PPV++PP
Sbjct: 105 VDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDEPPVDQPPVDEPPVDQPP 164

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVY 278
           V +PP ++PP   P    P    P    P  +
Sbjct: 165 VDEPPVDQPPTDTPGTDTPGSGTPGSNTPDAH 196

[39][TOP]
>UniRef100_Q6PZE9 Putative uncharacterized protein (Fragment) n=1 Tax=Brassica napus
           var. napus RepID=Q6PZE9_BRANA
          Length = 225

 Score =  130 bits (326), Expect = 6e-29
 Identities = 67/128 (52%), Positives = 78/128 (60%), Gaps = 18/128 (14%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKP 164
           +Y PPV  PPV +PP     PPV  PPV+KP  P Y PPV+ PPV KPP     PP+  P
Sbjct: 54  IYSPPVMPPPVQQPPTPSYSPPVKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPP 113

Query: 165 PVEKP--PVYKPPAEKPPVYKP--PVYKPPVYKPPVEKP--PVYKPPVEKPPV------Y 308
           PV+KP  P Y PP + PPV KP  P Y PPV  PPV+KP  P Y PP++ PPV      Y
Sbjct: 114 PVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVKPPTPIY 173

Query: 309 KPPVEKPP 332
            PPV+ PP
Sbjct: 174 SPPVKPPP 181

 Score =  129 bits (325), Expect = 8e-29
 Identities = 65/127 (51%), Positives = 78/127 (61%), Gaps = 18/127 (14%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKPP 167
           Y PPV+ PPV KPP     PPV  PPV+KPP   Y PP++ PPV KPP     PP+  PP
Sbjct: 72  YSPPVKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPP 131

Query: 168 VEKPPV--YKPPAEKPPVYKPPV--YKPPVYKPPVEKP-PVYKPPVEKPPV-------YK 311
           V+KPP   Y PP + PPV KPP   Y PP+  PPV+ P P+Y PPV+ PPV       Y 
Sbjct: 132 VQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVQKPPTPTYS 191

Query: 312 PPVEKPP 332
           PP++ PP
Sbjct: 192 PPIKPPP 198

 Score =  127 bits (319), Expect = 4e-28
 Identities = 65/127 (51%), Positives = 77/127 (60%), Gaps = 18/127 (14%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVE--KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVE--KPPVYKPPV 170
           Y PP++ PPV KPP     PPV  PPV+ P P+Y PPV  PPV +PP     PPV  PPV
Sbjct: 22  YSPPIKPPPVQKPPTPTYSPPVKPPPVKPPTPIYSPPVMPPPVQQPPTPSYSPPVKPPPV 81

Query: 171 EKP--PVYKPPAEKPPVYKP--PVYKPPVYKPPVEKP--PVYKPPVEKPPV-------YK 311
           +KP  P Y PP + PPV KP  P Y PP+  PPV+KP  P Y PP++ PPV       Y 
Sbjct: 82  QKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYS 141

Query: 312 PPVEKPP 332
           PPV+ PP
Sbjct: 142 PPVKPPP 148

 Score =  126 bits (317), Expect = 7e-28
 Identities = 67/125 (53%), Positives = 76/125 (60%), Gaps = 18/125 (14%)
 Frame = +3

Query: 12  PPVEKPPV--YKPPVEKPPV------YKPPVEKPPVYKPPVE--KPPVYKPPVEKP--PV 155
           PPV+KPP   Y PPV+ PPV      Y PPV  PPV +PP     PPV  PPV+KP  P 
Sbjct: 29  PPVQKPPTPTYSPPVKPPPVKPPTPIYSPPVMPPPVQQPPTPSYSPPVKPPPVQKPPTPT 88

Query: 156 YKPPVEKPPVYKPPAE--KPPVYKPPVYKP--PVYKPPVEKPPVYKPPVE--KPPVYKPP 317
           Y PPV+ PPV KPP     PP+  PPV KP  P Y PP++ PPV KPP     PPV  PP
Sbjct: 89  YSPPVKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPP 148

Query: 318 VEKPP 332
           V+KPP
Sbjct: 149 VQKPP 153

 Score =  125 bits (313), Expect = 2e-27
 Identities = 61/117 (52%), Positives = 73/117 (62%), Gaps = 8/117 (6%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKPP 167
           Y PP++ PPV KPP     PP+  PPV+KPP   Y PPV+ PPV KPP     PP+  PP
Sbjct: 106 YSPPIKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPP 165

Query: 168 VEKP-PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPP 332
           V+ P P+Y PP + PPV KPP    P Y PP++ PPV  P P   PPV  PPV+KPP
Sbjct: 166 VKPPTPIYSPPVKPPPVQKPPT---PTYSPPIKPPPVKPPTPTYSPPVKPPPVQKPP 219

 Score =  123 bits (309), Expect = 6e-27
 Identities = 65/124 (52%), Positives = 75/124 (60%), Gaps = 18/124 (14%)
 Frame = +3

Query: 15  PVEKPPV--YKPPVEKPPVYKPPVE--KPPVYKPPVEKP-PVYKPPVEKPPV-------Y 158
           PV+KPP   Y PP++ PPV KPP     PPV  PPV+ P P+Y PPV  PPV       Y
Sbjct: 13  PVQKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVKPPTPIYSPPVMPPPVQQPPTPSY 72

Query: 159 KPPVEKPPVYKPPAE--KPPVYKPPVYKP--PVYKPPVEKPPVYKPPVE--KPPVYKPPV 320
            PPV+ PPV KPP     PPV  PPV KP  P Y PP++ PPV KPP     PP+  PPV
Sbjct: 73  SPPVKPPPVQKPPTPTYSPPVKPPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPV 132

Query: 321 EKPP 332
           +KPP
Sbjct: 133 QKPP 136

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 51/96 (53%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVE--KPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           Y PPV+ PPV KPP     PP+  PPV+ P P+Y PPV+ PPV KPP    P Y PP++ 
Sbjct: 140 YSPPVKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVQKPPT---PTYSPPIKP 196

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKP 284
           PPV KPP    P Y PPV  PPV KPP    P Y P
Sbjct: 197 PPV-KPPT---PTYSPPVKPPPVQKPPT---PTYSP 225

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 34/64 (53%), Positives = 39/64 (60%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +Y PPV+ PPV KPP    P Y PP++ PPV KPP    P Y PPV+ PPV KPP    P
Sbjct: 172 IYSPPVKPPPVQKPPT---PTYSPPIKPPPV-KPPT---PTYSPPVKPPPVQKPPT---P 221

Query: 183 VYKP 194
            Y P
Sbjct: 222 TYSP 225

[40][TOP]
>UniRef100_O49201 Proline-rich protein n=1 Tax=Gossypium hirsutum RepID=O49201_GOSHI
          Length = 299

 Score =  130 bits (326), Expect = 6e-29
 Identities = 66/129 (51%), Positives = 84/129 (65%), Gaps = 19/129 (14%)
 Frame = +3

Query: 3   VYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPP 152
           VY PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP +KPP
Sbjct: 159 VYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPP 216

Query: 153 VYKPPVEKPPVYKPPAEKPPVYKPPVYK----PPVYKPPVEKPPVYKPPVE-----KPPV 305
           +Y+P   KPPVY PP ++ P  KPP+Y+    PP+Y+P   KPPVY PP E     KPPV
Sbjct: 217 MYEPKPPKPPVYTPPKKEKPEPKPPMYQPPNNPPIYEPKPPKPPVYAPPKEEKPKPKPPV 276

Query: 306 YKPPVEKPP 332
           Y  P  +PP
Sbjct: 277 YDAPAHEPP 285

 Score =  125 bits (315), Expect = 1e-27
 Identities = 65/134 (48%), Positives = 86/134 (64%), Gaps = 24/134 (17%)
 Frame = +3

Query: 3   VYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPP 122
           VY+PP +     KPP+Y PP +     KPPVY+PP +     +PPVY PP +     KPP
Sbjct: 114 VYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPRPPVYTPPKKEKPEPKPP 173

Query: 123 VYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVY----KPPVYKPPVEKPPVYKPPV 290
           VY+PP +KPP+Y+P   KPPVY PP ++ P  KPP+Y    KPP+Y+P   KPPVY PP 
Sbjct: 174 VYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPPKKPPMYEPKPPKPPVYTPPK 232

Query: 291 EKPPVYKPPVEKPP 332
           ++ P  KPP+ +PP
Sbjct: 233 KEKPEPKPPMYQPP 246

 Score =  124 bits (312), Expect = 3e-27
 Identities = 63/127 (49%), Positives = 80/127 (62%), Gaps = 17/127 (13%)
 Frame = +3

Query: 3   VYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE-----K 146
           V+KPP  KPP Y  KPPV +PP  + P  KPPVY PP +     KPP+Y+PP +     K
Sbjct: 37  VFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPPMYEPPKKEKPEPK 96

Query: 147 PPVYKPPVE-----KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
           PPVY PP +     KPPVY+PP ++ P  KPP+Y PP  + P  KPPVY+PP ++ P  +
Sbjct: 97  PPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPR 156

Query: 312 PPVEKPP 332
           PPV  PP
Sbjct: 157 PPVYTPP 163

 Score =  124 bits (312), Expect = 3e-27
 Identities = 64/128 (50%), Positives = 83/128 (64%), Gaps = 20/128 (15%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE----- 143
           KPPV +PP  + P  KPP+Y PP +     KPPVY+PP +     +PPVY PP +     
Sbjct: 111 KPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPRPPVYTPPKKEKPEP 170

Query: 144 KPPVYKPPVEKPPVYKPPAEKPPVYKPPVY-----KPPVYKPPVEKPPVYKPPVEKPPVY 308
           KPPVY+PP +KPP+Y+P   KPPVY PP       KPP+Y+PP +KPP+Y+P   KPPVY
Sbjct: 171 KPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPPMYEPKPPKPPVY 228

Query: 309 KPPVEKPP 332
            PP ++ P
Sbjct: 229 TPPKKEKP 236

 Score =  124 bits (310), Expect = 4e-27
 Identities = 67/140 (47%), Positives = 87/140 (62%), Gaps = 30/140 (21%)
 Frame = +3

Query: 3   VYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPP 122
           VY+PP +     KPPVY PP +     KPP+Y+PP +     KPPVY PP +     KPP
Sbjct: 54  VYEPPKKEKPEPKPPVYAPPKKEKHGPKPPMYEPPKKEKPEPKPPVYTPPKKEEPKPKPP 113

Query: 123 VYKPPVE-----KPPVYKPPVE-----KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPP 272
           VY+PP +     KPP+Y PP +     KPPVY+PP ++ P  +PPVY PP  + P  KPP
Sbjct: 114 VYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPRPPVYTPPKKEKPEPKPP 173

Query: 273 VYKPPVEKPPVYKPPVEKPP 332
           VY+PP +KPP+Y+P   KPP
Sbjct: 174 VYEPP-KKPPMYEPKPPKPP 192

 Score =  123 bits (308), Expect = 7e-27
 Identities = 66/133 (49%), Positives = 85/133 (63%), Gaps = 25/133 (18%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE----- 143
           KPPV  PP  + P  KPPVY+PP +     KPP+Y PP +     KPPVY+PP +     
Sbjct: 96  KPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEP 155

Query: 144 KPPVYKPPVE-----KPPVYKPPAEKPPVYKPPVYKPPVYKPPVE-----KPPVYKPPVE 293
           +PPVY PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +     KPP+Y+PP +
Sbjct: 156 RPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-K 213

Query: 294 KPPVYKPPVEKPP 332
           KPP+Y+P   KPP
Sbjct: 214 KPPMYEPKPPKPP 226

 Score =  120 bits (301), Expect = 5e-26
 Identities = 61/120 (50%), Positives = 76/120 (63%), Gaps = 12/120 (10%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPP 167
           KPP    PV+KPP  KPP Y  KPPV +PP  + P  KPPVY PP +     KPP+Y+PP
Sbjct: 32  KPPT---PVFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKPPMYEPP 88

Query: 168 VE-----KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +     KPPVY PP ++ P  KPPVY+PP  + P  KPP+Y PP ++ P  KPPV +PP
Sbjct: 89  KKEKPEPKPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPP 148

 Score =  112 bits (281), Expect = 1e-23
 Identities = 57/119 (47%), Positives = 75/119 (63%), Gaps = 10/119 (8%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPP 152
           +Y+P   KPPVY PP +     KPP+Y+PP +KPP+Y+P   KPPVY PP +     KPP
Sbjct: 183 MYEPKPPKPPVYTPPKKEKPEPKPPMYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPKPP 241

Query: 153 VYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           +Y+PP   PP+Y+P   KPPVY PP  + P  KPPV   P ++PP    P + PP+ KP
Sbjct: 242 MYQPP-NNPPIYEPKPPKPPVYAPPKEEKPKPKPPVYDAPAHEPPYGHYPGH-PPLGKP 298

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 36/71 (50%), Positives = 44/71 (61%), Gaps = 7/71 (9%)
 Frame = +3

Query: 141 EKPPVYKPPVEKPPVYKPPAEKPPVY--KPPVYKPPVYKPPVEKPPVYKPPVE-----KP 299
           E P   KPP    PV+KPP  KPP Y  KPPVY+PP  + P  KPPVY PP +     KP
Sbjct: 26  ESPNYGKPPT---PVFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKHGPKP 82

Query: 300 PVYKPPVEKPP 332
           P+Y+PP ++ P
Sbjct: 83  PMYEPPKKEKP 93

[41][TOP]
>UniRef100_O49870 Extensin (Fragment) n=1 Tax=Hordeum vulgare RepID=O49870_HORVU
          Length = 330

 Score =  129 bits (325), Expect = 8e-29
 Identities = 58/118 (49%), Positives = 64/118 (54%), Gaps = 11/118 (9%)
 Frame = +3

Query: 12  PPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           PP  KP  P YKPP   PP  KPP   PP YKPP   PP +KPP   PP +KP    PP 
Sbjct: 207 PPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKPATPTPPA 266

Query: 186 YKPPAEKPPVYKP----PVYKPPVYKPPVEKPP-----VYKPPVEKPPVYKPPVEKPP 332
           +KPP   PP +KP    P YKPP   PP +KPP      +KPP   PP YK P   PP
Sbjct: 267 HKPPTPTPPAHKPTTPTPAYKPPTPTPPADKPPTPTPLAHKPPTPTPPAYKAPTPSPP 324

 Score =  124 bits (311), Expect = 3e-27
 Identities = 61/127 (48%), Positives = 65/127 (51%), Gaps = 18/127 (14%)
 Frame = +3

Query: 6   YKP-PVEKPPVYKP--------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 158
           YKP P   PP YKP        P   PP YKPP   PP  KPP   PP YKPP   PP +
Sbjct: 188 YKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPPAQKPPTPTPPAYKPPTPTPPAH 247

Query: 159 KPPVEKPPVYKP-----PAEKPPVYKPPVYKP----PVYKPPVEKPPVYKPPVEKPPVYK 311
           KPP   PP +KP     PA KPP   PP +KP    P YKPP   PP  KPP   P  +K
Sbjct: 248 KPPTPTPPAHKPATPTPPAHKPPTPTPPAHKPTTPTPAYKPPTPTPPADKPPTPTPLAHK 307

Query: 312 PPVEKPP 332
           PP   PP
Sbjct: 308 PPTPTPP 314

 Score =  122 bits (305), Expect = 2e-26
 Identities = 61/124 (49%), Positives = 65/124 (52%), Gaps = 15/124 (12%)
 Frame = +3

Query: 6   YKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP--------PVEKPPVYKPPVEKPP 152
           YKP P   PP YKP P   PP YKP P   PP YKP        P   PP YKPP   PP
Sbjct: 166 YKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPYKPPTPTPP 225

Query: 153 VYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP----PV 320
             KPP   PP YKPP   PP +KPP   PP +KP    PP +KPP   PP +KP    P 
Sbjct: 226 AQKPPTPTPPAYKPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPPTPTPPAHKPTTPTPA 285

Query: 321 EKPP 332
            KPP
Sbjct: 286 YKPP 289

 Score =  111 bits (277), Expect = 3e-23
 Identities = 67/148 (45%), Positives = 68/148 (45%), Gaps = 39/148 (26%)
 Frame = +3

Query: 6   YKPPVE---KPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKP 164
           YKPP +    PP YKP P   PP YKP P   PP YKP P   PP YKP P   PP YKP
Sbjct: 98  YKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKP 157

Query: 165 -PVEKPPVYKP-PAEKPPVYK------PPVYK------------------------PPVY 248
            P   PP YKP P   PP YK      PP YK                        PP Y
Sbjct: 158 SPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPVPKPSPPAPKPTPPPY 217

Query: 249 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP   PP  KPP   PP YKPP   PP
Sbjct: 218 KPPTPTPPAQKPPTPTPPAYKPPTPTPP 245

 Score =  105 bits (261), Expect = 2e-21
 Identities = 63/124 (50%), Positives = 65/124 (52%), Gaps = 17/124 (13%)
 Frame = +3

Query: 12  PPVEKP------PVYKPPVEKPPVYKP-PVEKPPVYKPPVE---KPPVYKP-PVEKPPVY 158
           PP  KP      P+ KPP   PP Y P P   PP YKPP +    PP YKP P   PP Y
Sbjct: 63  PPAPKPAPPTYAPIPKPPKPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAY 122

Query: 159 KP-PVEKPPVYKP-PAEKPPVYKP-PVYKPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PV 320
           KP P   PP YKP P   PP YKP P   PP YKP P   PP YKP P   PP YKP P 
Sbjct: 123 KPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPK 182

Query: 321 EKPP 332
             PP
Sbjct: 183 VSPP 186

 Score =  103 bits (256), Expect = 8e-21
 Identities = 65/131 (49%), Positives = 66/131 (50%), Gaps = 23/131 (17%)
 Frame = +3

Query: 9   KPPVEKPPVYKP-PVEKPPVYKPPVE---KPPVYKP------PVEK------PPVYKP-P 137
           KPP   PP Y P P   PP YKPP +    PP YKP      P  K      PP YKP P
Sbjct: 78  KPPKPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAP 137

Query: 138 VEKPPVYKP-PVEKPPVYKP-PAEKPPVYKP-PVYKPPVYKP-PVEKPPVYKP-PVEKPP 302
              PP YKP P   PP YKP P   PP YKP P   PP YKP P   PP YKP P   PP
Sbjct: 138 KVSPPAYKPAPKVSPPAYKPSPKVSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPP 197

Query: 303 VYKP-PVEKPP 332
            YKP P   PP
Sbjct: 198 AYKPVPKPSPP 208

 Score =  102 bits (253), Expect = 2e-20
 Identities = 43/89 (48%), Positives = 48/89 (53%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKPP   PP +KPP   PP +KP    PP +KPP   PP +K P    P YKPP   PP 
Sbjct: 237 YKPPTPTPPAHKPPTPTPPAHKPATPTPPAHKPPTPTPPAHK-PTTPTPAYKPPTPTPPA 295

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPP 272
            KPP   P  +KPP   PP YK P   PP
Sbjct: 296 DKPPTPTPLAHKPPTPTPPAYKAPTPSPP 324

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 62/129 (48%), Positives = 66/129 (51%), Gaps = 21/129 (16%)
 Frame = +3

Query: 9   KPPV-EKPPVY----KPPV--EKPPVYKPPVEKPPVYKPPVEKP------PVYKPPVEKP 149
           KPP   KPP +    KPPV  + PP Y PP  KP    PP  KP      P+ KPP   P
Sbjct: 28  KPPKGHKPPHHHHHAKPPVGSQAPPTYSPPTAKPT---PPAPKPAPPTYAPIPKPPKPSP 84

Query: 150 PVYKP-PVEKPPVYKPPAE---KPPVYKP-PVYKPPVYKP-PVEKPPVYKP-PVEKPPVY 308
           P Y P P   PP YKPP +    PP YKP P   PP YKP P   PP YKP P   PP Y
Sbjct: 85  PAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVSPPAY 144

Query: 309 KP-PVEKPP 332
           KP P   PP
Sbjct: 145 KPAPKVSPP 153

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 56/122 (45%), Positives = 58/122 (47%), Gaps = 15/122 (12%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKP------PVYKPP 167
           P  EKPP    P       KPPV  + PP Y PP  KP    PP  KP      P+ KPP
Sbjct: 24  PKHEKPPKGHKPPHHHHHAKPPVGSQAPPTYSPPTAKPT---PPAPKPAPPTYAPIPKPP 80

Query: 168 VEKPPVYKP-PAEKPPVYKPPVY---KPPVYKP-PVEKPPVYKP-PVEKPPVYKP-PVEK 326
              PP Y P P   PP YKPP      PP YKP P   PP YKP P   PP YKP P   
Sbjct: 81  KPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPPAYKPAPKVS 140

Query: 327 PP 332
           PP
Sbjct: 141 PP 142

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/118 (40%), Positives = 52/118 (44%), Gaps = 26/118 (22%)
 Frame = +3

Query: 57  PPVYKPPVEKPPVYKPPVEKPPVY-----KPPV--EKPPVYKPPVEKP------------ 179
           PP   P    P   KPP    P +     KPPV  + PP Y PP  KP            
Sbjct: 14  PPSPTPISPAPKHEKPPKGHKPPHHHHHAKPPVGSQAPPTYSPPTAKPTPPAPKPAPPTY 73

Query: 180 -PVYKPPAEKPPVYKP-PVYKPPVYKPPVE---KPPVYKP-PVEKPPVYKP-PVEKPP 332
            P+ KPP   PP Y P P   PP YKPP +    PP YKP P   PP YKP P   PP
Sbjct: 74  APIPKPPKPSPPAYHPTPKPAPPTYKPPTQPKPSPPAYKPAPKVSPPAYKPAPKVSPP 131

[42][TOP]
>UniRef100_B5UN98 Cell surface protein n=1 Tax=Bacillus cereus AH1134
           RepID=B5UN98_BACCE
          Length = 814

 Score =  128 bits (321), Expect = 2e-28
 Identities = 67/109 (61%), Positives = 67/109 (61%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KP  EKP V KP  EKP V KP  EKP V KP  EKP V KP  EKP V KP  EKP 
Sbjct: 326 VEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPE 385

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V KP AEKP   KP   KP   KP VEKP V KP VEKP V KP VEKP
Sbjct: 386 VEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKPEVEKP 434

 Score =  122 bits (307), Expect = 1e-26
 Identities = 63/107 (58%), Positives = 64/107 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +P VEKP   KP VEKP   KP VEKP   KP VEKP   KP VEKP   KP VEKP   
Sbjct: 323 QPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAE 382

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           KP  EKP   KP   KP   KP  EKP V KP VEKP V KP VEKP
Sbjct: 383 KPEVEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKP 429

 Score =  122 bits (307), Expect = 1e-26
 Identities = 64/105 (60%), Positives = 64/105 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KP VEKP   KP VEKP   KP VEKP   KP VEKP   KP VEKP   KP VEKP   
Sbjct: 333 KPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAE 392

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           KP AEKP   KP   KP V KP VEKP V KP VEKP V KP  E
Sbjct: 393 KPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKPEVEKPEVEKPDAE 437

 Score =  118 bits (296), Expect = 2e-25
 Identities = 61/103 (59%), Positives = 63/103 (61%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           ++P V KP  EKP V KP  EKP V KP  EKP V KP  EKP V KP  EKP V KP A
Sbjct: 322 KQPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEAEKPEVEKPEA 381

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           EKP V KP   KP   KP  EKP   KP VEKP V KP VEKP
Sbjct: 382 EKPEVEKPEAEKPEAEKPEAEKPEAEKPEVEKPEVEKPEVEKP 424

[43][TOP]
>UniRef100_A1YL95 Proline-rich protein n=1 Tax=Gossypium hirsutum RepID=A1YL95_GOSHI
          Length = 258

 Score =  126 bits (316), Expect = 9e-28
 Identities = 69/140 (49%), Positives = 87/140 (62%), Gaps = 30/140 (21%)
 Frame = +3

Query: 3   VYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPP 122
           VY+PP +     KPPVY PP +     KPPVY+PP +     KPPVY PP +     KPP
Sbjct: 53  VYEPPKKEKPEPKPPVYAPPKKEKPGPKPPVYEPPKKEKPEPKPPVYTPPKKEEPKPKPP 112

Query: 123 VYKPPVE-----KPPVYKPPVE-----KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPP 272
           VY+PP +     KPP+Y PP +     KPPVY+PP ++ P  KPPVY PP  + P  KPP
Sbjct: 113 VYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPP 172

Query: 273 VYKPPVEKPPVYKPPVEKPP 332
           VY+PP +KPP+Y+P   KPP
Sbjct: 173 VYEPP-KKPPMYEPKPPKPP 191

 Score =  125 bits (314), Expect = 1e-27
 Identities = 64/126 (50%), Positives = 79/126 (62%), Gaps = 17/126 (13%)
 Frame = +3

Query: 6   YKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE-----KP 149
           +KPP  KPP Y  KPPV +PP  + P  KPPVY PP +     KPPVY+PP +     KP
Sbjct: 37  FKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKPGPKPPVYEPPKKEKPEPKP 96

Query: 150 PVYKPPVE-----KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           PVY PP +     KPPVY+PP ++ P  KPP+Y PP  + P  KPPVY+PP ++ P  KP
Sbjct: 97  PVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKP 156

Query: 315 PVEKPP 332
           PV  PP
Sbjct: 157 PVYTPP 162

 Score =  122 bits (305), Expect = 2e-26
 Identities = 65/134 (48%), Positives = 84/134 (62%), Gaps = 24/134 (17%)
 Frame = +3

Query: 3   VYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVEKPPVYKPP 137
           VY+PP +     KPPVY PP +     KPPVY+PP +     KPP+Y PP ++ P  KPP
Sbjct: 83  VYEPPKKEKPEPKPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPP 142

Query: 138 VEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVY----KPPVYKPPVEKPPVYKPPVEK--- 296
           V +PP  + P  KPPVY PP ++ P  KPPVY    KPP+Y+P   KPPVY PP ++   
Sbjct: 143 VYEPPKKEKPEPKPPVYTPPKKEKPEPKPPVYEPPKKPPMYEPKPPKPPVYTPPKKEKPE 202

Query: 297 --PPVYKPPVEKPP 332
             PP+Y+PP +KPP
Sbjct: 203 PIPPMYEPP-KKPP 215

 Score =  119 bits (298), Expect = 1e-25
 Identities = 61/120 (50%), Positives = 75/120 (62%), Gaps = 12/120 (10%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPP 167
           KPP    P +KPP  KPP Y  KPPV +PP  + P  KPPVY PP +     KPPVY+PP
Sbjct: 31  KPPT---PEFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKPGPKPPVYEPP 87

Query: 168 VE-----KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +     KPPVY PP ++ P  KPPVY+PP  + P  KPP+Y PP ++ P  KPPV +PP
Sbjct: 88  KKEKPEPKPPVYTPPKKEEPKPKPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPP 147

 Score =  119 bits (298), Expect = 1e-25
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 10/118 (8%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           KPPV +PP  + P  KPP+Y PP +     KPPVY+PP ++ P  KPPV  PP  + P  
Sbjct: 110 KPPVYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEP 169

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEK-----PPVYKPPVEKPPVYKPPVEKPP 332
           KPPVY+PP +KPP+Y+P   KPPVY PP ++     PP+Y+PP +KPP+ +P   KPP
Sbjct: 170 KPPVYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPIPPMYEPP-KKPPMCEPKPPKPP 225

 Score =  112 bits (281), Expect = 1e-23
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 20/125 (16%)
 Frame = +3

Query: 3   VYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPPVYKPPVE-----KPP 122
           VY+PP +     KPP+Y PP +     KPPVY+PP +     KPPVY PP +     KPP
Sbjct: 113 VYEPPKKEKPEPKPPIYTPPKKEKPEPKPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPP 172

Query: 123 VYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP 302
           VY+PP +KPP+Y+P   KPPVY PP ++ P   PP+Y+PP      +KPP+ +P   KPP
Sbjct: 173 VYEPP-KKPPMYEPKPPKPPVYTPPKKEKPEPIPPMYEPP------KKPPMCEPKPPKPP 225

Query: 303 VYKPP 317
           VY PP
Sbjct: 226 VYTPP 230

 Score =  102 bits (253), Expect = 2e-20
 Identities = 55/115 (47%), Positives = 74/115 (64%), Gaps = 13/115 (11%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           KPPV +PP  + P  KPPVY PP +     KPPVY+PP +KPP+Y+P   KPPVY PP +
Sbjct: 140 KPPVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPVYEPP-KKPPMYEPKPPKPPVYTPPKK 198

Query: 174 K-----PPVYKPPAEKPPVYKPPVYKPPVYKPP-VEKPPVYKPPVE--KPPVYKP 314
           +     PP+Y+PP +KPP+ +P   KPPVY PP  EK    +P +   +P +Y+P
Sbjct: 199 EKPEPIPPMYEPP-KKPPMCEPKPPKPPVYTPPKKEKSDPSQPCINLPQPTIYEP 252

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = +3

Query: 141 EKPPVYKPPVEKPPVYKPPAEKPPVY--KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           E P   KPP    P +KPP  KPP Y  KPPVY+PP  + P  KPPVY PP ++ P  KP
Sbjct: 25  ESPNYGKPPT---PEFKPPKVKPPPYEPKPPVYEPPKKEKPEPKPPVYAPPKKEKPGPKP 81

Query: 315 PVEKPP 332
           PV +PP
Sbjct: 82  PVYEPP 87

[44][TOP]
>UniRef100_A9VJK7 NEAr transporter n=1 Tax=Bacillus weihenstephanensis KBAB4
           RepID=A9VJK7_BACWK
          Length = 1147

 Score =  125 bits (315), Expect = 1e-27
 Identities = 67/101 (66%), Positives = 67/101 (66%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           EKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP  
Sbjct: 459 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEV 518

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           EKP V KP V KP V KP VEKP V KP VEKP V  P  E
Sbjct: 519 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENPDAE 559

 Score =  125 bits (313), Expect = 2e-27
 Identities = 66/97 (68%), Positives = 66/97 (68%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V 
Sbjct: 460 KPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVE 519

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP 299
           KP  EKP V KP V KP V KP VEKP V KP VE P
Sbjct: 520 KPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENP 556

 Score =  125 bits (313), Expect = 2e-27
 Identities = 66/97 (68%), Positives = 66/97 (68%)
 Frame = +3

Query: 39  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVY 218
           KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP  EKP V 
Sbjct: 460 KPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVE 519

Query: 219 KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           KP V KP V KP VEKP V KP VEKP V KP VE P
Sbjct: 520 KPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENP 556

 Score =  121 bits (303), Expect = 3e-26
 Identities = 64/93 (68%), Positives = 64/93 (68%)
 Frame = +3

Query: 51  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPV 230
           EKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP  EKP V KP V
Sbjct: 459 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEV 518

Query: 231 YKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            KP V KP VEKP V KP VEKP V KP VEKP
Sbjct: 519 EKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKP 551

 Score =  119 bits (299), Expect = 8e-26
 Identities = 64/97 (65%), Positives = 64/97 (65%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP V KP VEKP 
Sbjct: 463 VEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVEKPE 522

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVE 293
           V KP  EKP V KP V KP V KP VEKP V  P  E
Sbjct: 523 VEKPEVEKPEVEKPEVEKPEVEKPEVEKPEVENPDAE 559

[45][TOP]
>UniRef100_UPI0000E49E3C PREDICTED: hypothetical protein n=1 Tax=Strongylocentrotus
           purpuratus RepID=UPI0000E49E3C
          Length = 1082

 Score =  121 bits (304), Expect = 2e-26
 Identities = 45/108 (41%), Positives = 68/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ 
Sbjct: 652 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPIT 711

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP
Sbjct: 712 QPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPP 759

 Score =  120 bits (301), Expect = 5e-26
 Identities = 45/108 (41%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  
Sbjct: 657 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPST 716

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP
Sbjct: 717 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPP 764

 Score =  120 bits (301), Expect = 5e-26
 Identities = 45/108 (41%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  
Sbjct: 662 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTT 721

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP
Sbjct: 722 QPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPP 769

 Score =  120 bits (301), Expect = 5e-26
 Identities = 45/108 (41%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  
Sbjct: 667 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTT 726

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP
Sbjct: 727 QPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPP 774

 Score =  119 bits (297), Expect = 1e-25
 Identities = 45/108 (41%), Positives = 67/108 (62%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  
Sbjct: 507 QPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTT 566

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP+ KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 567 QPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPP 614

 Score =  118 bits (295), Expect = 2e-25
 Identities = 45/108 (41%), Positives = 66/108 (61%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  
Sbjct: 517 QPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTT 576

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 577 QPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPP 624

 Score =  117 bits (294), Expect = 3e-25
 Identities = 45/108 (41%), Positives = 66/108 (61%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ 
Sbjct: 497 QPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMT 556

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 557 HPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPP 604

 Score =  117 bits (294), Expect = 3e-25
 Identities = 45/108 (41%), Positives = 66/108 (61%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  
Sbjct: 512 EPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPST 571

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 572 KPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPP 619

 Score =  117 bits (293), Expect = 4e-25
 Identities = 45/108 (41%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 472 QPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTT 531

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP+ +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP
Sbjct: 532 QPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPP 579

 Score =  117 bits (292), Expect = 5e-25
 Identities = 45/107 (42%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 488 PPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQ 547

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP
Sbjct: 548 PPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPP 594

 Score =  117 bits (292), Expect = 5e-25
 Identities = 45/108 (41%), Positives = 66/108 (61%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  
Sbjct: 502 QPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTA 561

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 562 QPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPP 609

 Score =  117 bits (292), Expect = 5e-25
 Identities = 43/108 (39%), Positives = 66/108 (61%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 637 QPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 696

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 697 QPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 744

 Score =  117 bits (292), Expect = 5e-25
 Identities = 43/108 (39%), Positives = 66/108 (61%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 642 QPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 701

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 702 QPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 749

 Score =  116 bits (291), Expect = 7e-25
 Identities = 45/107 (42%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 493 PPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQ 552

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP
Sbjct: 553 PPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPP 599

 Score =  116 bits (290), Expect = 9e-25
 Identities = 43/108 (39%), Positives = 66/108 (61%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 632 QPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 691

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 692 QPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPP 739

 Score =  116 bits (290), Expect = 9e-25
 Identities = 44/108 (40%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 647 RQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 706

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP
Sbjct: 707 QPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPP 754

 Score =  116 bits (290), Expect = 9e-25
 Identities = 44/108 (40%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  
Sbjct: 672 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTT 731

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP    P
Sbjct: 732 QPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPPTTPVP 779

 Score =  115 bits (289), Expect = 1e-24
 Identities = 45/108 (41%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 482 QPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTT 541

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP
Sbjct: 542 QPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPP 589

 Score =  115 bits (288), Expect = 2e-24
 Identities = 45/108 (41%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 477 QPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPST 536

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP
Sbjct: 537 QPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPP 584

 Score =  115 bits (288), Expect = 2e-24
 Identities = 44/108 (40%), Positives = 66/108 (61%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  
Sbjct: 537 QPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTT 596

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP+ +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP
Sbjct: 597 QPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPP 644

 Score =  114 bits (286), Expect = 3e-24
 Identities = 44/108 (40%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 462 QPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTT 521

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP
Sbjct: 522 QPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPP 569

 Score =  114 bits (286), Expect = 3e-24
 Identities = 45/108 (41%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 467 QPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTT 526

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP
Sbjct: 527 QPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPP 574

 Score =  114 bits (285), Expect = 3e-24
 Identities = 44/108 (40%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  
Sbjct: 522 QPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTT 581

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P
Sbjct: 582 QPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLP 629

 Score =  114 bits (285), Expect = 3e-24
 Identities = 44/108 (40%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  
Sbjct: 527 QPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTT 586

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP
Sbjct: 587 QPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPP 634

 Score =  114 bits (284), Expect = 4e-24
 Identities = 44/108 (40%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  
Sbjct: 452 QPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPST 511

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP
Sbjct: 512 EPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPP 559

 Score =  114 bits (284), Expect = 4e-24
 Identities = 43/108 (39%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  
Sbjct: 572 KPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTT 631

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP+ +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 632 QPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 679

 Score =  113 bits (283), Expect = 6e-24
 Identities = 44/108 (40%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  
Sbjct: 532 QPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTT 591

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP
Sbjct: 592 QPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPP 639

 Score =  113 bits (282), Expect = 8e-24
 Identities = 44/107 (41%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +
Sbjct: 443 PPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQ 502

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PPA +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 503 PPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPP 549

 Score =  113 bits (282), Expect = 8e-24
 Identities = 44/108 (40%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  
Sbjct: 457 QPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTM 516

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+  PP  +PP
Sbjct: 517 QPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPMTHPPTAQPP 564

 Score =  113 bits (282), Expect = 8e-24
 Identities = 42/108 (38%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  
Sbjct: 607 QPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTT 666

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP
Sbjct: 667 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPP 714

 Score =  113 bits (282), Expect = 8e-24
 Identities = 42/106 (39%), Positives = 64/106 (60%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P
Sbjct: 629 PTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQP 688

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP
Sbjct: 689 PTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPP 734

 Score =  112 bits (281), Expect = 1e-23
 Identities = 42/108 (38%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  
Sbjct: 612 RPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTT 671

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP
Sbjct: 672 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPP 719

 Score =  112 bits (280), Expect = 1e-23
 Identities = 43/108 (39%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 332 QPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTT 391

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +P   + P  +PP  +PP  +PP  +PP  +PP
Sbjct: 392 QPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPP 439

 Score =  112 bits (280), Expect = 1e-23
 Identities = 42/108 (38%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  
Sbjct: 617 QPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTT 676

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP
Sbjct: 677 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPP 724

 Score =  112 bits (280), Expect = 1e-23
 Identities = 42/108 (38%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 622 QPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTT 681

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP
Sbjct: 682 QPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPP 729

 Score =  112 bits (279), Expect = 2e-23
 Identities = 44/108 (40%), Positives = 63/108 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ 
Sbjct: 207 QPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPIT 266

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP
Sbjct: 267 KPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPP 314

 Score =  112 bits (279), Expect = 2e-23
 Identities = 43/108 (39%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 562 QPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTT 621

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP
Sbjct: 622 QPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPP 669

 Score =  112 bits (279), Expect = 2e-23
 Identities = 43/108 (39%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 567 QPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTT 626

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           + P  +PP  +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP
Sbjct: 627 QLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPP 674

 Score =  112 bits (279), Expect = 2e-23
 Identities = 42/108 (38%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  
Sbjct: 602 QPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTT 661

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 662 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 709

 Score =  111 bits (278), Expect = 2e-23
 Identities = 43/106 (40%), Positives = 63/106 (59%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +P
Sbjct: 449 PTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQP 508

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 509 PSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPP 554

 Score =  111 bits (278), Expect = 2e-23
 Identities = 43/108 (39%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 542 QPPTTQPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPST 601

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P
Sbjct: 602 QPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQP 649

 Score =  111 bits (278), Expect = 2e-23
 Identities = 43/108 (39%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 552 QPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYT 611

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP
Sbjct: 612 RPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPP 659

 Score =  111 bits (278), Expect = 2e-23
 Identities = 43/107 (40%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 558 PPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQ 617

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  +PP  + P  +PP  +PP  +PP  + P  +PP  +PP  +PP
Sbjct: 618 PPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTTQPPTTQPP 664

 Score =  111 bits (278), Expect = 2e-23
 Identities = 43/107 (40%), Positives = 63/107 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  
Sbjct: 677 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTT 736

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP    P   P
Sbjct: 737 QPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPPTTPVPCLHP 783

 Score =  111 bits (277), Expect = 3e-23
 Identities = 43/108 (39%), Positives = 63/108 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 337 QPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTT 396

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +P   + P  +PP  +PP  +PP  +PP  +PP   PP
Sbjct: 397 QPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPP 444

 Score =  111 bits (277), Expect = 3e-23
 Identities = 43/108 (39%), Positives = 63/108 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 422 QPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTI 481

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP+  PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 482 QPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPP 529

 Score =  111 bits (277), Expect = 3e-23
 Identities = 43/108 (39%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP+  PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 547 QPPTTQPPMTHPPTAQPPTTQPPSTKPPTTQPPTTQPPTTQPPTTQPPTTQPPSTQPPTT 606

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP
Sbjct: 607 QPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPP 654

 Score =  111 bits (277), Expect = 3e-23
 Identities = 42/108 (38%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  
Sbjct: 577 QPPTTQPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPST 636

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 637 QPPTTQPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 684

 Score =  111 bits (277), Expect = 3e-23
 Identities = 42/108 (38%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  
Sbjct: 582 QPPTTQPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTT 641

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 642 QPPTTRQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 689

 Score =  111 bits (277), Expect = 3e-23
 Identities = 42/108 (38%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  
Sbjct: 587 QPPTTQPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTT 646

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 647 RQPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 694

 Score =  111 bits (277), Expect = 3e-23
 Identities = 42/108 (38%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  
Sbjct: 592 QPPTTQPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTT 651

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 652 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 699

 Score =  111 bits (277), Expect = 3e-23
 Identities = 42/108 (38%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  + P  +PP  +PP  +PP  + P  +PP  
Sbjct: 597 QPPSTQPPTTQPPYTRPPTTQPPTTQPPTTQLPTTQPPSTQPPTTQPPTTRQPTTQPPTT 656

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 657 QPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPP 704

 Score =  110 bits (276), Expect = 4e-23
 Identities = 44/108 (40%), Positives = 63/108 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  
Sbjct: 197 QPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTT 256

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP
Sbjct: 257 QPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPP 304

 Score =  110 bits (275), Expect = 5e-23
 Identities = 44/107 (41%), Positives = 62/107 (57%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP  
Sbjct: 212 QPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTS 271

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
             P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP
Sbjct: 272 HLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKP 318

 Score =  110 bits (274), Expect = 6e-23
 Identities = 43/107 (40%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP  +
Sbjct: 283 PPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQ 342

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP+ +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP
Sbjct: 343 PPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPP 389

 Score =  110 bits (274), Expect = 6e-23
 Identities = 43/105 (40%), Positives = 62/105 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 682 QPPTTQPPTTQPPTTQPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTT 741

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           +PP  +PP  KPP  +PP  +PP  +PP  +PP    P   P VE
Sbjct: 742 QPPTTQPPSTKPPTTQPPTTQPPTTQPPTAQPPTTPVPCLHPGVE 786

 Score =  109 bits (273), Expect = 8e-23
 Identities = 43/108 (39%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  
Sbjct: 162 QPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPST 221

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP
Sbjct: 222 QPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPP 269

 Score =  109 bits (273), Expect = 8e-23
 Identities = 43/108 (39%), Positives = 63/108 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP  
Sbjct: 287 QPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPST 346

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 347 QPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPP 394

 Score =  109 bits (273), Expect = 8e-23
 Identities = 43/108 (39%), Positives = 63/108 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP  +PP  +PP  
Sbjct: 297 QPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTT 356

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 357 QPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPP 404

 Score =  109 bits (273), Expect = 8e-23
 Identities = 43/108 (39%), Positives = 62/108 (57%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  
Sbjct: 417 QPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTT 476

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 477 QPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPP 524

 Score =  109 bits (273), Expect = 8e-23
 Identities = 43/108 (39%), Positives = 62/108 (57%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 427 QPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPST 486

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 487 SPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPP 534

 Score =  109 bits (273), Expect = 8e-23
 Identities = 43/108 (39%), Positives = 62/108 (57%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  
Sbjct: 432 QPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTT 491

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 492 HPPTPQPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPP 539

 Score =  109 bits (272), Expect = 1e-22
 Identities = 44/108 (40%), Positives = 62/108 (57%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  
Sbjct: 202 QPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTT 261

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP
Sbjct: 262 RPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPP 309

 Score =  109 bits (272), Expect = 1e-22
 Identities = 43/108 (39%), Positives = 63/108 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP  +PP  
Sbjct: 292 QPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTT 351

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 352 QPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPP 399

 Score =  108 bits (271), Expect = 1e-22
 Identities = 43/108 (39%), Positives = 63/108 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 112 QPPTTQPPTTQPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTT 171

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP
Sbjct: 172 QPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPP 219

 Score =  108 bits (271), Expect = 1e-22
 Identities = 43/107 (40%), Positives = 62/107 (57%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  
Sbjct: 217 QPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTT 276

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           +PP+  PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P
Sbjct: 277 QPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQP 323

 Score =  108 bits (271), Expect = 1e-22
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 347 QPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTT 406

Query: 189 KP-----PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +P     P  +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP
Sbjct: 407 QPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPP 459

 Score =  108 bits (271), Expect = 1e-22
 Identities = 43/108 (39%), Positives = 62/108 (57%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  
Sbjct: 437 QPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTP 496

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 497 QPPTTQPPATQPPSTEPPTMQPPTTQPPTTQPPTTQPPSTQPPTTQPP 544

 Score =  108 bits (270), Expect = 2e-22
 Identities = 42/108 (38%), Positives = 65/108 (60%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P   +PP  + P  +PP  
Sbjct: 142 QPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTT 201

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 202 QPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPP 249

 Score =  108 bits (270), Expect = 2e-22
 Identities = 43/108 (39%), Positives = 62/108 (57%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  
Sbjct: 277 QPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTT 336

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP
Sbjct: 337 QPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPP 384

 Score =  108 bits (269), Expect = 2e-22
 Identities = 43/108 (39%), Positives = 63/108 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 117 QPPTTQPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTT 176

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 177 QPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPP 224

 Score =  108 bits (269), Expect = 2e-22
 Identities = 43/108 (39%), Positives = 63/108 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 122 QPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTT 181

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 182 QPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPP 229

 Score =  108 bits (269), Expect = 2e-22
 Identities = 42/108 (38%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  
Sbjct: 157 QPPTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTT 216

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP+ +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP
Sbjct: 217 QPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPP 264

 Score =  108 bits (269), Expect = 2e-22
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 342 QPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTT 401

Query: 189 KPPAEKP-----PVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +P     P  +PP  +PP  +PP  +PP  +PP   PP  + P  +PP
Sbjct: 402 QPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPP 454

 Score =  108 bits (269), Expect = 2e-22
 Identities = 44/113 (38%), Positives = 64/113 (56%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVE 173
           +PP  KPP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P     P  
Sbjct: 357 QPPTTKPPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTT 416

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP
Sbjct: 417 QPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPP 469

 Score =  107 bits (268), Expect = 3e-22
 Identities = 43/108 (39%), Positives = 61/108 (56%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  
Sbjct: 257 QPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPST 316

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KP   +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP
Sbjct: 317 KPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPP 364

 Score =  107 bits (268), Expect = 3e-22
 Identities = 42/106 (39%), Positives = 62/106 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  K
Sbjct: 303 PPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTK 362

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P
Sbjct: 363 PPSTQPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQP 408

 Score =  107 bits (267), Expect = 4e-22
 Identities = 43/108 (39%), Positives = 63/108 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P   
Sbjct: 127 KPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPHTT 186

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 187 QPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPP 234

 Score =  107 bits (267), Expect = 4e-22
 Identities = 43/106 (40%), Positives = 61/106 (57%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   P
Sbjct: 194 PSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYP 253

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP
Sbjct: 254 PTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPP 299

 Score =  107 bits (267), Expect = 4e-22
 Identities = 42/106 (39%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P  +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +P
Sbjct: 414 PTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQP 473

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 474 PTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPPTMQPP 519

 Score =  107 bits (266), Expect = 5e-22
 Identities = 42/107 (39%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P   +PP  + P  +
Sbjct: 138 PPTTQPPTTQPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQ 197

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 198 PPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPP 244

 Score =  107 bits (266), Expect = 5e-22
 Identities = 42/108 (38%), Positives = 64/108 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  
Sbjct: 147 QPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPST 206

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP
Sbjct: 207 QPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPP 254

 Score =  107 bits (266), Expect = 5e-22
 Identities = 46/122 (37%), Positives = 64/122 (52%), Gaps = 15/122 (12%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +
Sbjct: 253 PPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQ 312

Query: 192 PPAEK---------------PPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           PP+ K               PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +
Sbjct: 313 PPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQ 372

Query: 327 PP 332
           PP
Sbjct: 373 PP 374

 Score =  107 bits (266), Expect = 5e-22
 Identities = 43/113 (38%), Positives = 65/113 (57%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP  
Sbjct: 322 QPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTTRPPTT 381

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPP 332
           +PP+ +PP  +PP  +PP  +PP  +P     P  +PP  +PP  +PP  +PP
Sbjct: 382 QPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPP 434

 Score =  106 bits (265), Expect = 7e-22
 Identities = 42/108 (38%), Positives = 63/108 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 167 QPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTT 226

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP+ +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P
Sbjct: 227 QPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLP 274

 Score =  106 bits (265), Expect = 7e-22
 Identities = 43/108 (39%), Positives = 62/108 (57%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 187 QPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTTQPPTT 246

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP
Sbjct: 247 QPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPP 294

 Score =  106 bits (265), Expect = 7e-22
 Identities = 43/113 (38%), Positives = 64/113 (56%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVE 173
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P     P  +PP  +PP  
Sbjct: 367 QPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTT 426

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP
Sbjct: 427 QPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPP 479

 Score =  106 bits (264), Expect = 9e-22
 Identities = 43/108 (39%), Positives = 61/108 (56%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP+ KPP    P  +PP   PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   
Sbjct: 262 RPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTT 321

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP
Sbjct: 322 QPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPP 369

 Score =  105 bits (263), Expect = 1e-21
 Identities = 42/106 (39%), Positives = 61/106 (57%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P  +PP  +PP  +PP  KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP  +P
Sbjct: 109 PTTQPPTTQPPTTQPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPTTQP 168

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P  +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP
Sbjct: 169 PTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPP 214

 Score =  105 bits (263), Expect = 1e-21
 Identities = 43/113 (38%), Positives = 63/113 (55%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVE 173
           +PP  +PP  +PP  +PP  +PP  +PP  +P     P  +PP  +PP  +PP  +PP  
Sbjct: 377 RPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTT 436

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP   PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP
Sbjct: 437 QPPTAWPPTTQTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPP 489

 Score =  105 bits (262), Expect = 2e-21
 Identities = 43/113 (38%), Positives = 62/113 (54%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           +PP  +PP  +PP  +PP  +P     P  +PP  +PP  +PP  +PP  +PP   PP  
Sbjct: 387 QPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTT 446

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP
Sbjct: 447 QTPTTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPP 499

 Score =  105 bits (262), Expect = 2e-21
 Identities = 43/113 (38%), Positives = 62/113 (54%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKP-----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           +PP  +PP  +P     P  +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  
Sbjct: 397 QPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTT 456

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP   PP   PP  +PP  +PP  +PP
Sbjct: 457 QPPSTQPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPP 509

 Score =  105 bits (262), Expect = 2e-21
 Identities = 43/113 (38%), Positives = 63/113 (55%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           +PP  +P     P  +PP  +PP  +PP  +PP  +PP   PP  + P  +PP  +PP  
Sbjct: 402 QPPTTQPRTTQTPTTQPPTTQPPTTQPPTTQPPTTQPPTAWPPTTQTPTTQPPTTQPPST 461

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP+ +PP  +PP  +PP   PP   PP  +PP  +PP  +PP  +PP
Sbjct: 462 QPPTTQPPSTQPPTTQPPTIQPPSTSPPTTHPPTPQPPTTQPPATQPPSTEPP 514

 Score =  105 bits (261), Expect = 2e-21
 Identities = 42/108 (38%), Positives = 62/108 (57%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 172 QPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPST 231

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP
Sbjct: 232 QPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPP 279

 Score =  104 bits (260), Expect = 3e-21
 Identities = 42/108 (38%), Positives = 60/108 (55%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  
Sbjct: 232 QPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTT 291

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP  +PP
Sbjct: 292 QPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPP 339

 Score =  104 bits (260), Expect = 3e-21
 Identities = 42/108 (38%), Positives = 59/108 (54%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP  +PP  
Sbjct: 237 QPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPPTTQPPTT 296

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP   PP  +PP  +PP  KP   +P   +P   +PP  +PP  +PP
Sbjct: 297 QPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPP 344

 Score =  104 bits (260), Expect = 3e-21
 Identities = 43/113 (38%), Positives = 63/113 (55%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KP   +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  
Sbjct: 317 KPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPSTQPPTTQPPTT 376

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKP-----PVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +P     P  +PP  +PP  +PP
Sbjct: 377 RPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPPTTQPPTTQPP 429

 Score =  104 bits (259), Expect = 4e-21
 Identities = 42/107 (39%), Positives = 60/107 (56%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP  
Sbjct: 222 QPPTTQPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPST 281

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            PP  +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P
Sbjct: 282 LPPTTQPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQP 328

 Score =  104 bits (259), Expect = 4e-21
 Identities = 42/108 (38%), Positives = 60/108 (55%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  
Sbjct: 227 QPPSTQPPTTQPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTT 286

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP+  PP  +PP  +PP  KP   +P   +P   +PP
Sbjct: 287 QPPTTQPPTTQPPMTHPPTTQPPTTQPPSTKPSTTQPLTTQPATTQPP 334

 Score =  103 bits (258), Expect = 5e-21
 Identities = 43/113 (38%), Positives = 63/113 (55%), Gaps = 5/113 (4%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  KP   +P   +P   +PP  +PP  +PP  +PP  +PP  +PP  KPP  
Sbjct: 307 QPPTTQPPSTKPSTTQPLTTQPATTQPPTTQPPTSQPPSTQPPTTQPPTTQPPTTKPPST 366

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PVEKPP 332
           +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +P     P  +PP
Sbjct: 367 QPPTTQPPTTRPPTTQPPSTQPPTTQPPTTQPPTTQPPTTQPRTTQTPTTQPP 419

 Score =  103 bits (257), Expect = 6e-21
 Identities = 42/108 (38%), Positives = 61/108 (56%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 177 QPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTT 236

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP
Sbjct: 237 QPPTTQPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPP 284

 Score =  103 bits (256), Expect = 8e-21
 Identities = 42/108 (38%), Positives = 61/108 (56%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +P   +PP  + P  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  
Sbjct: 182 QPHTTQPPTTQLPSTQPPTTQPPSTQPPSTQPPTTQPPSTQPPTTQPPSTQPPTTQPPTT 241

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP   PP  +PP  +PP+ KPP    P  +PP   PP  +PP
Sbjct: 242 QPPTTQPPFTYPPTTQPPTTRPPITKPPTSHLPTTQPPSTLPPTTQPP 289

 Score =  101 bits (252), Expect = 2e-20
 Identities = 40/104 (38%), Positives = 59/104 (56%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           +  P  +PP  +PP  +PP  KPP  +PP   PP  +PP  +PP  +PP  +PP  +PP 
Sbjct: 106 DSEPTTQPPTTQPPTTQPPTTKPPTTQPPTAWPPTTQPPTTQPPTTQPPSTQPPTTQPPT 165

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +PP  +PP  +PP  +P   +PP  + P  +PP  +PP  +PP
Sbjct: 166 TQPPTTQPPTTQPPTTQPHTTQPPTTQLPSTQPPTTQPPSTQPP 209

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 38/100 (38%), Positives = 55/100 (55%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  +PP  +PP+ +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  
Sbjct: 697 QPPTTQPPTTQPPITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTT 756

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
           +PP  +PP  +PP  +PP    P   P V       P +Y
Sbjct: 757 QPPTTQPPTTQPPTAQPPTTPVPCLHPGVEVCGTSLPGLY 796

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 30/76 (39%), Positives = 43/76 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  KPP  +PP  +PP  +PP
Sbjct: 710 ITQPPSTQPPTTQPPTTQPPTTQPPTTQPPTTQPPTTQPPSTKPPTTQPPTTQPPTTQPP 769

Query: 183 VYKPPAEKPPVYKPPV 230
             +PP    P   P V
Sbjct: 770 TAQPPTTPVPCLHPGV 785

[46][TOP]
>UniRef100_Q9LZJ7 Proline-rich protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9LZJ7_ARATH
          Length = 313

 Score =  121 bits (304), Expect = 2e-26
 Identities = 67/119 (56%), Positives = 69/119 (57%), Gaps = 13/119 (10%)
 Frame = +3

Query: 12  PPVEKPPVYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPP 167
           PPV K P +KP    PV  PPVYKP +  PPVY  P   PPVY PPV K    PPVY  P
Sbjct: 30  PPVYKSPEHKPTLPSPVYTPPVYKPTL-SPPVYTKPTIPPPVYTPPVYKHTPSPPVYTKP 88

Query: 168 VEKPPVYKPPAEK----PPVYKPPVYKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKP 329
              PPVY PP  K    PPVY  P   PPVY PPV KP PVY  P   PPVY PPV KP
Sbjct: 89  TIPPPVYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKPTPVYTKPTIPPPVYTPPVYKP 147

 Score =  117 bits (293), Expect = 4e-25
 Identities = 68/125 (54%), Positives = 69/125 (55%), Gaps = 15/125 (12%)
 Frame = +3

Query: 3   VYKPPVEKP----PVYKPPVEKPPVYKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVY 158
           VY PPV KP    PVY  P   PPVY PPV K    PPVY  P   PPVY PPV KP + 
Sbjct: 46  VYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTL- 104

Query: 159 KPPVEKPPVYKPPAEKPPVYKPPVYKP-PVYKPPVEKPPVYKPPVEK----PPVYK--PP 317
                 PPVY  P   PPVY PPVYKP PVY  P   PPVY PPV K    PPVYK  P 
Sbjct: 105 -----SPPVYTKPTIPPPVYTPPVYKPTPVYTKPTIPPPVYTPPVYKPTPSPPVYKKSPS 159

Query: 318 VEKPP 332
              PP
Sbjct: 160 YSSPP 164

 Score =  111 bits (277), Expect = 3e-23
 Identities = 64/123 (52%), Positives = 65/123 (52%), Gaps = 14/123 (11%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEK----PPVYKPPVEKPPVYKPPVEKP----PVYKPPVEKPPVY 158
           VY  P   PPVY PPV K    PPVY  P   PPVY PPV KP    PVY  P   PPVY
Sbjct: 60  VYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTLSPPVYTKPTIPPPVY 119

Query: 159 KPPVEKP-PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PV 320
            PPV KP PVY  P   PPVY PPVYKP    P  +K P Y  P   PP Y P     P 
Sbjct: 120 TPPVYKPTPVYTKPTIPPPVYTPPVYKPTPSPPVYKKSPSYSSP---PPPYVPKPTYTPT 176

Query: 321 EKP 329
            KP
Sbjct: 177 TKP 179

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 32/57 (56%), Positives = 34/57 (59%)
 Frame = +3

Query: 156 YKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           Y P    PPVYK P  KP +   PVY PPVYKP +  PPVY  P   PPVY PPV K
Sbjct: 25  YSP--SSPPVYKSPEHKPTL-PSPVYTPPVYKPTL-SPPVYTKPTIPPPVYTPPVYK 77

[47][TOP]
>UniRef100_B9RUF0 Extensin, proline-rich protein, putative n=1 Tax=Ricinus communis
           RepID=B9RUF0_RICCO
          Length = 234

 Score =  121 bits (304), Expect = 2e-26
 Identities = 64/114 (56%), Positives = 66/114 (57%), Gaps = 4/114 (3%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPP-VEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           V KP    PPVYKPP     PV KPP    PPV KPP   PPVYKPP    PV KPP   
Sbjct: 49  VVKPTPTTPPVYKPPATPTTPVVKPPTSPAPPVVKPPTPSPPVYKPPT--TPVIKPPNAP 106

Query: 177 PPVYKPP-AEKPPVYKPPVYKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKPP 332
            PV KPP    PPV KPP Y PPV KPP   PPV KPP    PP++KPP   PP
Sbjct: 107 SPVVKPPTVPAPPVVKPPTYSPPVAKPPTPAPPVVKPPSTPAPPMFKPPTPLPP 160

 Score =  110 bits (275), Expect = 5e-23
 Identities = 62/114 (54%), Positives = 65/114 (57%), Gaps = 4/114 (3%)
 Frame = +3

Query: 3   VYKPPVEKP-PVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VE 173
           VYKPP     PV KPP    PPV KPP   PPVYKPP    PV KPP    PV KPP V 
Sbjct: 59  VYKPPATPTTPVVKPPTSPAPPVVKPPTPSPPVYKPPTT--PVIKPPNAPSPVVKPPTVP 116

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPP 332
            PPV KPP   PPV KPP   PPV KPP    PP++KPP   PP    P+  PP
Sbjct: 117 APPVVKPPTYSPPVAKPPTPAPPVVKPPSTPAPPMFKPPTPLPPPSGTPL--PP 168

[48][TOP]
>UniRef100_Q25434 Adhesive plaque matrix protein n=1 Tax=Mytilus coruscus
           RepID=FP1_MYTCO
          Length = 872

 Score =  120 bits (301), Expect = 5e-26
 Identities = 56/129 (43%), Positives = 63/129 (48%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YKP    PP YKP +  PP YKP    PP YKP +  PP 
Sbjct: 532 YKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRYPPTYKPKASYPPTYKPKITYPPT 591

Query: 186 YKPPAEKPPVYK-----PPVYK---------------PPVYKPPVEKPPVYKPPVEKPPV 305
           YKP    P  YK     PP+YK               PP YKP +  PP YKP    PP 
Sbjct: 592 YKPKPSYPTPYKQKPSYPPIYKSKSSYPTAYKSKKTYPPTYKPKITYPPTYKPKPSYPPS 651

Query: 306 YKPPVEKPP 332
           Y+P +  PP
Sbjct: 652 YRPKITYPP 660

 Score =  119 bits (297), Expect = 1e-25
 Identities = 55/119 (46%), Positives = 59/119 (49%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YKP     P YKP +  PP YKP    PP YKP    PP YKP +  PP 
Sbjct: 362 YKPKPSYPPSYKPKKTYSPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPT 421

Query: 186 YKPPAE----------KPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP A            PP YKP +  PP YKP    PP YKP +  PP YKP    PP
Sbjct: 422 YKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPP 480

 Score =  119 bits (297), Expect = 1e-25
 Identities = 52/109 (47%), Positives = 56/109 (51%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YKP    PP YKP +  PP YKP       YK     PP 
Sbjct: 382 YKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYPPT 441

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP    PP YKP +  PP YKP    PP YKP +  PP
Sbjct: 442 YKPKISYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKPKITYPP 490

 Score =  118 bits (296), Expect = 2e-25
 Identities = 57/139 (41%), Positives = 63/139 (45%), Gaps = 30/139 (21%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---------------PPV 140
           YKP    PP YKP +  PP YKP    PP YKP +  PP YK               PP+
Sbjct: 452 YKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKPKITYPPTYKRKPSYPTPYKQKPSYPPI 511

Query: 141 EK---------------PPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPV 275
            K               PP YKP +  PP YKP    PP YKP    PP YKP +  PP 
Sbjct: 512 YKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRYPPT 571

Query: 276 YKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP +  PP
Sbjct: 572 YKPKASYPPTYKPKITYPP 590

 Score =  116 bits (291), Expect = 7e-25
 Identities = 57/139 (41%), Positives = 62/139 (44%), Gaps = 30/139 (21%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-------- 161
           YKP +  PP YKP    PP YKP +  PP YKP    PP YKP +  PP YK        
Sbjct: 442 YKPKISYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKPKITYPPTYKRKPSYPTP 501

Query: 162 -------PPVEK---------------PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPV 275
                  PP+ K               PP YKP    PP YKP    PP YKP    PP 
Sbjct: 502 YKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPT 561

Query: 276 YKPPVEKPPVYKPPVEKPP 332
           YKP +  PP YKP    PP
Sbjct: 562 YKPKIRYPPTYKPKASYPP 580

 Score =  114 bits (284), Expect = 4e-24
 Identities = 55/119 (46%), Positives = 59/119 (49%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  PP YKP    PP YKP V  PP YKP    PP YKP +  PP 
Sbjct: 252 YKSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKPKPSYPPTYKPKITYPPT 311

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    P  YK     PP+YK     P  YK     PP YKP +  PP YKP    PP
Sbjct: 312 YKPKPSYPTPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPP 370

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/123 (46%), Positives = 61/123 (49%), Gaps = 15/123 (12%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YKP V  PP YKP    PP YKP +  PP YKP    P  
Sbjct: 262 YKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPTP 321

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKP-----PV 320
           YK     PP+YK     P  YK     PP YKP +  PP YKP    PP YKP     P 
Sbjct: 322 YKQKPSYPPIYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKKTYSPT 381

Query: 321 EKP 329
            KP
Sbjct: 382 YKP 384

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/139 (41%), Positives = 62/139 (44%), Gaps = 30/139 (21%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---------------PPVEK-------- 116
           YKP V  PP YKP    PP YKP +  PP YK               PP+ K        
Sbjct: 282 YKPKVTYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSYPTS 341

Query: 117 -------PPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPV 275
                  PP YKP +  PP YKP    PP YKP     P YKP +  PP YKP    PP 
Sbjct: 342 YKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKKTYSPTYKPKITYPPTYKPKPSYPPS 401

Query: 276 YKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP +  PP
Sbjct: 402 YKPKTTYPPTYKPKISYPP 420

 Score =  114 bits (284), Expect = 4e-24
 Identities = 53/119 (44%), Positives = 57/119 (47%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  PP YKP    PP YKP     P YKP +  PP YKP    PP 
Sbjct: 342 YKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKKTYSPTYKPKITYPPTYKPKPSYPPS 401

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEK----------PPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP +  PP YKP              PP YKP +  PP YKP    PP
Sbjct: 402 YKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPP 460

 Score =  113 bits (283), Expect = 6e-24
 Identities = 49/102 (48%), Positives = 53/102 (51%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YKP    PP YKP +  PP YKP       YK     PP YKP +  PP 
Sbjct: 392 YKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISYPPT 451

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
           YKP    PP YKP +  PP YKP    PP YKP +  PP YK
Sbjct: 452 YKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKPKITYPPTYK 493

 Score =  113 bits (282), Expect = 8e-24
 Identities = 54/127 (42%), Positives = 59/127 (46%), Gaps = 19/127 (14%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYK---------PPVEKPPVYKPPVEKPPVYKPPVE----- 143
           YKP    PP YKP +  PP YK         P    PP YKP +  P +YKP        
Sbjct: 193 YKPKATYPPTYKPKITYPPTYKRKPSYTPYKPKTTYPPTYKPKISYPSIYKPKASYVSSY 252

Query: 144 -----KPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
                 PP YKP +  PP YKP    PP YKP V  PP YKP    PP YKP +  PP Y
Sbjct: 253 KSKKTYPPTYKPKISYPPTYKPKPSYPPTYKPKVTYPPTYKPKPSYPPTYKPKITYPPTY 312

Query: 309 KPPVEKP 329
           KP    P
Sbjct: 313 KPKPSYP 319

 Score =  112 bits (279), Expect = 2e-23
 Identities = 48/108 (44%), Positives = 55/108 (50%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
            YKP +  PP YKP       YKP +  PP YKP       YKP +  PP YKP       
Sbjct: 762  YKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASS 821

Query: 186  YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            YKP    PP YKP +  PP YKP +  PP YKP +  PP YKP +  P
Sbjct: 822  YKPKITYPPTYKPKISYPPTYKPKITYPPTYKPKISYPPAYKPKISYP 869

 Score =  111 bits (278), Expect = 2e-23
 Identities = 57/149 (38%), Positives = 63/149 (42%), Gaps = 40/149 (26%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVE----------KPPVYKPPVEKPPVYKPPVEKPPV 155
           YKP    PP YKP +  PP YKP              PP YKP +  PP YKP    PP 
Sbjct: 402 YKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPT 461

Query: 156 YKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYK---------------PPVEK-------- 266
           YKP +  PP YKP    PP YKP +  PP YK               PP+ K        
Sbjct: 462 YKPKITYPPTYKPKPSYPPTYKPKITYPPTYKRKPSYPTPYKQKPSYPPIYKSKSSYPTS 521

Query: 267 -------PPVYKPPVEKPPVYKPPVEKPP 332
                  PP YKP +  PP YKP    PP
Sbjct: 522 YKSKKTYPPTYKPKITYPPTYKPKPSYPP 550

 Score =  110 bits (275), Expect = 5e-23
 Identities = 48/108 (44%), Positives = 54/108 (50%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YKP +  PP YKP    P  YK     PP+YK     P  
Sbjct: 562 YKPKIRYPPTYKPKASYPPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSYPTA 621

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YK     PP YKP +  PP YKP    PP Y+P +  PP YKP    P
Sbjct: 622 YKSKKTYPPTYKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSYP 669

 Score =  110 bits (274), Expect = 6e-23
 Identities = 51/118 (43%), Positives = 56/118 (47%), Gaps = 10/118 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVE----------KPPVYKPPVEKPPVYKPPVEKPPV 155
           YKP    PP YKP +  P +YKP              PP YKP +  PP YKP    PP 
Sbjct: 222 YKPKTTYPPTYKPKISYPSIYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPT 281

Query: 156 YKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP V  PP YKP    PP YKP +  PP YKP    P  YK     PP+YK     P
Sbjct: 282 YKPKVTYPPTYKPKPSYPPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSYP 339

 Score =  109 bits (272), Expect = 1e-22
 Identities = 56/137 (40%), Positives = 61/137 (44%), Gaps = 28/137 (20%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYK---------PPVEKPPVYKPPVEKPPVYK--------- 131
           YKP    PP YKP +  PP YK         P    PP YKP +  PP YK         
Sbjct: 164 YKPKTTYPPTYKPKITYPPTYKRKPSYTPYKPKATYPPTYKPKITYPPTYKRKPSYTPYK 223

Query: 132 PPVEKPPVYKPPVEKPPVYKPPAE----------KPPVYKPPVYKPPVYKPPVEKPPVYK 281
           P    PP YKP +  P +YKP A            PP YKP +  PP YKP    PP YK
Sbjct: 224 PKTTYPPTYKPKISYPSIYKPKASYVSSYKSKKTYPPTYKPKISYPPTYKPKPSYPPTYK 283

Query: 282 PPVEKPPVYKPPVEKPP 332
           P V  PP YKP    PP
Sbjct: 284 PKVTYPPTYKPKPSYPP 300

 Score =  108 bits (271), Expect = 1e-22
 Identities = 51/120 (42%), Positives = 56/120 (46%), Gaps = 10/120 (8%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YK     P  YK     PP YKP +  PP YKP    PP YKP     P YKP +  PP
Sbjct: 331 IYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKKTYSPTYKPKITYPP 390

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVE----------KPPVYKPPVEKPP 332
            YKP    PP YKP    PP YKP +  PP YKP              PP YKP +  PP
Sbjct: 391 TYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKPKASYVSSYKSKKTYPPTYKPKISYPP 450

 Score =  108 bits (271), Expect = 1e-22
 Identities = 49/109 (44%), Positives = 54/109 (49%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YK     P  YK     PP YKP +  PP YKP    PP YKP    PP YKP +  PP
Sbjct: 511 IYKSKSSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRYPP 570

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            YKP A  PP YKP +  PP YKP    P  YK     PP+YK     P
Sbjct: 571 TYKPKASYPPTYKPKITYPPTYKPKPSYPTPYKQKPSYPPIYKSKSSYP 619

 Score =  108 bits (269), Expect = 2e-22
 Identities = 47/109 (43%), Positives = 54/109 (49%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
            YKP       YKP +  PP YKP       YKP +  PP YKP       YKP +  PP 
Sbjct: 752  YKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRYPPT 811

Query: 186  YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            YKP       YKP +  PP YKP +  PP YKP +  PP YKP +  PP
Sbjct: 812  YKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPTYKPKISYPP 860

 Score =  107 bits (268), Expect = 3e-22
 Identities = 55/139 (39%), Positives = 59/139 (42%), Gaps = 30/139 (21%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYK---------------PPVEK---------------PPV 95
           YKP    PP YKP +  PP YK               PP+ K               PP 
Sbjct: 472 YKPKPSYPPTYKPKITYPPTYKRKPSYPTPYKQKPSYPPIYKSKSSYPTSYKSKKTYPPT 531

Query: 96  YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPV 275
           YKP +  PP YKP    PP YKP    PP YKP    PP YKP    PP YKP +  PP 
Sbjct: 532 YKPKITYPPTYKPKPSYPPSYKPKTTYPPTYKPKIRYPPTYKPKASYPPTYKPKITYPPT 591

Query: 276 YKPPVEKPPVYKPPVEKPP 332
           YKP    P  YK     PP
Sbjct: 592 YKPKPSYPTPYKQKPSYPP 610

 Score =  105 bits (261), Expect = 2e-21
 Identities = 47/108 (43%), Positives = 53/108 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP Y+P +  PP YKP    P  YK     PP Y+P    PP 
Sbjct: 632 YKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSYPQAYKSKGSYPPSYQPKKTYPPS 691

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP    PP YKP +  PP YK     P  YK     PP YKP +  P
Sbjct: 692 YKPKKTYPPTYKPKISYPPTYKTKPSYPASYKRKTSYPPTYKPKISYP 739

 Score =  102 bits (255), Expect = 1e-20
 Identities = 47/109 (43%), Positives = 52/109 (47%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  PP YKP    PP Y+P +  PP YKP    P  YK     PP 
Sbjct: 622 YKSKKTYPPTYKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSYPQAYKSKGSYPPS 681

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y+P    PP YKP    PP YKP +  PP YK     P  YK     PP
Sbjct: 682 YQPKKTYPPSYKPKKTYPPTYKPKISYPPTYKTKPSYPASYKRKTSYPP 730

 Score =  102 bits (254), Expect = 1e-20
 Identities = 50/121 (41%), Positives = 56/121 (46%), Gaps = 18/121 (14%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK  +  PP YKP +  PP YK     PP YKP    PP YKP +  PP 
Sbjct: 124 YKAKTSYPPSYKHKITYPPTYKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKPKITYPPT 183

Query: 186 ---------YKPPAEKPPVYKPPVYKPPV---------YKPPVEKPPVYKPPVEKPPVYK 311
                    YKP A  PP YKP +  PP          YKP    PP YKP +  P +YK
Sbjct: 184 YKRKPSYTPYKPKATYPPTYKPKITYPPTYKRKPSYTPYKPKTTYPPTYKPKISYPSIYK 243

Query: 312 P 314
           P
Sbjct: 244 P 244

 Score =  102 bits (254), Expect = 1e-20
 Identities = 46/109 (42%), Positives = 52/109 (47%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YK     P  YK     PP YKP +  PP YKP    PP Y+P +  PP YKP    P 
Sbjct: 611 IYKSKSSYPTAYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYRPKITYPPTYKPKKSYPQ 670

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            YK     PP Y+P    PP YKP    PP YKP +  PP YK     P
Sbjct: 671 AYKSKGSYPPSYQPKKTYPPSYKPKKTYPPTYKPKISYPPTYKTKPSYP 719

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 45/109 (41%), Positives = 50/109 (45%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
            Y+P    PP YKP    PP YKP +  PP YK     P  YK     PP YKP +  P  
Sbjct: 682  YQPKKTYPPSYKPKKTYPPTYKPKISYPPTYKTKPSYPASYKRKTSYPPTYKPKISYPST 741

Query: 186  YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            YK     PP YKP       YKP +  PP YKP       YKP +  PP
Sbjct: 742  YKAKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRYPP 790

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 44/103 (42%), Positives = 49/103 (47%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y+P +  PP YKP    P  YK     PP Y+P    PP YKP    PP YKP +  PP 
Sbjct: 652 YRPKITYPPTYKPKKSYPQAYKSKGSYPPSYQPKKTYPPSYKPKKTYPPTYKPKISYPPT 711

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           YK     P  YK     PP YKP +  P  YK     PP YKP
Sbjct: 712 YKTKPSYPASYKRKTSYPPTYKPKISYPSTYKAKPSYPPTYKP 754

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 47/110 (42%), Positives = 53/110 (48%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YKP  +K   YK      P YK     PP YK  +  PP YKP +  PP YK     PP
Sbjct: 103 IYKPIAKKLSSYKAIKTTYPAYKAKTSYPPSYKHKITYPPTYKPKITYPPTYKQKPSYPP 162

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            YKP    PP YKP +  PP YK      P YKP    PP YKP +  PP
Sbjct: 163 SYKPKTTYPPTYKPKITYPPTYKRKPSYTP-YKPKATYPPTYKPKITYPP 211

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 44/103 (42%), Positives = 48/103 (46%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
            YKP    PP YKP +  PP YK     P  YK     PP YKP +  P  YK     PP 
Sbjct: 692  YKPKKTYPPTYKPKISYPPTYKTKPSYPASYKRKTSYPPTYKPKISYPSTYKAKPSYPPT 751

Query: 186  YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
            YKP       YKP +  PP YKP       YKP +  PP YKP
Sbjct: 752  YKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKP 794

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 41/91 (45%), Positives = 47/91 (51%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
            YKP +  PP YKP       YKP +  PP YKP       YKP +  PP YKP +  PP 
Sbjct: 782  YKPKIRYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYPPT 841

Query: 186  YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVY 278
            YKP    PP YKP +  PP YKP +  P  Y
Sbjct: 842  YKPKITYPPTYKPKISYPPAYKPKISYPSQY 872

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 45/109 (41%), Positives = 49/109 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    P  YK     PP Y+P    PP YKP    PP YKP +  PP YK     P  
Sbjct: 662 YKPKKSYPQAYKSKGSYPPSYQPKKTYPPSYKPKKTYPPTYKPKISYPPTYKTKPSYPAS 721

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YKP +  P  YK     PP YKP       YKP +  PP
Sbjct: 722 YKRKTSYPPTYKPKISYPSTYKAKPSYPPTYKPKPSYASSYKPKIRYPP 770

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 42/102 (41%), Positives = 46/102 (45%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y P     P Y      PP+YKP  +K   YK      P YK     PP YK  +  PP 
Sbjct: 84  YYPTKRYQPTYGSKTNYPPIYKPIAKKLSSYKAIKTTYPAYKAKTSYPPSYKHKITYPPT 143

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
           YKP    PP YK     PP YKP    PP YKP +  PP YK
Sbjct: 144 YKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKPKITYPPTYK 185

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/107 (40%), Positives = 47/107 (43%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           P   KP  Y P     P Y      PP+YKP  +K   YK      P YK     PP YK
Sbjct: 76  PAPYKPKGYYPTKRYQPTYGSKTNYPPIYKPIAKKLSSYKAIKTTYPAYKAKTSYPPSYK 135

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
                PP YKP +  PP YK     PP YKP    PP YKP +  PP
Sbjct: 136 HKITYPPTYKPKITYPPTYKQKPSYPPSYKPKTTYPPTYKPKITYPP 182

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 43/116 (37%), Positives = 48/116 (41%), Gaps = 15/116 (12%)
 Frame = +3

Query: 30  PVYKPPVEKPPVY-----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVYKP  + P  Y      P   KP  Y P     P Y      PP+YKP  +K   YK 
Sbjct: 57  PVYKPMNKIPTPYISKKSYPAPYKPKGYYPTKRYQPTYGSKTNYPPIYKPIAKKLSSYKA 116

Query: 195 PAEKPPVYK-----PPVYKPPVYKPPVEKPPVYKPPVEK-----PPVYKPPVEKPP 332
                P YK     PP YK  +  PP  KP +  PP  K     PP YKP    PP
Sbjct: 117 IKTTYPAYKAKTSYPPSYKHKITYPPTYKPKITYPPTYKQKPSYPPSYKPKTTYPP 172

[49][TOP]
>UniRef100_Q9M7N9 Proline-rich protein 3 n=1 Tax=Arabidopsis thaliana
           RepID=Q9M7N9_ARATH
          Length = 313

 Score =  119 bits (297), Expect = 1e-25
 Identities = 66/119 (55%), Positives = 68/119 (57%), Gaps = 13/119 (10%)
 Frame = +3

Query: 12  PPVEKPPVYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPP 167
           PPV K P +KP    PV  PPVYKP +  PPVY  P   PPVY PPV K    PPVY  P
Sbjct: 30  PPVYKSPEHKPTLPSPVYTPPVYKPTL-SPPVYTKPTIPPPVYTPPVYKHTPSPPVYTKP 88

Query: 168 VEKPPVYKPPAEK----PPVYKPPVYKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKP 329
              PPVY PP  K    PPVY  P   PPVY PPV KP P Y  P   PPVY PPV KP
Sbjct: 89  TIPPPVYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKPTPDYTKPTIPPPVYTPPVYKP 147

 Score =  114 bits (286), Expect = 3e-24
 Identities = 67/125 (53%), Positives = 68/125 (54%), Gaps = 15/125 (12%)
 Frame = +3

Query: 3   VYKPPVEKP----PVYKPPVEKPPVYKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVY 158
           VY PPV KP    PVY  P   PPVY PPV K    PPVY  P   PPVY PPV KP + 
Sbjct: 46  VYTPPVYKPTLSPPVYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTL- 104

Query: 159 KPPVEKPPVYKPPAEKPPVYKPPVYKP-PVYKPPVEKPPVYKPPVEK----PPVYK--PP 317
                 PPVY  P   PPVY PPVYKP P Y  P   PPVY PPV K    PPVYK  P 
Sbjct: 105 -----SPPVYTKPTIPPPVYTPPVYKPTPDYTKPTIPPPVYTPPVYKPTPSPPVYKKSPS 159

Query: 318 VEKPP 332
              PP
Sbjct: 160 YSSPP 164

 Score =  108 bits (270), Expect = 2e-22
 Identities = 63/123 (51%), Positives = 64/123 (52%), Gaps = 14/123 (11%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEK----PPVYKPPVEKPPVYKPPVEKP----PVYKPPVEKPPVY 158
           VY  P   PPVY PPV K    PPVY  P   PPVY PPV KP    PVY  P   PPVY
Sbjct: 60  VYTKPTIPPPVYTPPVYKHTPSPPVYTKPTIPPPVYTPPVYKPTLSPPVYTKPTIPPPVY 119

Query: 159 KPPVEKP-PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP-----PV 320
            PPV KP P Y  P   PPVY PPVYKP    P  +K P Y  P   PP Y P     P 
Sbjct: 120 TPPVYKPTPDYTKPTIPPPVYTPPVYKPTPSPPVYKKSPSYSSP---PPPYVPKPTYTPT 176

Query: 321 EKP 329
            KP
Sbjct: 177 TKP 179

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 32/57 (56%), Positives = 34/57 (59%)
 Frame = +3

Query: 156 YKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           Y P    PPVYK P  KP +   PVY PPVYKP +  PPVY  P   PPVY PPV K
Sbjct: 25  YSP--SSPPVYKSPEHKPTL-PSPVYTPPVYKPTL-SPPVYTKPTIPPPVYTPPVYK 77

[50][TOP]
>UniRef100_Q5XGC9-2 Isoform 2 of Serum response factor-binding protein 1 n=1
           Tax=Xenopus (Silurana) tropicalis RepID=Q5XGC9-2
          Length = 530

 Score =  119 bits (297), Expect = 1e-25
 Identities = 55/110 (50%), Positives = 75/110 (68%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 226 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 285

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V +P  E+P V +P V +P V +P VE+P V +P VE P V +PPVE PP
Sbjct: 286 VERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPP 335

 Score =  116 bits (291), Expect = 7e-25
 Identities = 54/110 (49%), Positives = 75/110 (68%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 221 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 280

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V +P  E+P V +P V +P V +P VE+P V +P VE+P V  P VE+PP
Sbjct: 281 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPP 330

 Score =  114 bits (284), Expect = 4e-24
 Identities = 53/109 (48%), Positives = 74/109 (67%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 216 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 275

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V +P  E+P V +P V +P V +P VE+P V +P VE+P V +P VE P
Sbjct: 276 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESP 324

 Score =  114 bits (284), Expect = 4e-24
 Identities = 53/108 (49%), Positives = 73/108 (67%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 231 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 290

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           V +P  E+P V +P V +P V +P VE+P V  P VE+PPV  PP +K
Sbjct: 291 VERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPPKKK 338

 Score =  110 bits (274), Expect = 6e-23
 Identities = 52/108 (48%), Positives = 72/108 (66%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 236 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 295

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           V +P  E+P V +P V +P V +P VE P V +PPVE PP  K  +E+
Sbjct: 296 VERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPPKKKACLEQ 343

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 43/104 (41%), Positives = 63/104 (60%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           +E P V +   E+    K   +   V +P VE+P V +P VE+P V +P VE+P V +P 
Sbjct: 191 LELPYVQENLPEQTAENKEQPKAQDVERPAVERPAVERPAVERPAVERPAVERPAVERPA 250

Query: 198 AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            E+P V +P V +P V +P VE+P V +P VE+P V +P VE+P
Sbjct: 251 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERP 294

[51][TOP]
>UniRef100_Q5XGC9 Serum response factor-binding protein 1 n=1 Tax=Xenopus (Silurana)
           tropicalis RepID=SRFB1_XENTR
          Length = 535

 Score =  119 bits (297), Expect = 1e-25
 Identities = 55/110 (50%), Positives = 75/110 (68%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 231 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 290

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V +P  E+P V +P V +P V +P VE+P V +P VE P V +PPVE PP
Sbjct: 291 VERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPP 340

 Score =  116 bits (291), Expect = 7e-25
 Identities = 54/110 (49%), Positives = 75/110 (68%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 226 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 285

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V +P  E+P V +P V +P V +P VE+P V +P VE+P V  P VE+PP
Sbjct: 286 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPP 335

 Score =  115 bits (287), Expect = 2e-24
 Identities = 53/109 (48%), Positives = 75/109 (68%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 216 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 275

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V +P  E+P V +P V +P V +P VE+P V +P VE+P V +P VE+P
Sbjct: 276 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERP 324

 Score =  114 bits (284), Expect = 4e-24
 Identities = 53/109 (48%), Positives = 74/109 (67%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 221 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 280

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V +P  E+P V +P V +P V +P VE+P V +P VE+P V +P VE P
Sbjct: 281 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPVVESP 329

 Score =  114 bits (284), Expect = 4e-24
 Identities = 53/108 (49%), Positives = 73/108 (67%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 236 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 295

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           V +P  E+P V +P V +P V +P VE+P V  P VE+PPV  PP +K
Sbjct: 296 VERPAVERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPPKKK 343

 Score =  110 bits (274), Expect = 6e-23
 Identities = 52/108 (48%), Positives = 72/108 (66%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P V +P VE+P 
Sbjct: 241 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPA 300

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           V +P  E+P V +P V +P V +P VE P V +PPVE PP  K  +E+
Sbjct: 301 VERPAVERPAVERPAVERPAVERPVVESPAVERPPVESPPKKKACLEQ 348

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 43/104 (41%), Positives = 63/104 (60%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           +E P V +   E+    K   +   V +P VE+P V +P VE+P V +P VE+P V +P 
Sbjct: 191 LELPYVQENLPEQTAENKEQPKAQDVERPAVERPAVERPAVERPAVERPAVERPAVERPA 250

Query: 198 AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            E+P V +P V +P V +P VE+P V +P VE+P V +P VE+P
Sbjct: 251 VERPAVERPAVERPAVERPAVERPAVERPAVERPAVERPAVERP 294

[52][TOP]
>UniRef100_Q2TCL0 Foot protein 1 variant 1 n=1 Tax=Mytilus californianus
           RepID=Q2TCL0_MYTCA
          Length = 732

 Score =  117 bits (294), Expect = 3e-25
 Identities = 52/109 (47%), Positives = 56/109 (51%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YKP +  PP YKP    PP YK     PP YKP +  PP YKP    P  
Sbjct: 282 YKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTS 341

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP
Sbjct: 342 YKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPP 390

 Score =  113 bits (282), Expect = 8e-24
 Identities = 51/109 (46%), Positives = 54/109 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YK     PP YKP +  PP YKP    P  YK     PP 
Sbjct: 292 YKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPT 351

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP    PP YKP +  PP YKP    PP YK     PP
Sbjct: 352 YKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPP 400

 Score =  112 bits (280), Expect = 1e-23
 Identities = 51/110 (46%), Positives = 54/110 (49%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYK     PPVYK  +  PP YKP +  PP YKP    PP YKP    PP YK     P 
Sbjct: 121 VYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPS 180

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            YKP    PP YKP +  PP YKP    PP YK     P  YKP    PP
Sbjct: 181 TYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPP 230

 Score =  112 bits (280), Expect = 1e-23
 Identities = 55/129 (42%), Positives = 60/129 (46%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP 
Sbjct: 252 YKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPT 311

Query: 186 YK-----PPAEKPPVYKPPVYK---------------PPVYKPPVEKPPVYKPPVEKPPV 305
           YK     PP  KP +  PP YK               PP YKP +  PP YKP    PP 
Sbjct: 312 YKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPS 371

Query: 306 YKPPVEKPP 332
           YKP +  PP
Sbjct: 372 YKPKITYPP 380

 Score =  112 bits (279), Expect = 2e-23
 Identities = 55/129 (42%), Positives = 59/129 (45%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YKP +  PP YKP    PP YK     P  YKP    PP YKP +  PP 
Sbjct: 242 YKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPT 301

Query: 186 YKPPAEKPPVYK-----PPVYKPPVYKPPVEK---------------PPVYKPPVEKPPV 305
           YKP    PP YK     PP YKP +  PP  K               PP YKP +  PP 
Sbjct: 302 YKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPT 361

Query: 306 YKPPVEKPP 332
           YKP    PP
Sbjct: 362 YKPKPSYPP 370

 Score =  110 bits (276), Expect = 4e-23
 Identities = 55/129 (42%), Positives = 58/129 (44%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YKP    PP YK     P  YKP    PP YKP +  PP 
Sbjct: 142 YKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPT 201

Query: 186 YKPPAEKPPVYK---------------PPVYK-----PPVYKPPVEKPPVYKPPVEKPPV 305
           YKP    PP YK               PP YK     P  YKP    PP YKP +  PP 
Sbjct: 202 YKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPT 261

Query: 306 YKPPVEKPP 332
           YKP    PP
Sbjct: 262 YKPKPSYPP 270

 Score =  110 bits (276), Expect = 4e-23
 Identities = 50/109 (45%), Positives = 53/109 (48%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK     P  
Sbjct: 222 YKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPST 281

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP +  PP YKP    PP YK     PP YKP +  PP
Sbjct: 282 YKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPP 330

 Score =  109 bits (272), Expect = 1e-22
 Identities = 49/109 (44%), Positives = 53/109 (48%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  P  YK     PP YK     PP YKP +  PP YKP    P  
Sbjct: 452 YKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTS 511

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP
Sbjct: 512 YKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPP 560

 Score =  108 bits (269), Expect = 2e-22
 Identities = 48/103 (46%), Positives = 52/103 (50%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP 
Sbjct: 302 YKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPT 361

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           YKP    PP YKP +  PP YKP    PP YK     PP Y+P
Sbjct: 362 YKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQP 404

 Score =  107 bits (268), Expect = 3e-22
 Identities = 49/109 (44%), Positives = 54/109 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP YKP +  PP 
Sbjct: 322 YKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPT 381

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YK     PP Y+P     P YKP    PP YK  +  PP
Sbjct: 382 YKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPP 430

 Score =  107 bits (268), Expect = 3e-22
 Identities = 49/109 (44%), Positives = 54/109 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP YKP +  PP 
Sbjct: 492 YKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPT 551

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YK     PP Y+P     P YKP    PP YK  +  PP
Sbjct: 552 YKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPP 600

 Score =  107 bits (267), Expect = 4e-22
 Identities = 49/109 (44%), Positives = 52/109 (47%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  P  YK     PP YK     PP YKP +  PP YKP    P  YK     PP 
Sbjct: 462 YKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPT 521

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP    PP YKP +  PP YKP    PP YK     PP
Sbjct: 522 YKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPP 570

 Score =  106 bits (264), Expect = 9e-22
 Identities = 51/119 (42%), Positives = 54/119 (45%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YKP +  PP YKP    PP YK     P  YKP    PP YK     P  
Sbjct: 182 YKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKAKKTYPST 241

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPP----------VYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP +  PP YKP    PP           YKP    PP YKP +  PP
Sbjct: 242 YKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPP 300

 Score =  105 bits (263), Expect = 1e-21
 Identities = 49/108 (45%), Positives = 51/108 (47%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YKP    PP YKP +  PP YKP    PP YK     P  YKP    PP 
Sbjct: 232 YKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPT 291

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP    PP YKP    PP YK     PP YKP +  PP YKP    P
Sbjct: 292 YKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYP 339

 Score =  105 bits (261), Expect = 2e-21
 Identities = 47/103 (45%), Positives = 51/103 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP 
Sbjct: 472 YKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPT 531

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           YKP    PP YKP +  PP YKP    PP YK     PP Y+P
Sbjct: 532 YKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQP 574

 Score =  104 bits (260), Expect = 3e-21
 Identities = 49/110 (44%), Positives = 54/110 (49%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YKP  +K   YK       VYK     PPVYK  +  PP YKP +  PP YKP    PP
Sbjct: 101 IYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSYPP 160

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP
Sbjct: 161 TYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPP 210

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/109 (44%), Positives = 52/109 (47%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP 
Sbjct: 312 YKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPS 371

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP    PP YK     PP Y+P     P YKP    PP
Sbjct: 372 YKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPP 420

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/109 (44%), Positives = 52/109 (47%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP 
Sbjct: 482 YKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPS 541

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP    PP YK     PP Y+P     P YKP    PP
Sbjct: 542 YKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPP 590

 Score =  103 bits (257), Expect = 6e-21
 Identities = 47/109 (43%), Positives = 51/109 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YK     PP YKP +  P  YK     PP YK     PP YKP +  PP 
Sbjct: 442 YKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPT 501

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    P  YK     PP YKP +  PP YKP    PP YKP +  PP
Sbjct: 502 YKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPP 550

 Score =  103 bits (257), Expect = 6e-21
 Identities = 46/108 (42%), Positives = 52/108 (48%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  P  YK     PP YKP       YKP +  PP YKP       
Sbjct: 622 YKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASS 681

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP    PP YKP +  PP YKP +  PP YKP +   P YKP +  P
Sbjct: 682 YKPKITYPPTYKPKISYPPTYKPKITYPPSYKPKISYLPAYKPKISYP 729

 Score =  100 bits (250), Expect = 4e-20
 Identities = 45/109 (41%), Positives = 51/109 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YK     PP YKP +  P  YK     PP YKP       YKP +  PP 
Sbjct: 612 YKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKPKPSYASSYKPKIRYPPT 671

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP       YKP +  PP YKP +  PP YKP +  PP YKP +   P
Sbjct: 672 YKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKPKISYLP 720

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 50/118 (42%), Positives = 54/118 (45%), Gaps = 10/118 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P     P 
Sbjct: 352 YKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPS 411

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP    PP YK     PP YK     P  YK     P  YK     PP YKP +  P
Sbjct: 412 YKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYP 469

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 50/118 (42%), Positives = 54/118 (45%), Gaps = 10/118 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P     P 
Sbjct: 522 YKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPS 581

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP    PP YK     PP YK     P  YK     P  YK     PP YKP +  P
Sbjct: 582 YKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYP 639

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 47/108 (43%), Positives = 49/108 (45%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YKP    PP YKP +  PP YKP    PP YK     P  YKP    PP 
Sbjct: 172 YKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPT 231

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YK     P  YKP    PP YKP +  PP YKP    PP YK     P
Sbjct: 232 YKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYP 279

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 48/113 (42%), Positives = 51/113 (45%), Gaps = 4/113 (3%)
 Frame = +3

Query: 6   YKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           Y P  +     PP YK     P  YKP    PP YK     P  YKP    PP YKP + 
Sbjct: 198 YPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKIT 257

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP
Sbjct: 258 YPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPP 310

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 46/108 (42%), Positives = 50/108 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP 
Sbjct: 342 YKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPS 401

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           Y+P     P YKP    PP YK  +  PP YK     P  YK     P
Sbjct: 402 YQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYP 449

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 46/108 (42%), Positives = 50/108 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP 
Sbjct: 512 YKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPS 571

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           Y+P     P YKP    PP YK  +  PP YK     P  YK     P
Sbjct: 572 YQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYP 619

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 43/101 (42%), Positives = 49/101 (48%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  P  YK     PP YKP       YKP +  PP YKP       YKP +  PP 
Sbjct: 632 YKPKISYPSTYKTKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPT 691

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
           YKP    PP YKP +  PP YKP +   P YKP +  P  Y
Sbjct: 692 YKPKISYPPTYKPKITYPPSYKPKISYLPAYKPKISYPSQY 732

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 49/129 (37%), Positives = 54/129 (41%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YK  +  PP YK     P  YK     P  YK     PP YKP +  P  
Sbjct: 582 YKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYPST 641

Query: 186 YKPPAEKPPVYK---------------PPVYKP-----PVYKPPVEKPPVYKPPVEKPPV 305
           YK     PP YK               PP YKP       YKP +  PP YKP +  PP 
Sbjct: 642 YKTKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYPPT 701

Query: 306 YKPPVEKPP 332
           YKP +  PP
Sbjct: 702 YKPKITYPP 710

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 47/112 (41%), Positives = 52/112 (46%), Gaps = 4/112 (3%)
 Frame = +3

Query: 6   YKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           Y P  +     P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP   
Sbjct: 328 YPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKS 387

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            PP YK  A  PP Y+P     P YKP    PP YK  +  PP YK     P
Sbjct: 388 YPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYP 439

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 47/112 (41%), Positives = 52/112 (46%), Gaps = 4/112 (3%)
 Frame = +3

Query: 6   YKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           Y P  +     P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP   
Sbjct: 498 YPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKS 557

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            PP YK  A  PP Y+P     P YKP    PP YK  +  PP YK     P
Sbjct: 558 YPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYP 609

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 49/129 (37%), Positives = 53/129 (41%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YK  +  PP YK     P  YK     P  YK     PP YKP +  P  
Sbjct: 412 YKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPST 471

Query: 186 YKPPAEKPPVYK-----PPVYKPPVYKPPVEK---------------PPVYKPPVEKPPV 305
           YK     PP YK     PP YKP +  PP  K               PP YKP +  PP 
Sbjct: 472 YKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPT 531

Query: 306 YKPPVEKPP 332
           YKP    PP
Sbjct: 532 YKPKPSYPP 540

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 54/139 (38%), Positives = 58/139 (41%), Gaps = 30/139 (21%)
 Frame = +3

Query: 6   YKPPVEKPPVYKP-----PVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 155
           YKP    PP YKP     P  K     PP YK     PP Y+P     P YKP    PP 
Sbjct: 362 YKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPT 421

Query: 156 YKPPVEKPPVYKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYK-----PPV 290
           YK  +  PP YK     P  YK     P  YK     PP YKP +  P  YK     PP 
Sbjct: 422 YKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPT 481

Query: 291 EK-----PPVYKPPVEKPP 332
            K     PP YKP +  PP
Sbjct: 482 YKAKKTYPPTYKPKITYPP 500

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 46/115 (40%), Positives = 51/115 (44%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPP 167
           VYKP  + P  Y      P  YKP    P     P Y      PP+YKP  +K   YK  
Sbjct: 56  VYKPMNKIPTSYISKKSYPAPYKPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKAI 115

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
                VYK     PPVYK  +  PP YKP +  PP YKP    PP YKP    PP
Sbjct: 116 KTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPP 170

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/123 (39%), Positives = 51/123 (41%), Gaps = 15/123 (12%)
 Frame = +3

Query: 6   YKPPVEKPPVYKP-----PVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 155
           YKP    PP YKP     P  K     PP YK     PP Y+P     P YKP    PP 
Sbjct: 532 YKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPT 591

Query: 156 YKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPV 320
           YK  +  PP YK     P  YK     P  YK     PP YKP +  P  YK     PP 
Sbjct: 592 YKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPT 651

Query: 321 EKP 329
            KP
Sbjct: 652 YKP 654

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/106 (32%), Positives = 38/106 (35%), Gaps = 25/106 (23%)
 Frame = +3

Query: 90  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYK----------- 236
           PVYKP  + P  Y      P  YKP    P     P        PP+YK           
Sbjct: 55  PVYKPMNKIPTSYISKKSYPAPYKPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKA 114

Query: 237 --------------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
                         PPVYK  +  PP YKP +  PP YKP    PP
Sbjct: 115 IKTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSYPP 160

[53][TOP]
>UniRef100_Q2TCK9 Foot protein 1 variant 2 n=1 Tax=Mytilus californianus
           RepID=Q2TCK9_MYTCA
          Length = 672

 Score =  117 bits (294), Expect = 3e-25
 Identities = 52/109 (47%), Positives = 56/109 (51%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YKP +  PP YKP    PP YK     PP YKP +  PP YKP    P  
Sbjct: 222 YKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTS 281

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP
Sbjct: 282 YKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPP 330

 Score =  114 bits (284), Expect = 4e-24
 Identities = 51/109 (46%), Positives = 54/109 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YKP    PP YK     P  YKP    PP YKP +  PP 
Sbjct: 142 YKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPT 201

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP
Sbjct: 202 YKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPP 250

 Score =  113 bits (282), Expect = 8e-24
 Identities = 51/109 (46%), Positives = 54/109 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YK     PP YKP +  PP YKP    P  YK     PP 
Sbjct: 232 YKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPT 291

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP    PP YKP +  PP YKP    PP YK     PP
Sbjct: 292 YKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPP 340

 Score =  112 bits (281), Expect = 1e-23
 Identities = 53/120 (44%), Positives = 57/120 (47%), Gaps = 10/120 (8%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYK     PPVYK  +  PP YKP +  PP YKP    PP YKP    PP YK     P 
Sbjct: 121 VYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPPTYKAKKTYPS 180

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPP----------VYKPPVEKPPVYKPPVEKPP 332
            YKP    PP YKP +  PP YKP    PP           YKP    PP YKP +  PP
Sbjct: 181 TYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPP 240

 Score =  112 bits (280), Expect = 1e-23
 Identities = 55/129 (42%), Positives = 60/129 (46%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP 
Sbjct: 192 YKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPT 251

Query: 186 YK-----PPAEKPPVYKPPVYK---------------PPVYKPPVEKPPVYKPPVEKPPV 305
           YK     PP  KP +  PP YK               PP YKP +  PP YKP    PP 
Sbjct: 252 YKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPS 311

Query: 306 YKPPVEKPP 332
           YKP +  PP
Sbjct: 312 YKPKITYPP 320

 Score =  112 bits (279), Expect = 2e-23
 Identities = 55/129 (42%), Positives = 59/129 (45%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YKP +  PP YKP    PP YK     P  YKP    PP YKP +  PP 
Sbjct: 182 YKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPTYKPKITYPPT 241

Query: 186 YKPPAEKPPVYK-----PPVYKPPVYKPPVEK---------------PPVYKPPVEKPPV 305
           YKP    PP YK     PP YKP +  PP  K               PP YKP +  PP 
Sbjct: 242 YKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPT 301

Query: 306 YKPPVEKPP 332
           YKP    PP
Sbjct: 302 YKPKPSYPP 310

 Score =  110 bits (276), Expect = 4e-23
 Identities = 50/109 (45%), Positives = 53/109 (48%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YK     P  
Sbjct: 162 YKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPST 221

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP +  PP YKP    PP YK     PP YKP +  PP
Sbjct: 222 YKPKPSYPPTYKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPP 270

 Score =  109 bits (272), Expect = 1e-22
 Identities = 49/109 (44%), Positives = 53/109 (48%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  P  YK     PP YK     PP YKP +  PP YKP    P  
Sbjct: 392 YKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTS 451

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP
Sbjct: 452 YKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPP 500

 Score =  108 bits (269), Expect = 2e-22
 Identities = 48/103 (46%), Positives = 52/103 (50%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP 
Sbjct: 242 YKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPT 301

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           YKP    PP YKP +  PP YKP    PP YK     PP Y+P
Sbjct: 302 YKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQP 344

 Score =  107 bits (268), Expect = 3e-22
 Identities = 49/109 (44%), Positives = 54/109 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP YKP +  PP 
Sbjct: 262 YKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPT 321

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YK     PP Y+P     P YKP    PP YK  +  PP
Sbjct: 322 YKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPP 370

 Score =  107 bits (268), Expect = 3e-22
 Identities = 49/109 (44%), Positives = 54/109 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP YKP +  PP 
Sbjct: 432 YKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPT 491

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YK     PP Y+P     P YKP    PP YK  +  PP
Sbjct: 492 YKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPP 540

 Score =  107 bits (267), Expect = 4e-22
 Identities = 49/109 (44%), Positives = 52/109 (47%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  P  YK     PP YK     PP YKP +  PP YKP    P  YK     PP 
Sbjct: 402 YKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPT 461

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP    PP YKP +  PP YKP    PP YK     PP
Sbjct: 462 YKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPP 510

 Score =  105 bits (263), Expect = 1e-21
 Identities = 49/108 (45%), Positives = 51/108 (47%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YKP    PP YKP +  PP YKP    PP YK     P  YKP    PP 
Sbjct: 172 YKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPPSYKAKKSYPSTYKPKPSYPPT 231

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP    PP YKP    PP YK     PP YKP +  PP YKP    P
Sbjct: 232 YKPKITYPPTYKPKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYP 279

 Score =  105 bits (261), Expect = 2e-21
 Identities = 47/103 (45%), Positives = 51/103 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP 
Sbjct: 412 YKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPT 471

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           YKP    PP YKP +  PP YKP    PP YK     PP Y+P
Sbjct: 472 YKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQP 514

 Score =  104 bits (260), Expect = 3e-21
 Identities = 49/110 (44%), Positives = 54/110 (49%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YKP  +K   YK       VYK     PPVYK  +  PP YKP +  PP YKP    PP
Sbjct: 101 IYKPVAKKLSSYKAIKTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSYPP 160

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP
Sbjct: 161 TYKPKPSYPPTYKAKKTYPSTYKPKPSYPPTYKPKITYPPTYKPKPSYPP 210

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/109 (44%), Positives = 52/109 (47%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP 
Sbjct: 252 YKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPS 311

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP    PP YK     PP Y+P     P YKP    PP
Sbjct: 312 YKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPP 360

 Score =  103 bits (258), Expect = 5e-21
 Identities = 49/109 (44%), Positives = 52/109 (47%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  PP YKP    P  YK     PP YKP +  PP YKP    PP 
Sbjct: 422 YKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPS 481

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP    PP YK     PP Y+P     P YKP    PP
Sbjct: 482 YKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPP 530

 Score =  103 bits (257), Expect = 6e-21
 Identities = 47/109 (43%), Positives = 51/109 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YK     PP YKP +  P  YK     PP YK     PP YKP +  PP 
Sbjct: 382 YKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKAKKTYPPTYKPKITYPPT 441

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    P  YK     PP YKP +  PP YKP    PP YKP +  PP
Sbjct: 442 YKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPP 490

 Score =  103 bits (257), Expect = 6e-21
 Identities = 46/108 (42%), Positives = 52/108 (48%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  P  YK     PP YKP       YKP +  PP YKP       
Sbjct: 562 YKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASS 621

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP    PP YKP +  PP YKP +  PP YKP +   P YKP +  P
Sbjct: 622 YKPKITYPPTYKPKISYPPTYKPKITYPPSYKPKISYLPAYKPKISYP 669

 Score =  100 bits (250), Expect = 4e-20
 Identities = 45/109 (41%), Positives = 51/109 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YK     PP YKP +  P  YK     PP YKP       YKP +  PP 
Sbjct: 552 YKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPTYKPKPSYASSYKPKIRYPPT 611

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP       YKP +  PP YKP +  PP YKP +  PP YKP +   P
Sbjct: 612 YKPKPSYASSYKPKITYPPTYKPKISYPPTYKPKITYPPSYKPKISYLP 660

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 50/118 (42%), Positives = 54/118 (45%), Gaps = 10/118 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P     P 
Sbjct: 292 YKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPS 351

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP    PP YK     PP YK     P  YK     P  YK     PP YKP +  P
Sbjct: 352 YKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYP 409

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 50/118 (42%), Positives = 54/118 (45%), Gaps = 10/118 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP Y+P     P 
Sbjct: 462 YKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPS 521

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP    PP YK     PP YK     P  YK     P  YK     PP YKP +  P
Sbjct: 522 YKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYP 579

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 46/108 (42%), Positives = 50/108 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP 
Sbjct: 282 YKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPS 341

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           Y+P     P YKP    PP YK  +  PP YK     P  YK     P
Sbjct: 342 YQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYP 389

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 46/108 (42%), Positives = 50/108 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP +  PP YKP    PP YKP +  PP YKP    PP YK     PP 
Sbjct: 452 YKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPS 511

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           Y+P     P YKP    PP YK  +  PP YK     P  YK     P
Sbjct: 512 YQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYP 559

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 43/101 (42%), Positives = 49/101 (48%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  P  YK     PP YKP       YKP +  PP YKP       YKP +  PP 
Sbjct: 572 YKPKISYPSTYKTKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPT 631

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
           YKP    PP YKP +  PP YKP +   P YKP +  P  Y
Sbjct: 632 YKPKISYPPTYKPKITYPPSYKPKISYLPAYKPKISYPSQY 672

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 49/129 (37%), Positives = 54/129 (41%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YK  +  PP YK     P  YK     P  YK     PP YKP +  P  
Sbjct: 522 YKPKKTYPPTYKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYPST 581

Query: 186 YKPPAEKPPVYK---------------PPVYKP-----PVYKPPVEKPPVYKPPVEKPPV 305
           YK     PP YK               PP YKP       YKP +  PP YKP +  PP 
Sbjct: 582 YKTKPSYPPTYKPKPSYASSYKPKIRYPPTYKPKPSYASSYKPKITYPPTYKPKISYPPT 641

Query: 306 YKPPVEKPP 332
           YKP +  PP
Sbjct: 642 YKPKITYPP 650

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 47/112 (41%), Positives = 52/112 (46%), Gaps = 4/112 (3%)
 Frame = +3

Query: 6   YKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           Y P  +     P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP   
Sbjct: 268 YPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKS 327

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            PP YK  A  PP Y+P     P YKP    PP YK  +  PP YK     P
Sbjct: 328 YPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYP 379

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 47/112 (41%), Positives = 52/112 (46%), Gaps = 4/112 (3%)
 Frame = +3

Query: 6   YKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           Y P  +     P  YK     PP YKP +  PP YKP    PP YKP +  PP YKP   
Sbjct: 438 YPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPTYKPKPSYPPSYKPKITYPPTYKPKKS 497

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            PP YK  A  PP Y+P     P YKP    PP YK  +  PP YK     P
Sbjct: 498 YPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPTYKRKISYPPTYKTKPSYP 549

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 49/129 (37%), Positives = 53/129 (41%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YK  +  PP YK     P  YK     P  YK     PP YKP +  P  
Sbjct: 352 YKPKKTYPPTYKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPST 411

Query: 186 YKPPAEKPPVYK-----PPVYKPPVYKPPVEK---------------PPVYKPPVEKPPV 305
           YK     PP YK     PP YKP +  PP  K               PP YKP +  PP 
Sbjct: 412 YKTKPSYPPTYKAKKTYPPTYKPKITYPPTYKPKPSYPTSYKSKKTYPPTYKPKITYPPT 471

Query: 306 YKPPVEKPP 332
           YKP    PP
Sbjct: 472 YKPKPSYPP 480

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 54/139 (38%), Positives = 58/139 (41%), Gaps = 30/139 (21%)
 Frame = +3

Query: 6   YKPPVEKPPVYKP-----PVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 155
           YKP    PP YKP     P  K     PP YK     PP Y+P     P YKP    PP 
Sbjct: 302 YKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPT 361

Query: 156 YKPPVEKPPVYKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYK-----PPV 290
           YK  +  PP YK     P  YK     P  YK     PP YKP +  P  YK     PP 
Sbjct: 362 YKRKISYPPTYKTKPSYPSSYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPT 421

Query: 291 EK-----PPVYKPPVEKPP 332
            K     PP YKP +  PP
Sbjct: 422 YKAKKTYPPTYKPKITYPP 440

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 46/115 (40%), Positives = 51/115 (44%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPP 167
           VYKP  + P  Y      P  YKP    P     P Y      PP+YKP  +K   YK  
Sbjct: 56  VYKPMNKIPTSYISKKSYPAPYKPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKAI 115

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
                VYK     PPVYK  +  PP YKP +  PP YKP    PP YKP    PP
Sbjct: 116 KTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSYPPTYKPKPSYPP 170

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/123 (39%), Positives = 51/123 (41%), Gaps = 15/123 (12%)
 Frame = +3

Query: 6   YKPPVEKPPVYKP-----PVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 155
           YKP    PP YKP     P  K     PP YK     PP Y+P     P YKP    PP 
Sbjct: 472 YKPKPSYPPSYKPKITYPPTYKPKKSYPPAYKSKASYPPSYQPKKTYLPSYKPKKTYPPT 531

Query: 156 YKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPV 320
           YK  +  PP YK     P  YK     P  YK     PP YKP +  P  YK     PP 
Sbjct: 532 YKRKISYPPTYKTKPSYPASYKRKTSYPSTYKRKTSYPPTYKPKISYPSTYKTKPSYPPT 591

Query: 321 EKP 329
            KP
Sbjct: 592 YKP 594

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/106 (32%), Positives = 38/106 (35%), Gaps = 25/106 (23%)
 Frame = +3

Query: 90  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYK----------- 236
           PVYKP  + P  Y      P  YKP    P     P        PP+YK           
Sbjct: 55  PVYKPMNKIPTSYISKKSYPAPYKPKGYHPTNSYQPTYGSKTNYPPIYKPVAKKLSSYKA 114

Query: 237 --------------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
                         PPVYK  +  PP YKP +  PP YKP    PP
Sbjct: 115 IKTTYLVYKAKTSYPPVYKHKITNPPTYKPKITYPPTYKPKPSYPP 160

[54][TOP]
>UniRef100_B4H1H8 GL22613 n=1 Tax=Drosophila persimilis RepID=B4H1H8_DROPE
          Length = 346

 Score =  117 bits (294), Expect = 3e-25
 Identities = 51/108 (47%), Positives = 74/108 (68%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP E+P   +PP E+PP  +PP E+PP  +PP + PP+ +PP E PP  +PP EKPP  
Sbjct: 224 EPPKEEPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPPKEEPPKEKPPKE 283

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PP E+PP  +PP  +PP  +P  E+PP  + P E+PP+ +PP+E+PP
Sbjct: 284 EPPKEEPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPPMEEPP 331

 Score =  117 bits (293), Expect = 4e-25
 Identities = 52/108 (48%), Positives = 73/108 (67%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP E+PP  +P  E+PP  +PP E+PP  +PP E+PP   PP+E+PP   PP E+PP  
Sbjct: 219 EPPKEEPPKEEPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPPKEEPPKE 278

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP E+PP  +PP  +PP  +PP E+P   +PP E+ P  +PP+E+PP
Sbjct: 279 KPPKEEPPKEEPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPP 326

 Score =  114 bits (285), Expect = 3e-24
 Identities = 50/106 (47%), Positives = 73/106 (68%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +P  E+PP  +PP E+PP  +PP E+PP   PP+E+PP   PP E+PP  KPP E+PP  
Sbjct: 229 EPRKEEPPKEEPPKEEPPKEEPPQEEPPKDDPPMEEPPKEVPPKEEPPKEKPPKEEPPKE 288

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           +PP E+PP  +PP  +P   +PP E+ P  +PP+E+PP+ +PP+E+
Sbjct: 289 EPPKEEPPKEEPPKEEPRKEEPPKEELPQEEPPMEEPPMEEPPMEE 334

[55][TOP]
>UniRef100_C5Z6N9 Putative uncharacterized protein Sb10g025210 n=1 Tax=Sorghum
           bicolor RepID=C5Z6N9_SORBI
          Length = 309

 Score =  117 bits (293), Expect = 4e-25
 Identities = 57/107 (53%), Positives = 65/107 (60%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+  PPV +PPV  PPV  PP+  
Sbjct: 95  PPVTRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVTYPPITG 152

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PPV  PPV  PP+  PP   PP+  PP   PPV  PPV  PP
Sbjct: 153 PPT-TPPVVGPPVTYPPITGPPSTTPPITGPPSTTPPVTGPPVTYPP 198

 Score =  102 bits (254), Expect = 1e-20
 Identities = 52/113 (46%), Positives = 60/113 (53%), Gaps = 4/113 (3%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +PPV +PPV  PPV  PP+  PPV +PPV  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 110 VTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPP 168

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPP----VYKPPVEKPPVYKPPVEKP 329
           +  PP+  PP+  PP   PPV  PPV  PP        P   PP    P   P
Sbjct: 169 ITGPPSTTPPITGPPSTTPPVTGPPVTYPPGGGGGSSTPCPPPPPPSTPTPTP 221

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 49/93 (52%), Positives = 55/93 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           K PV +PPV +PPV  PPV  PP+  PPV +PPV  PPV  PP+  PP   PPV  PPV 
Sbjct: 107 KGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVT 165

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPP 287
            PP   PP   PP+  PP   PPV  PPV  PP
Sbjct: 166 YPPITGPPSTTPPITGPPSTTPPVTGPPVTYPP 198

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 56/140 (40%), Positives = 63/140 (45%), Gaps = 32/140 (22%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKP-------------------PVYK-------------PPVEKPP 92
           KP   KP    PP  KP                   P Y              PPV +PP
Sbjct: 42  KPKAPKPSHSHPPKTKPSHPSPSPSPKPKNPKPPKGPAYPAPGHQQPPKSPSYPPVTRPP 101

Query: 93  VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPP 272
           V  PP  K PV +PPV +PPV  PPV  PP+  PP  +PPV  PPV  PP+  PP   PP
Sbjct: 102 VVGPP--KGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVTYPPITGPPT-TPP 158

Query: 273 VYKPPVEKPPVYKPPVEKPP 332
           V  PPV  PP+  PP   PP
Sbjct: 159 VVGPPVTYPPITGPPSTTPP 178

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 50/113 (44%), Positives = 56/113 (49%), Gaps = 19/113 (16%)
 Frame = +3

Query: 51  EKPPVYKPPVEKPPVYKP------PVEKPPVYKPPVEKPPVYK-------------PPVE 173
           +KP   KP    PP  KP      P  KP   KPP  K P Y              PPV 
Sbjct: 41  DKPKAPKPSHSHPPKTKPSHPSPSPSPKPKNPKPP--KGPAYPAPGHQQPPKSPSYPPVT 98

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PPV  PP  K PV +PPV +PPV  PPV  PP+  PPV +PPV  PPV  PP
Sbjct: 99  RPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPIIGPPVTRPPVVGPPVTYPP 149

[56][TOP]
>UniRef100_Q5DNZ7 Putative proline-rich protein (Fragment) n=1 Tax=Nicotiana tabacum
           RepID=Q5DNZ7_TOBAC
          Length = 195

 Score =  116 bits (291), Expect = 7e-25
 Identities = 58/107 (54%), Positives = 66/107 (61%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 2   PPVVKPPINLPPVV-PPVIKPPIGIPPVTVPPVVKPPINLPPVV-PPVIKPPIGIPPVTV 59

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  KPP+  PP+ KPP+  PP+  PPV  PPV  P     P   PP
Sbjct: 60  PPVLKPPIGLPPIVKPPINLPPIGIPPVTVPPVITPSPKGKPCPPPP 106

 Score =  116 bits (291), Expect = 7e-25
 Identities = 58/108 (53%), Positives = 66/108 (61%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PP
Sbjct: 4   VVKPPINLPPVV-PPVIKPPIGIPPVTVPPVVKPPINLPPVV-PPVIKPPIGIPPVTVPP 61

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           V KPP   PP+ KPP+  PP+  PPV  PPV  P  +  P   PP  K
Sbjct: 62  VLKPPIGLPPIVKPPINLPPIGIPPVTVPPVITPSPKGKPCPPPPTTK 109

[57][TOP]
>UniRef100_B4I114 GM12332 n=1 Tax=Drosophila sechellia RepID=B4I114_DROSE
          Length = 1214

 Score =  115 bits (289), Expect = 1e-24
 Identities = 44/107 (41%), Positives = 63/107 (58%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            +PP E PP Y PP  +PP  +PP  +PP  +PP  +PP ++PP  +PP  +PP  +PP  
Sbjct: 1078 QPPTE-PPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQPPTV 1136

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            +PP  +PP  +PP  +PP  +PP   PP  +PP  + P  +PP   P
Sbjct: 1137 QPPTVQPPTNQPPTVQPPTVQPPTHHPPTNEPPTNRSPTKRPPSPSP 1183

 Score =  110 bits (276), Expect = 4e-23
 Identities = 42/107 (39%), Positives = 64/107 (59%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP + P   +PP   PP  +PP  +PP ++PP  +PP  +PP  +PP  +PP  +PP  +
Sbjct: 1075 PPTQPPT--EPPSYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQ 1132

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP  +PP  +PP  +PP  +PP  +PP + PP  +PP  + P ++PP
Sbjct: 1133 PPTVQPPTVQPPTNQPPTVQPPTVQPPTHHPPTNEPPTNRSPTKRPP 1179

 Score =  108 bits (270), Expect = 2e-22
 Identities = 39/98 (39%), Positives = 58/98 (59%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
            Y PP  +PP  +PP  +PP  +PP  +PP ++PP  +PP  +PP  +PP  +PP  +PP 
Sbjct: 1086 YGPPTNEPPTVQPPTHQPPTVQPPTVQPPTHQPPTVQPPTVQPPTNQPPTVQPPTVQPPT 1145

Query: 186  YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP 299
             +PP  +PP  +PP + PP  +PP  + P  +PP   P
Sbjct: 1146 NQPPTVQPPTVQPPTHHPPTNEPPTNRSPTKRPPSPSP 1183

[58][TOP]
>UniRef100_Q9FUR7 ENOD2 (Fragment) n=1 Tax=Styphnolobium japonicum RepID=Q9FUR7_SOPJA
          Length = 269

 Score =  115 bits (287), Expect = 2e-24
 Identities = 67/129 (51%), Positives = 82/129 (63%), Gaps = 21/129 (16%)
 Frame = +3

Query: 6   YKPP--VEKPPVYKPP--VEKPPVYKPPVEK---PPVYKPP--VEKPPVYKPPVEK--PP 152
           Y+PP  V+ PPVY+PP  V+ PPVY+PP      PP Y+PP  V+ PPVY+PP  +  PP
Sbjct: 141 YQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHHVKPPPVYQPPPHEKPPP 200

Query: 153 VYKPPVEK--PPVYKPPAEK--PPVYKPP--VYKPPVYKPPVEK--PPVYKPPVEK--PP 302
           VY+PP  +  PPVY PP E   PP Y+PP  V  PP Y+PP  +  PPVY PP  +  PP
Sbjct: 201 VYQPPHHEIPPPVYPPPRENKPPPEYQPPPHVKPPPAYQPPPHEKPPPVYPPPHHEKPPP 260

Query: 303 VYKPPVEKP 329
            Y PP EKP
Sbjct: 261 AYPPPHEKP 269

 Score =  114 bits (286), Expect = 3e-24
 Identities = 68/132 (51%), Positives = 87/132 (65%), Gaps = 22/132 (16%)
 Frame = +3

Query: 3   VYKPPVEK--PPVYKPPVEK--PPVYKPP--VEKPPVYKPP--VEKPPVYKPPVEK---P 149
           VY PP  +  PPV++PP  +  PP Y+PP  V+ PPVY+PP  V+ PPVY+PP      P
Sbjct: 116 VYPPPHHEKPPPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPP 175

Query: 150 PVYKPP--VEKPPVYKPPAEK--PPVYKPPVYK--PPVYKPPVEK--PPVYKPP--VEKP 299
           P Y+PP  V+ PPVY+PP  +  PPVY+PP ++  PPVY PP E   PP Y+PP  V+ P
Sbjct: 176 PEYQPPHHVKPPPVYQPPPHEKPPPVYQPPHHEIPPPVYPPPRENKPPPEYQPPPHVKPP 235

Query: 300 PVYKPPV-EKPP 332
           P Y+PP  EKPP
Sbjct: 236 PAYQPPPHEKPP 247

 Score =  112 bits (279), Expect = 2e-23
 Identities = 68/128 (53%), Positives = 83/128 (64%), Gaps = 21/128 (16%)
 Frame = +3

Query: 12  PPVEKPPV-YKPP--VEKPPVYKPP--VEKPPVYKPPVEK---PPVYKPP--VEKPPVYK 161
           PP EKPP  Y+PP  V+ PPVY+PP  V+ PPVY+PP      PP Y+PP  V+ PPVY+
Sbjct: 132 PPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHHVKPPPVYQ 191

Query: 162 PPVEK--PPVYKPPAEK--PPVYKPPVYK--PPVYKPP--VEKPPVYKPPVEK--PPVYK 311
           PP  +  PPVY+PP  +  PPVY PP     PP Y+PP  V+ PP Y+PP  +  PPVY 
Sbjct: 192 PPPHEKPPPVYQPPHHEIPPPVYPPPRENKPPPEYQPPPHVKPPPAYQPPPHEKPPPVYP 251

Query: 312 PP-VEKPP 332
           PP  EKPP
Sbjct: 252 PPHHEKPP 259

 Score =  110 bits (275), Expect = 5e-23
 Identities = 66/128 (51%), Positives = 86/128 (67%), Gaps = 21/128 (16%)
 Frame = +3

Query: 12  PPVEKPPV-YKPP--VEKPPVYKPP--VEKPPVYKPPVEK--PPVYKPPVEK--PPVYKP 164
           PP EKPP  Y+PP  V+ PP Y+PP  V+ PPVY+PP  +  PP Y+PP  +  PP Y+P
Sbjct: 48  PPHEKPPPEYQPPPHVKPPPAYQPPPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQP 107

Query: 165 P--VEKPPVYKPP--AEKPPVYKPPVYK--PPVYKPP--VEKPPVYKPP--VEKPPVYKP 314
           P  V+ PPVY PP   + PPV++PP ++  PP Y+PP  V+ PPVY+PP  V+ PPVY+P
Sbjct: 108 PHHVKPPPVYPPPHHEKPPPVHQPPPHEKPPPEYQPPPHVKPPPVYQPPPHVKPPPVYQP 167

Query: 315 PV--EKPP 332
           P   E PP
Sbjct: 168 PPHHEIPP 175

 Score =  107 bits (268), Expect = 3e-22
 Identities = 65/130 (50%), Positives = 84/130 (64%), Gaps = 20/130 (15%)
 Frame = +3

Query: 3   VYKPPVEK--PPVYKPPVEK--PPVYKPPVEK-PPVYKPPVEK--PPVYKPP--VEKPPV 155
           VY+PP  +  PP Y PP  +  PPVY  P EK PP Y+PP  +  PP Y+PP  V+ PP 
Sbjct: 9   VYQPPHHEKPPPAYPPPHHEIPPPVYPSPHEKPPPEYQPPPHEKPPPEYQPPPHVKPPPA 68

Query: 156 YKPP--VEKPPVYKPP--AEKPPVYKPPVYK--PPVYKPP--VEKPPVYKPP--VEKPPV 305
           Y+PP  V+ PPVY+PP   + PP Y+PP ++  PP Y+PP  V+ PPVY PP   + PPV
Sbjct: 69  YQPPPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHEKPPPV 128

Query: 306 YKPPV-EKPP 332
           ++PP  EKPP
Sbjct: 129 HQPPPHEKPP 138

 Score =  104 bits (260), Expect = 3e-21
 Identities = 62/123 (50%), Positives = 79/123 (64%), Gaps = 18/123 (14%)
 Frame = +3

Query: 18  VEKPPVYKPPVEK--PPVYKPPVEK--PPVYKPPVEKPPV-YKPPVEK--PPVYKPP--V 170
           V+ PPVY+PP  +  PP Y PP  +  PPVY  P EKPP  Y+PP  +  PP Y+PP  V
Sbjct: 4   VKPPPVYQPPHHEKPPPAYPPPHHEIPPPVYPSPHEKPPPEYQPPPHEKPPPEYQPPPHV 63

Query: 171 EKPPVYKPP--AEKPPVYKPPVYK--PPVYKPPVEK--PPVYKPP--VEKPPVYKPP-VE 323
           + PP Y+PP   + PPVY+PP ++  PP Y+PP  +  PP Y+PP  V+ PPVY PP  E
Sbjct: 64  KPPPAYQPPPHVKPPPVYQPPHHEKPPPEYQPPPHEKPPPEYQPPHHVKPPPVYPPPHHE 123

Query: 324 KPP 332
           KPP
Sbjct: 124 KPP 126

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 60/125 (48%), Positives = 73/125 (58%), Gaps = 26/125 (20%)
 Frame = +3

Query: 3   VYKPP--VEKPPVYKPP---------------VEKPPVYKPPVEK--PPVYKPPVEK--P 119
           VY+PP  V+ PPVY+PP               V+ PPVY+PP  +  PPVY+PP  +  P
Sbjct: 152 VYQPPPHVKPPPVYQPPPHHEIPPPEYQPPHHVKPPPVYQPPPHEKPPPVYQPPHHEIPP 211

Query: 120 PVYKPPVEK--PPVYKPP--VEKPPVYKPPA-EKPPVYKPPVYKPPVYKPPVEKPPVYKP 284
           PVY PP E   PP Y+PP  V+ PP Y+PP  EKP    PPVY PP ++ P   PP Y P
Sbjct: 212 PVYPPPRENKPPPEYQPPPHVKPPPAYQPPPHEKP----PPVYPPPHHEKP---PPAYPP 264

Query: 285 PVEKP 299
           P EKP
Sbjct: 265 PHEKP 269

[59][TOP]
>UniRef100_Q6PCS2 Zgc:64189 n=1 Tax=Danio rerio RepID=Q6PCS2_DANRE
          Length = 690

 Score =  114 bits (286), Expect = 3e-24
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 160 VSAPATERPPVSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 219

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 220 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 269

 Score =  114 bits (285), Expect = 3e-24
 Identities = 53/107 (49%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  
Sbjct: 153 PAPERPPVSAPATERPPVSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERPPVSA 212

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 213 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 259

 Score =  114 bits (284), Expect = 4e-24
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 170 VSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 229

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 230 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 279

 Score =  113 bits (282), Expect = 8e-24
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 180 VSAPATERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 239

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 240 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 289

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 190 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 249

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 250 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 299

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 200 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 259

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 260 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 309

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 210 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 269

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 270 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 319

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 220 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 279

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 280 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 329

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 230 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 289

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 290 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 339

 Score =  109 bits (272), Expect = 1e-22
 Identities = 53/110 (48%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 240 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 299

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+ P
Sbjct: 300 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSP 349

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/104 (47%), Positives = 60/104 (57%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 250 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 309

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+ P+  P
Sbjct: 310 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVP 353

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 46/106 (43%), Positives = 56/106 (52%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   P +  PV   
Sbjct: 489 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPA 548

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PA+  PV   P    PV   P + PPV   P + PPV   P + PP
Sbjct: 549 PAQLLPVPPAPAQLLPVPPAPAQLPPVPPVPAQLPPVPPAPAQLPP 594

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 45/105 (42%), Positives = 55/105 (52%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   P +  PV   P +  PV   
Sbjct: 499 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPAPAQLLPVPPA 558

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PA+  PV   P   PPV   P + PPV   P + PPV   PV+ P
Sbjct: 559 PAQLLPVPPAPAQLPPVPPVPAQLPPVPPAPAQLPPVPPAPVQLP 603

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 43/104 (41%), Positives = 52/104 (50%), Gaps = 14/104 (13%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 260 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 319

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPP--------------VEKPP 272
           V  P  E+PPV  P   +PPV  P               +  PP
Sbjct: 320 VSAPAPERPPVSAPAPERPPVSAPAPERSPMPVPVWLLALPAPP 363

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 45/110 (40%), Positives = 54/110 (49%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PPV   PV  PPV  PP    PV+ PPV   P +  PV   P +  PV   P +  P
Sbjct: 510 VQLPPVPPAPVQLPPV--PPA---PVQLPPVPPAPAQLLPVPPAPAQLLPVPPAPAQLLP 564

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   PA+ PPV   P   PPV   P + PPV   PV+ P   +P + KPP
Sbjct: 565 VPPAPAQLPPVPPVPAQLPPVPPAPAQLPPVPPAPVQLP--LQPALLKPP 612

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 38/106 (35%), Positives = 51/106 (48%)
 Frame = +2

Query: 8   QAPS*ETTSVQAPSREATGVQASS*EATRVQAPS*EATCLQTSGGEATSVQAPS*ETPSL 187
           +AP+ E   V AP+ E   V A + E   V AP+ E   +     E   V AP+ E P +
Sbjct: 151 KAPAPERPPVSAPATERPPVSAPATERPPVSAPATERPPVSAPAPERPPVSAPAPERPPV 210

Query: 188 QAPGGEAPSLQAPGLQATGVQAPS*EATSVQAPS*EATCVQAPS*E 325
            AP  E P + AP  +   V AP+ E   V AP+ E   V AP+ E
Sbjct: 211 SAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPE 256

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 35/104 (33%), Positives = 49/104 (47%)
 Frame = +2

Query: 5   LQAPS*ETTSVQAPSREATGVQASS*EATRVQAPS*EATCLQTSGGEATSVQAPS*ETPS 184
           + AP+ E   V AP+ E   V A + E   V AP+ E   +     E   V AP+ E P 
Sbjct: 250 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 309

Query: 185 LQAPGGEAPSLQAPGLQATGVQAPS*EATSVQAPS*EATCVQAP 316
           + AP  E P + AP  +   V AP+ E   V AP+ E + +  P
Sbjct: 310 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVP 353

[60][TOP]
>UniRef100_Q94G50 Proline-rich protein-2 n=1 Tax=Gossypium hirsutum
           RepID=Q94G50_GOSHI
          Length = 310

 Score =  113 bits (282), Expect = 8e-24
 Identities = 59/125 (47%), Positives = 75/125 (60%), Gaps = 15/125 (12%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY PP ++ P  KPPV +PP  + P  KP VY PP ++ P  KP V +PP  + P  KPP
Sbjct: 97  VYTPPKKERPEPKPPVYEPPKKEKPKPKPSVYTPPKKEKPEPKPLVYEPPKKEKPEPKPP 156

Query: 183 VYKPPAEKPPVYKPPVYKPP----------VYKPPVE-----KPPVYKPPVEKPPVYKPP 317
           VY PP ++ P  KPP+Y+PP          VY PP +     KPPVY+PP +KPPVY+P 
Sbjct: 157 VYTPPKKEKPEPKPPMYEPPKKEKLEPKPLVYAPPKKEKPEPKPPVYEPP-KKPPVYEPK 215

Query: 318 VEKPP 332
             KPP
Sbjct: 216 PPKPP 220

 Score =  113 bits (282), Expect = 8e-24
 Identities = 68/158 (43%), Positives = 85/158 (53%), Gaps = 48/158 (30%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVE-------- 143
           VY PP ++ P  KP V +PP  + P  KPPVY PP +     KPP+Y+PP +        
Sbjct: 127 VYTPPKKEKPEPKPLVYEPPKKEKPEPKPPVYTPPKKEKPEPKPPMYEPPKKEKLEPKPL 186

Query: 144 ------------KPPVYKPPVEKPPVYKPPAEKPPVY----------KPPVY----KPPV 245
                       KPPVY+PP +KPPVY+P   KPPVY          KPP+Y    KPP+
Sbjct: 187 VYAPPKKEKPEPKPPVYEPP-KKPPVYEPKPPKPPVYASPKKEKPEPKPPMYEPPNKPPM 245

Query: 246 YKPPVEKPPVYKPPVE-----KPPVY----KPPVEKPP 332
           Y+P  +K PVY PP +     KPP+Y    KPPV KPP
Sbjct: 246 YEPKPQKSPVYVPPKKEKPEPKPPMYEPPKKPPVHKPP 283

 Score =  112 bits (281), Expect = 1e-23
 Identities = 66/142 (46%), Positives = 81/142 (57%), Gaps = 32/142 (22%)
 Frame = +3

Query: 3   VYKPPV-------EKPPVYKPPVEKPPVYKPPV----------EKPPVYKPP-VEKP--- 119
           VYKPP         KPPVY+PP ++ P  KPPV           KPPVY+PP  EKP   
Sbjct: 35  VYKPPKVKPPPYEHKPPVYEPPKKEKPEPKPPVYTSPKKDKPEPKPPVYEPPKKEKPEPK 94

Query: 120 -PVYKPPVE-----KPPVYKPPVE-----KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEK 266
            PVY PP +     KPPVY+PP +     KP VY PP ++ P  KP VY+PP  + P  K
Sbjct: 95  SPVYTPPKKERPEPKPPVYEPPKKEKPKPKPSVYTPPKKEKPEPKPLVYEPPKKEKPEPK 154

Query: 267 PPVYKPPVEKPPVYKPPVEKPP 332
           PPVY PP ++ P  KPP+ +PP
Sbjct: 155 PPVYTPPKKEKPEPKPPMYEPP 176

 Score =  110 bits (275), Expect = 5e-23
 Identities = 62/120 (51%), Positives = 73/120 (60%), Gaps = 12/120 (10%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPP 167
           KPP    PVYKPP  KPP Y  KPPV +PP  + P  KPPVY  P +     KPPVY+PP
Sbjct: 30  KPPT---PVYKPPKVKPPPYEHKPPVYEPPKKEKPEPKPPVYTSPKKDKPEPKPPVYEPP 86

Query: 168 -VEKP----PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             EKP    PVY PP ++ P  KPPVY+PP  + P  KP VY PP ++ P  KP V +PP
Sbjct: 87  KKEKPEPKSPVYTPPKKERPEPKPPVYEPPKKEKPKPKPSVYTPPKKEKPEPKPLVYEPP 146

 Score =  109 bits (273), Expect = 8e-23
 Identities = 62/133 (46%), Positives = 77/133 (57%), Gaps = 25/133 (18%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE----- 173
           KPPV +PP  + P  KP VY PP ++ P  KP V +PP  + P  KPPVY PP +     
Sbjct: 109 KPPVYEPPKKEKPKPKPSVYTPPKKEKPEPKPLVYEPPKKEKPEPKPPVYTPPKKEKPEP 168

Query: 174 KPPVYKPPAE-----KPPVYKPPVY-----KPPVYKPPVEKPPVYKPPVEKPPVY----- 308
           KPP+Y+PP +     KP VY PP       KPPVY+PP +KPPVY+P   KPPVY     
Sbjct: 169 KPPMYEPPKKEKLEPKPLVYAPPKKEKPEPKPPVYEPP-KKPPVYEPKPPKPPVYASPKK 227

Query: 309 -----KPPVEKPP 332
                KPP+ +PP
Sbjct: 228 EKPEPKPPMYEPP 240

[61][TOP]
>UniRef100_UPI000180B733 PREDICTED: similar to cell wall proline-rich protein n=1 Tax=Ciona
           intestinalis RepID=UPI000180B733
          Length = 1425

 Score =  112 bits (281), Expect = 1e-23
 Identities = 54/107 (50%), Positives = 54/107 (50%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   PPV K P   PPV K P   PPV K P   PPV K P   PPV K     PPV K
Sbjct: 660 PPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVK 719

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PA  PPV K P   PPV K P   PPV K P   PPV K P   PP
Sbjct: 720 SPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPP 766

 Score =  109 bits (273), Expect = 8e-23
 Identities = 54/110 (49%), Positives = 54/110 (49%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V K P   PPV K P   PPV K P   PPV K P   PPV K     PPV K P   PP
Sbjct: 667 VVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVKSPAGNPP 726

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V K PA  PPV K P   PPV K P   PPV K P   PPV K P    P
Sbjct: 727 VVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNSP 776

 Score =  108 bits (271), Expect = 1e-22
 Identities = 54/110 (49%), Positives = 54/110 (49%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V K P   PPV K P   PPV K P   PPV K     PPV K P   PPV K P   PP
Sbjct: 677  VVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPP 736

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V K PA  PPV K P   PPV K P   PPV K P    PV K P   PP
Sbjct: 737  VVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNSPVGKSPAGNPP 786

 Score =  106 bits (265), Expect = 7e-22
 Identities = 54/110 (49%), Positives = 54/110 (49%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V K P   PPV K P   PPV K     PPV K P   PPV K P   PPV K P   PP
Sbjct: 687  VVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPP 746

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V K PA  PPV K P   PPV K P    PV K P   PPV K P E  P
Sbjct: 747  VVKSPAGNPPVVKSPAGNPPVVKSPAGNSPVGKSPAGNPPVVKLPAENFP 796

 Score =  106 bits (265), Expect = 7e-22
 Identities = 54/110 (49%), Positives = 54/110 (49%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V K P   PPV K     PPV K P   PPV K P   PPV K P   PPV K P   PP
Sbjct: 697  VVKSPAGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPP 756

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V K PA  PPV K P    PV K P   PPV K P E  PV K P   PP
Sbjct: 757  VVKSPAGNPPVVKSPAGNSPVGKSPAGNPPVVKLPAENFPVVKSPAGNPP 806

 Score =  105 bits (261), Expect = 2e-21
 Identities = 52/107 (48%), Positives = 52/107 (48%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP    P   PP   PPV K P   PPV K P   PPV K P   PPV K P   PPV K
Sbjct: 650 PPGLTLPARIPPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVK 709

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             A  PPV K P   PPV K P   PPV K P   PPV K P   PP
Sbjct: 710 SSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPP 756

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 52/103 (50%), Positives = 52/103 (50%), Gaps = 5/103 (4%)
 Frame = +3

Query: 12   PPVEK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
            PPV K     PPV K P   PPV K P   PPV K P   PPV K P   PPV K P   
Sbjct: 705  PPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGN 764

Query: 177  PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPV 305
            PPV K PA   PV K P   PPV K P E  PV K P   PPV
Sbjct: 765  PPVVKSPAGNSPVGKSPAGNPPVVKLPAENFPVVKSPAGNPPV 807

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 50/105 (47%), Positives = 50/105 (47%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           VEK     PP    P   PP   PPV K P   PPV K P   PPV K P   PPV K P
Sbjct: 642 VEKVSNRNPPGLTLPARIPPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSP 701

Query: 198 AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           A  PPV K     PPV K P   PPV K P   PPV K P   PP
Sbjct: 702 AGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPP 746

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 45/91 (49%), Positives = 45/91 (49%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V K P   PPV K P   PPV K P   PPV K P   PPV K P   PPV K P    P
Sbjct: 717 VVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNPPVVKSPAGNSP 776

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPV 275
           V K PA  PPV K P    PV K P   PPV
Sbjct: 777 VGKSPAGNPPVVKLPAENFPVVKSPAGNPPV 807

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 47/106 (44%), Positives = 47/106 (44%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P    P     VEK     PP    P   PP   PPV K P   PPV K P   PPV K 
Sbjct: 631 PTGNLPFTDANVEKVSNRNPPGLTLPARIPPAGNPPVVKSPAGNPPVVKSPAGNPPVVKS 690

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PA  PPV K P   PPV K     PPV K P   PPV K P   PP
Sbjct: 691 PAGNPPVVKSPAGNPPVVKSSAGNPPVVKSPAGNPPVVKSPAGNPP 736

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 44/104 (42%), Positives = 44/104 (42%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           E  P    P    P     VEK     PP    P   PP   PPV K P   PPV K PA
Sbjct: 623 ESSPYVSNPTGNLPFTDANVEKVSNRNPPGLTLPARIPPAGNPPVVKSPAGNPPVVKSPA 682

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PPV K P   PPV K P   PPV K     PPV K P   PP
Sbjct: 683 GNPPVVKSPAGNPPVVKSPAGNPPVVKSSAGNPPVVKSPAGNPP 726

[62][TOP]
>UniRef100_UPI00017611C2 PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI00017611C2
          Length = 653

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 153 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 212

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 213 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 262

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 163 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 222

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 223 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 272

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 173 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 232

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 233 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 282

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 183 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 242

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 243 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 292

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 193 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 252

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 253 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 302

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 203 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 262

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 263 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 312

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 213 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 272

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 273 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 322

 Score =  111 bits (277), Expect = 3e-23
 Identities = 54/110 (49%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 143 VSAPAPEHPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 202

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 203 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 252

 Score =  109 bits (272), Expect = 1e-22
 Identities = 52/104 (50%), Positives = 62/104 (59%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           E+PPV  P  E PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 139 ERPPVSAPAPEHPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 198

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 199 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 242

 Score =  109 bits (272), Expect = 1e-22
 Identities = 53/110 (48%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 223 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 282

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+ P
Sbjct: 283 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSP 332

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/104 (47%), Positives = 60/104 (57%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 233 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 292

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+ P+  P
Sbjct: 293 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVP 336

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/105 (44%), Positives = 57/105 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV+ PPV   PV+ P V   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   
Sbjct: 463 PVQLPPVPPAPVQLP-VPPDPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPA 521

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PA+  PV   P    PV   P + PPV   P + PPV   PV+ P
Sbjct: 522 PAQLLPVPPAPAQLLPVPPAPAQLPPVPPAPAQLPPVPPAPVQLP 566

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 43/104 (41%), Positives = 52/104 (50%), Gaps = 14/104 (13%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 243 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 302

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPP--------------VEKPP 272
           V  P  E+PPV  P   +PPV  P               +  PP
Sbjct: 303 VSAPAPERPPVSAPAPERPPVSAPAPERSPMPVPVWLLALPAPP 346

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/139 (33%), Positives = 57/139 (41%), Gaps = 34/139 (24%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV----------------------------- 110
           V +PP  +P      +   PV  P    PPV                             
Sbjct: 74  VRRPPFSEPLESLLELCGTPVSAPAPECPPVSAPAPEQDPSPDHNTLPSQTTRRRRHRKR 133

Query: 111 -----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPV 275
                E+PPV  P  E PPV  P  E+PPV  P  E+PPV  P   +PPV  P  E+PPV
Sbjct: 134 TAHVPERPPVSAPAPEHPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 193

Query: 276 YKPPVEKPPVYKPPVEKPP 332
             P  E+PPV  P  E+PP
Sbjct: 194 SAPAPERPPVSAPAPERPP 212

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 41/96 (42%), Positives = 50/96 (52%)
 Frame = +3

Query: 45  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKP 224
           PV+ PPV   PV+ P V   PV+ PPV   PV+ PPV   PV+ PPV   P + PPV   
Sbjct: 463 PVQLPPVPPAPVQLP-VPPDPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPA 521

Query: 225 PVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P    PV   P +  PV   P + PPV   P + PP
Sbjct: 522 PAQLLPVPPAPAQLLPVPPAPAQLPPVPPAPAQLPP 557

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 43/100 (43%), Positives = 51/100 (51%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PPV   PV  PPV  PP    PV+ PPV   PV+ PPV   P +  PV   P +  P
Sbjct: 483 VQLPPVPPAPVQLPPV--PPA---PVQLPPVPPAPVQLPPVPPAPAQLLPVPPAPAQLLP 537

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP 302
           V   PA+ PPV   P   PPV   PV+ P   +P + KPP
Sbjct: 538 VPPAPAQLPPVPPAPAQLPPVPPAPVQLP--LQPALLKPP 575

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 35/104 (33%), Positives = 49/104 (47%)
 Frame = +2

Query: 5   LQAPS*ETTSVQAPSREATGVQASS*EATRVQAPS*EATCLQTSGGEATSVQAPS*ETPS 184
           + AP+ E   V AP+ E   V A + E   V AP+ E   +     E   V AP+ E P 
Sbjct: 233 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 292

Query: 185 LQAPGGEAPSLQAPGLQATGVQAPS*EATSVQAPS*EATCVQAP 316
           + AP  E P + AP  +   V AP+ E   V AP+ E + +  P
Sbjct: 293 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVP 336

[63][TOP]
>UniRef100_UPI000175F23A PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI000175F23A
          Length = 661

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 197 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 256

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 257 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 306

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 207 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 266

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 267 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 316

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 217 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 276

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 277 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 326

 Score =  110 bits (275), Expect = 5e-23
 Identities = 52/104 (50%), Positives = 63/104 (60%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 193 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 252

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 253 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 296

 Score =  109 bits (272), Expect = 1e-22
 Identities = 53/110 (48%), Positives = 64/110 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 227 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 286

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+ P
Sbjct: 287 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSP 336

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/104 (47%), Positives = 60/104 (57%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 237 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 296

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+ P+  P
Sbjct: 297 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVP 340

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 47/105 (44%), Positives = 57/105 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   P +  PV   
Sbjct: 470 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPA 529

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PA+ PP    P   PPV   P + PPV   P + PPV   PV+ P
Sbjct: 530 PAQLPPASPVPAQLPPVPPAPAQLPPVPPAPAQLPPVPPAPVQLP 574

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 49/110 (44%), Positives = 59/110 (53%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP+  PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PP
Sbjct: 458 VQLPPL--PPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPP 515

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   PA+  PV   P   PP    P + PPV   P + PPV   P + PP
Sbjct: 516 VPPAPAQLLPVPPAPAQLPPASPVPAQLPPVPPAPAQLPPVPPAPAQLPP 565

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 49/113 (43%), Positives = 50/113 (44%), Gaps = 3/113 (2%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   P    PV   P
Sbjct: 471 VQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPAQLLPVPPAP 530

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPV---YKPPVEKPP 332
              PPA   P   PPV   P   PPV   P   PPV   PV    +P   KPP
Sbjct: 531 AQLPPASPVPAQLPPVPPAPAQLPPVPPAPAQLPPVPPAPVQLPLQPAFLKPP 583

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 43/104 (41%), Positives = 52/104 (50%), Gaps = 14/104 (13%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 247 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 306

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPP--------------VEKPP 272
           V  P  E+PPV  P   +PPV  P               +  PP
Sbjct: 307 VSAPAPERPPVSAPAPERPPVSAPAPERSPMPVPVWLLALPAPP 350

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 47/139 (33%), Positives = 58/139 (41%), Gaps = 34/139 (24%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV----------------------------- 110
           V +PP  +P      +   PV  P    PPV                             
Sbjct: 128 VRRPPFSEPLESLLELCGTPVSAPAPECPPVSAPAPEQDPSPDDNTLPSQTTRRRRHRKR 187

Query: 111 -----EKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPV 275
                E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P   +PPV  P  E+PPV
Sbjct: 188 TAHVPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 247

Query: 276 YKPPVEKPPVYKPPVEKPP 332
             P  E+PPV  P  E+PP
Sbjct: 248 SAPAPERPPVSAPAPERPP 266

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 35/104 (33%), Positives = 49/104 (47%)
 Frame = +2

Query: 5   LQAPS*ETTSVQAPSREATGVQASS*EATRVQAPS*EATCLQTSGGEATSVQAPS*ETPS 184
           + AP+ E   V AP+ E   V A + E   V AP+ E   +     E   V AP+ E P 
Sbjct: 237 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 296

Query: 185 LQAPGGEAPSLQAPGLQATGVQAPS*EATSVQAPS*EATCVQAP 316
           + AP  E P + AP  +   V AP+ E   V AP+ E + +  P
Sbjct: 297 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSPMPVP 340

[64][TOP]
>UniRef100_UPI0000F1E1DC PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI0000F1E1DC
          Length = 665

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 197 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 256

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 257 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 306

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 207 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 266

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 267 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 316

 Score =  112 bits (280), Expect = 1e-23
 Identities = 54/110 (49%), Positives = 65/110 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 217 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 276

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 277 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 326

 Score =  110 bits (275), Expect = 5e-23
 Identities = 52/104 (50%), Positives = 63/104 (60%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 193 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 252

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 253 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 296

 Score =  106 bits (264), Expect = 9e-22
 Identities = 52/107 (48%), Positives = 62/107 (57%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 227 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 286

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E
Sbjct: 287 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPE 333

 Score =  104 bits (259), Expect = 4e-21
 Identities = 53/106 (50%), Positives = 63/106 (59%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   
Sbjct: 439 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPA 498

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P + PPV   PV  PPV   PV+ PPV   PV+ PPV   PV+ PP
Sbjct: 499 PVQLPPVPPAPVQLPPVTPAPVQLPPVPPAPVQLPPVPPAPVQLPP 544

 Score =  104 bits (259), Expect = 4e-21
 Identities = 53/106 (50%), Positives = 63/106 (59%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   
Sbjct: 449 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPAPVQLPPVPPA 508

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P + PPV   PV  PPV   PV+ PPV   PV+ PPV   PV+ PP
Sbjct: 509 PVQLPPVTPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPP 554

 Score =  104 bits (259), Expect = 4e-21
 Identities = 53/106 (50%), Positives = 63/106 (59%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   
Sbjct: 459 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPAPVQLPPVPPAPVQLPPVTPA 518

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P + PPV   PV  PPV   PV+ PPV   PV+ PPV   PV+ PP
Sbjct: 519 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPP 564

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 54/110 (49%), Positives = 54/110 (49%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   P
Sbjct: 460 VQLPPVPPAPVQLPPVPPAPVQLPPVPPTPVQLPPVPPAPVQLPPVPPAPVQLPPVTPAP 519

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP    PV  PPV   PV  PPV   PV  PPV   PV  PPV   P
Sbjct: 520 VQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAP 569

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 51/103 (49%), Positives = 61/103 (59%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   PV+ PPV   
Sbjct: 469 PVQLPPVPPAPVQLPPVPPTPVQLPPVPPAPVQLPPVPPAPVQLPPVTPAPVQLPPVPPA 528

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           P + PPV   PV  PPV   PV+ PPV   PV+ PPV   PV+
Sbjct: 529 PVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQ 571

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/113 (47%), Positives = 56/113 (49%), Gaps = 3/113 (2%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   PV  PPV   P
Sbjct: 470 VQLPPVPPAPVQLPPVPPTPVQLPPVPPAPVQLPPVPPAPVQLPPVTPAPVQLPPVPPAP 529

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPV---YKPPVEKPP 332
           V  PP    PV  PPV   PV  PPV   PV  PPV   PV    +P + KPP
Sbjct: 530 VQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLPPVPPAPVQLHLQPALLKPP 582

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 44/139 (31%), Positives = 56/139 (40%), Gaps = 34/139 (24%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV------------------- 140
           +E  P  +  V +PP  +P      +   PV  P    PPV                   
Sbjct: 118 LELRPYPRRAVRRPPFSEPLESLLELCGTPVSAPVPQCPPVSAPAPEQAPSPDDNTLPSQ 177

Query: 141 ---------------EKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPV 275
                          E+PPV  P  E+PPV  P  E+PPV  P   +PPV  P  E+PPV
Sbjct: 178 TPRRRRHRRRTAHVPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPV 237

Query: 276 YKPPVEKPPVYKPPVEKPP 332
             P  E+PPV  P  E+PP
Sbjct: 238 SAPAPERPPVSAPAPERPP 256

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 38/109 (34%), Positives = 52/109 (47%)
 Frame = +2

Query: 5   LQAPS*ETTSVQAPSREATGVQASS*EATRVQAPS*EATCLQTSGGEATSVQAPS*ETPS 184
           + AP+ E   V AP+ E   V A + E   V AP+ E   +     E   V AP+ E P 
Sbjct: 227 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 286

Query: 185 LQAPGGEAPSLQAPGLQATGVQAPS*EATSVQAPS*EATCVQAPS*EAT 331
           + AP  E P + AP  +   V AP+ E   V AP+ E   V AP+ E +
Sbjct: 287 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPECS 335

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 35/104 (33%), Positives = 49/104 (47%)
 Frame = +2

Query: 5   LQAPS*ETTSVQAPSREATGVQASS*EATRVQAPS*EATCLQTSGGEATSVQAPS*ETPS 184
           + AP+ E   V AP+ E   V A + E   V AP+ E   +     E   V AP+ E P 
Sbjct: 237 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 296

Query: 185 LQAPGGEAPSLQAPGLQATGVQAPS*EATSVQAPS*EATCVQAP 316
           + AP  E P + AP  +   V AP+ E   V AP+ E + +  P
Sbjct: 297 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPECSSMPVP 340

[65][TOP]
>UniRef100_Q9M7P1 Proline-rich protein 1 n=1 Tax=Arabidopsis thaliana
           RepID=Q9M7P1_ARATH
          Length = 335

 Score =  112 bits (280), Expect = 1e-23
 Identities = 62/121 (51%), Positives = 65/121 (53%), Gaps = 12/121 (9%)
 Frame = +3

Query: 3   VYKPPVEKP----PVYKPPVEKP----PVYKPPVEK----PPVYKPPVEKPPVYKPPVEK 146
           VY  PV KP    PVY PPV KP    PVY PPV K    PPVY  P   PP Y PPV  
Sbjct: 32  VYTSPVNKPTLPPPVYTPPVHKPTLPPPVYTPPVHKPTLSPPVYTKPTLPPPAYTPPVYN 91

Query: 147 PPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
            P    PV  PPVYKP    PPVY  P   PPV+KP +  PPVY  P   P VYKP +  
Sbjct: 92  KPTLPAPVYTPPVYKPTL-SPPVYTKPTLLPPVFKPTL-SPPVYTKPTLSPTVYKPTLSP 149

Query: 327 P 329
           P
Sbjct: 150 P 150

 Score =  111 bits (277), Expect = 3e-23
 Identities = 62/121 (51%), Positives = 65/121 (53%), Gaps = 12/121 (9%)
 Frame = +3

Query: 3   VYKPPVEKP----PVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 158
           VY PPV KP    PVY PPV KP    PVY  P   PP Y PPV   P    PV  PPVY
Sbjct: 46  VYTPPVHKPTLPPPVYTPPVHKPTLSPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVY 105

Query: 159 KPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYK----PPVEKPPVYKPPVEK 326
           KP +  PPVY  P   PPV+KP +  PPVY  P   P VYK    PPV   P   PPV K
Sbjct: 106 KPTL-SPPVYTKPTLLPPVFKPTL-SPPVYTKPTLSPTVYKPTLSPPVNNKPSLSPPVYK 163

Query: 327 P 329
           P
Sbjct: 164 P 164

 Score =  100 bits (250), Expect = 4e-20
 Identities = 53/102 (51%), Positives = 58/102 (56%)
 Frame = +3

Query: 27  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEK 206
           PPVY  PV KP +       PPVY PPV KP +  PPV  PPV+KP +  PPVY  P   
Sbjct: 30  PPVYTSPVNKPTL------PPPVYTPPVHKPTL-PPPVYTPPVHKPTLS-PPVYTKPTLP 81

Query: 207 PPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP Y PPVY  P    PV  PPVYKP +  PPVY  P   PP
Sbjct: 82  PPAYTPPVYNKPTLPAPVYTPPVYKPTL-SPPVYTKPTLLPP 122

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 58/122 (47%), Positives = 63/122 (51%), Gaps = 14/122 (11%)
 Frame = +3

Query: 3   VYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---------PVE 143
           VY PPV KP    PVY  P   PPV+KP +  PPVY  P   P VYKP         P  
Sbjct: 99  VYTPPVYKPTLSPPVYTKPTLLPPVFKPTLS-PPVYTKPTLSPTVYKPTLSPPVNNKPSL 157

Query: 144 KPPVYKPPVEKPPVYKPPAEKPPVY-KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 320
            PPVYKP +  PPVY  P   PPVY K P+Y PP   PP    P Y PP  KP  Y P +
Sbjct: 158 SPPVYKPTL-SPPVYTKPTLPPPVYKKSPIYSPP---PPFAPKPTYTPPT-KP--YVPEI 210

Query: 321 EK 326
            K
Sbjct: 211 IK 212

[66][TOP]
>UniRef100_Q9FZ35 Proline-rich protein 1 n=1 Tax=Arabidopsis thaliana
           RepID=Q9FZ35_ARATH
          Length = 335

 Score =  112 bits (280), Expect = 1e-23
 Identities = 62/121 (51%), Positives = 65/121 (53%), Gaps = 12/121 (9%)
 Frame = +3

Query: 3   VYKPPVEKP----PVYKPPVEKP----PVYKPPVEK----PPVYKPPVEKPPVYKPPVEK 146
           VY  PV KP    PVY PPV KP    PVY PPV K    PPVY  P   PP Y PPV  
Sbjct: 32  VYTSPVNKPTLPPPVYTPPVHKPTLPPPVYTPPVHKPTLSPPVYTKPTLPPPAYTPPVYN 91

Query: 147 PPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
            P    PV  PPVYKP    PPVY  P   PPV+KP +  PPVY  P   P VYKP +  
Sbjct: 92  KPTLPAPVYTPPVYKPTL-SPPVYTKPTLLPPVFKPTL-SPPVYTKPTLSPTVYKPTLSP 149

Query: 327 P 329
           P
Sbjct: 150 P 150

 Score =  111 bits (277), Expect = 3e-23
 Identities = 62/121 (51%), Positives = 65/121 (53%), Gaps = 12/121 (9%)
 Frame = +3

Query: 3   VYKPPVEKP----PVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 158
           VY PPV KP    PVY PPV KP    PVY  P   PP Y PPV   P    PV  PPVY
Sbjct: 46  VYTPPVHKPTLPPPVYTPPVHKPTLSPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVY 105

Query: 159 KPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYK----PPVEKPPVYKPPVEK 326
           KP +  PPVY  P   PPV+KP +  PPVY  P   P VYK    PPV   P   PPV K
Sbjct: 106 KPTL-SPPVYTKPTLLPPVFKPTL-SPPVYTKPTLSPTVYKPTLSPPVNNKPSLSPPVYK 163

Query: 327 P 329
           P
Sbjct: 164 P 164

 Score =  100 bits (250), Expect = 4e-20
 Identities = 53/102 (51%), Positives = 58/102 (56%)
 Frame = +3

Query: 27  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEK 206
           PPVY  PV KP +       PPVY PPV KP +  PPV  PPV+KP +  PPVY  P   
Sbjct: 30  PPVYTSPVNKPTL------PPPVYTPPVHKPTL-PPPVYTPPVHKPTLS-PPVYTKPTLP 81

Query: 207 PPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP Y PPVY  P    PV  PPVYKP +  PPVY  P   PP
Sbjct: 82  PPAYTPPVYNKPTLPAPVYTPPVYKPTL-SPPVYTKPTLLPP 122

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 58/122 (47%), Positives = 62/122 (50%), Gaps = 14/122 (11%)
 Frame = +3

Query: 3   VYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---------PVE 143
           VY PPV KP    PVY  P   PPV+KP +  PPVY  P   P VYKP         P  
Sbjct: 99  VYTPPVYKPTLSPPVYTKPTLLPPVFKPTLS-PPVYTKPTLSPTVYKPTLSPPVNNKPSL 157

Query: 144 KPPVYKPPVEKPPVYKPPAEKPPVY-KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 320
            PPVYKP +  PPVY  P   PPVY K P Y PP   PP    P Y PP  KP  Y P +
Sbjct: 158 SPPVYKPTL-SPPVYTKPTLPPPVYKKSPSYSPP---PPFAPKPTYTPPT-KP--YVPEI 210

Query: 321 EK 326
            K
Sbjct: 211 IK 212

[67][TOP]
>UniRef100_P93705 Hypocotil specific n=1 Tax=Daucus carota RepID=P93705_DAUCA
          Length = 347

 Score =  112 bits (280), Expect = 1e-23
 Identities = 57/107 (53%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  KP  +KPP  KPPV KPP+ KPPV KPPV KPPV KPP+ KPP+ KPP   PP+  
Sbjct: 20  PPHHKPAPHKPPTVKPPVVKPPIVKPPVVKPPVVKPPVVKPPIVKPPIVKPPGLLPPIL- 78

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP   PP   PP   PP+  PP   PP   PP   PP   PP
Sbjct: 79  PPGILPPGVLPPGVLPPGVLPPL--PPGVLPPGILPPGVLPPGVLPP 123

 Score =  112 bits (279), Expect = 2e-23
 Identities = 57/109 (52%), Positives = 63/109 (57%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           +KP   KPP  KPPV KPP+ KPPV KPPV KPPV KPP+ KPP+ KPP   PP+  PP 
Sbjct: 23  HKPAPHKPPTVKPPVVKPPIVKPPVVKPPVVKPPVVKPPIVKPPIVKPPGLLPPI-LPPG 81

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PP   PP   PP   PP+  PP   PP   PP   PP   PP   PP
Sbjct: 82  ILPPGVLPPGVLPPGVLPPL--PPGVLPPGILPPGVLPPGVLPPGVVPP 128

 Score =  107 bits (268), Expect = 3e-22
 Identities = 56/104 (53%), Positives = 62/104 (59%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           EKPP    P  KP  +KPP  KPPV KPP+ KPPV KPPV KPPV KPP+ KPP+ KPP 
Sbjct: 17  EKPP----PHHKPAPHKPPTVKPPVVKPPIVKPPVVKPPVVKPPVVKPPIVKPPIVKPPG 72

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PP+  PP   PP   PP   PP   PP+  PP   PP   PP
Sbjct: 73  LLPPIL-PPGILPPGVLPPGVLPPGVLPPL--PPGVLPPGILPP 113

 Score =  100 bits (249), Expect = 5e-20
 Identities = 54/110 (49%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPP+ KPPV KPPV KPPV KPP+ KPP+ KPP   PP+  PP   PP   PP   PP
Sbjct: 37  VVKPPIVKPPVVKPPVVKPPVVKPPIVKPPIVKPPGLLPPIL-PPGILPPGVLPPGVLPP 95

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PP   PP   PP   PP   PP   PP   PP++ P    PP   PP
Sbjct: 96  GVLPPL--PPGVLPPGILPPGVLPPGVLPPGVVPPIKPPGGLLPPGVLPP 143

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 56/156 (35%), Positives = 65/156 (41%), Gaps = 47/156 (30%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP------- 164
           +KPP  KPPV KPP+ KPPV KPPV KPPV KPP+ KPP+ KPP   PP+  P       
Sbjct: 28  HKPPTVKPPVVKPPIVKPPVVKPPVVKPPVVKPPIVKPPIVKPPGLLPPILPPGILPPGV 87

Query: 165 ----------------------------------------PVEKPPVYKPPAEKPPVYKP 224
                                                   P++ P    PP   PP   P
Sbjct: 88  LPPGVLPPGVLPPLPPGVLPPGILPPGVLPPGVLPPGVVPPIKPPGGLLPPGVLPPGVLP 147

Query: 225 PVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P   PP+  PP   PP   PP+  PP   PP   PP
Sbjct: 148 PGVLPPL--PPGVLPPGVLPPL--PPGVLPPGVLPP 179

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 47/108 (43%), Positives = 49/108 (45%), Gaps = 1/108 (0%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVY 188
           PP   PP+  PP   PP   PP+  PP   PP   PP   PP  KPP    PP   PP  
Sbjct: 147 PPGVLPPL--PPGVLPPGVLPPL--PPGVLPPGVLPPGVLPPGIKPPGGLLPPGVLPPGV 202

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP   PP   PP   PP   PP  KPPV  PP  KPP    P
Sbjct: 203 LPPGILPPGILPPGVLPPGILPPGILPPGVKPPV-LPPTTKPPSPGTP 249

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 44/102 (43%), Positives = 45/102 (44%), Gaps = 1/102 (0%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           PP+  PP   PP   PP   PP  KPP    PP   PP   PP   PP   PP   PP  
Sbjct: 165 PPL--PPGVLPPGVLPPGVLPPGIKPPGGLLPPGVLPPGVLPPGILPPGILPPGVLPPGI 222

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
            PP   PP  KPPV  PP  KPP    P   PP  K P   P
Sbjct: 223 LPPGILPPGVKPPVL-PPTTKPPSPGTPC--PPGAKTPPSAP 261

[68][TOP]
>UniRef100_UPI000175F187 PREDICTED: hypothetical protein n=1 Tax=Danio rerio
           RepID=UPI000175F187
          Length = 557

 Score =  112 bits (279), Expect = 2e-23
 Identities = 53/107 (49%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  
Sbjct: 136 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSA 195

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 196 PAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 242

 Score =  107 bits (266), Expect = 5e-22
 Identities = 52/108 (48%), Positives = 63/108 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 143 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 202

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+
Sbjct: 203 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPER 250

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 51/111 (45%), Positives = 62/111 (55%), Gaps = 2/111 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 153 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 212

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP--PVYKPPVEKP 329
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+   PV   P+  P
Sbjct: 213 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERSTMPVPVRPLALP 263

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/109 (42%), Positives = 57/109 (52%), Gaps = 4/109 (3%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV+ PPV   PV+  PV   PV+ PPV   PV+ PPV   P + PP    P + PP    
Sbjct: 373 PVQLPPVPPAPVQLLPVPPAPVQLPPVPPAPVQLPPVPPAPAQLPPA---PAQLPPA--- 426

Query: 195 PAEKPP----VYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PA+ PP    +   P   PPV   PV+ PPV   PV+ PPV   PV+ P
Sbjct: 427 PAQLPPAPAQLPPAPAQLPPVPPAPVQLPPVPPAPVQLPPVPSAPVQLP 475

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 39/99 (39%), Positives = 45/99 (45%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PPV   PV  PPV   P   PP         P + PP    P + PP    P + PP
Sbjct: 394 VQLPPVPPAPVQLPPVPPAPAQLPPA--------PAQLPPA---PAQLPPA---PAQLPP 439

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP 299
               PA+ PPV   PV  PPV   PV+ PPV   PV+ P
Sbjct: 440 A---PAQLPPVPPAPVQLPPVPPAPVQLPPVPSAPVQLP 475

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 38/105 (36%), Positives = 50/105 (47%)
 Frame = +2

Query: 11  APS*ETTSVQAPSREATGVQASS*EATRVQAPS*EATCLQTSGGEATSVQAPS*ETPSLQ 190
           AP+ E   V AP+ E   V A + E   V AP+ E   +     E   V AP+ E P + 
Sbjct: 135 APAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVS 194

Query: 191 APGGEAPSLQAPGLQATGVQAPS*EATSVQAPS*EATCVQAPS*E 325
           AP  E P + AP  +   V AP+ E   V AP+ E   V AP+ E
Sbjct: 195 APAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPE 239

[69][TOP]
>UniRef100_A8DV67 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis
           RepID=A8DV67_NEMVE
          Length = 140

 Score =  112 bits (279), Expect = 2e-23
 Identities = 61/109 (55%), Positives = 75/109 (68%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KP V KP V+KP V KP V+KP V +P V+KP V +P V+KP V KP V+KP   KP 
Sbjct: 7   VHKPRVLKPLVHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPL 66

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V+KP   KP V+KP V+KP V+KP V KP V+KP V KP V+ P V KP
Sbjct: 67  VHKPCVHKPCVHKPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKP 115

 Score =  110 bits (276), Expect = 4e-23
 Identities = 60/109 (55%), Positives = 74/109 (67%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KP V KP V+KP V +P V+KP V +P V+KP V KP V+KP   KP V+KP V KP 
Sbjct: 17  VHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPLVHKPCVHKPC 76

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V+KP   KP V+KP V+KP V+KP V KP V+ P V KP V +P V KP
Sbjct: 77  VHKPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQPHVHKP 125

 Score =  110 bits (275), Expect = 5e-23
 Identities = 60/109 (55%), Positives = 70/109 (64%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KP V KP V +P V KP V +P V KP V KP V KP   KP V KP V+KP V KP 
Sbjct: 22  VLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPLVHKPCVHKPCVHKPC 81

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V+KP   KP V+KP V+KP V+KP V  P V+KP V +P V+KP V KP
Sbjct: 82  VHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQPHVHKPLVNKP 130

 Score =  109 bits (273), Expect = 8e-23
 Identities = 61/105 (58%), Positives = 74/105 (70%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV K  V+KP V KP V+KP V KP V+KP V +P V+KP V +P V+KP V KP V+KP
Sbjct: 1   PVHKLLVHKPRVLKPLVHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKP 60

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            A KP V+KP V+KP V+KP V KP V+KP V KP V+KP V KP
Sbjct: 61  RALKPLVHKPCVHKPCVHKPCVHKPCVHKPCVHKPCVHKPRVHKP 105

 Score =  109 bits (272), Expect = 1e-22
 Identities = 60/109 (55%), Positives = 69/109 (63%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KP V KP V KP V KP V +P V KP V +P V KP V KP V KP   KP V KP 
Sbjct: 12  VLKPLVHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPLVHKPC 71

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V+KP   KP V+KP V+KP V+KP V KP V+KP V  P V+KP V +P
Sbjct: 72  VHKPCVHKPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQP 120

 Score =  109 bits (272), Expect = 1e-22
 Identities = 60/109 (55%), Positives = 73/109 (66%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+KP V +P V+KP V +P V+KP V KP V+KP   KP V+KP V KP V+KP V KP 
Sbjct: 27  VHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPLVHKPCVHKPCVHKPCVHKPC 86

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V+KP   KP V+KP V+KP V+ P V KP V +P V KP V KP V KP
Sbjct: 87  VHKPCVHKPCVHKPRVHKPLVHNPRVHKPRVLQPHVHKPLVNKPRVLKP 135

 Score =  108 bits (269), Expect = 2e-22
 Identities = 59/109 (54%), Positives = 69/109 (63%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +P V KP V +P V KP V KP V KP   KP V KP V+KP V KP V+KP V KP 
Sbjct: 32  VLEPLVHKPCVLEPLVHKPCVLKPCVHKPRALKPLVHKPCVHKPCVHKPCVHKPCVHKPC 91

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V+KP   KP V+KP V+ P V+KP V +P V+KP V KP V KP   KP
Sbjct: 92  VHKPCVHKPRVHKPLVHNPRVHKPRVLQPHVHKPLVNKPRVLKPLALKP 140

 Score =  107 bits (268), Expect = 3e-22
 Identities = 60/109 (55%), Positives = 68/109 (62%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+K  V KP V KP V KP V KP V KP V +P V KP V +P V KP V KP V KP 
Sbjct: 2   VHKLLVHKPRVLKPLVHKPRVLKPLVHKPCVLEPLVHKPCVLEPLVHKPCVLKPCVHKPR 61

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
             KP   KP V+KP V+KP V+KP V KP V+KP V KP V+KP V  P
Sbjct: 62  ALKPLVHKPCVHKPCVHKPCVHKPCVHKPCVHKPCVHKPRVHKPLVHNP 110

[70][TOP]
>UniRef100_A7S8Z4 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis
           RepID=A7S8Z4_NEMVE
          Length = 160

 Score =  112 bits (279), Expect = 2e-23
 Identities = 61/111 (54%), Positives = 71/111 (63%), Gaps = 2/111 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEK 176
           V+KP V KP V+KP   KP V+KP V KP V+KP V KP V+ P V KP   V+KP V K
Sbjct: 47  VHKPRVLKPCVHKPRALKPCVHKPCVHKPRVHKPRVHKPLVHNPRVHKPRPHVHKPRVHK 106

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           P V+KP   KP V+KP V KP   KP V  P V+KP V KP V+KP V KP
Sbjct: 107 PRVHKPRVLKPHVHKPRVLKPLALKPLVNNPRVHKPRVHKPHVHKPSVHKP 157

 Score =  108 bits (269), Expect = 2e-22
 Identities = 61/111 (54%), Positives = 69/111 (62%), Gaps = 2/111 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+K  V KP V KP + KP VYKP V KP V+KP V KP   KP V KP V KP V KP 
Sbjct: 2   VHKLLVHKPRVLKPLLHKPRVYKPCVLKPLVHKPRVLKPRALKPLVHKPRVLKPCVHKPR 61

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKP 329
             KP   KP V+KP V+KP V+KP V  P V+K  P V KP V+KP V KP
Sbjct: 62  ALKPCVHKPCVHKPRVHKPRVHKPLVHNPRVHKPRPHVHKPRVHKPRVHKP 112

 Score =  105 bits (263), Expect = 1e-21
 Identities = 59/108 (54%), Positives = 65/108 (60%), Gaps = 2/108 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP--VEKPPVYKPPVEK 176
           V KP V KP   KP V KP V+KP V KP V+KP V  P V+KP   V KP V+KP V K
Sbjct: 52  VLKPCVHKPRALKPCVHKPCVHKPRVHKPRVHKPLVHNPRVHKPRPHVHKPRVHKPRVHK 111

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 320
           P V KP   KP V KP   KP V  P V KP V+KP V KP V+KP V
Sbjct: 112 PRVLKPHVHKPRVLKPLALKPLVNNPRVHKPRVHKPHVHKPSVHKPRV 159

 Score =  105 bits (261), Expect = 2e-21
 Identities = 60/107 (56%), Positives = 70/107 (65%), Gaps = 2/107 (1%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV K  V+KP V KP ++KP V KP V KP V KP V KP   KP V+KP V KP V+KP
Sbjct: 1   PVHKLLVHKPRVLKPLLHKPRVYKPCVLKPLVHKPRVLKPRALKPLVHKPRVLKPCVHKP 60

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKP 329
            A KP V+KP V+KP V+KP V KP V+ P V K  P V+KP V KP
Sbjct: 61  RALKPCVHKPCVHKPRVHKPRVHKPLVHNPRVHKPRPHVHKPRVHKP 107

 Score =  102 bits (253), Expect = 2e-20
 Identities = 56/104 (53%), Positives = 66/104 (63%), Gaps = 2/104 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEK 176
           V+KP   KP V+KP V KP V+KP V KP V+ P V KP   V+KP V KP V+KP V K
Sbjct: 57  VHKPRALKPCVHKPCVHKPRVHKPRVHKPLVHNPRVHKPRPHVHKPRVHKPRVHKPRVLK 116

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
           P V+KP   KP   KP V  P V+KP V KP V+KP V KP V+
Sbjct: 117 PHVHKPRVLKPLALKPLVNNPRVHKPRVHKPHVHKPSVHKPRVH 160

[71][TOP]
>UniRef100_UPI00019859A1 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI00019859A1
          Length = 377

 Score =  111 bits (277), Expect = 3e-23
 Identities = 56/112 (50%), Positives = 57/112 (50%), Gaps = 2/112 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           VY PP   P  YK P   PPVYK   P   PPVY PP   P  YK P   PPVY PP   
Sbjct: 66  VYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHP 125

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P  YK P   PPVY PP + P  YK P   PPVY PP   P  YK P   PP
Sbjct: 126 PYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPP 177

 Score =  110 bits (275), Expect = 5e-23
 Identities = 56/113 (49%), Positives = 58/113 (51%), Gaps = 5/113 (4%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK P   PPVY PP   P  YK P   PPVY PP   P  YK P   PPVY PP   P  
Sbjct: 89  YKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYK 148

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYK-----PPVEKPPVYKPPVEKP 329
           YK P   PPVY PP + P  YK P   PPVYK     PP +KP  YK P   P
Sbjct: 149 YKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPP 201

 Score =  110 bits (274), Expect = 6e-23
 Identities = 58/115 (50%), Positives = 59/115 (51%), Gaps = 7/115 (6%)
 Frame = +3

Query: 6   YKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           YK P   PPVYK   P   PPVY PP   P  YK P   PPVY PP   P  YK P   P
Sbjct: 77  YKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPP 136

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEKP 329
           PVY PP   P  YK P   PPVY PP   P  YK P   PPVYK     PP +KP
Sbjct: 137 PVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKP 191

 Score =  109 bits (273), Expect = 8e-23
 Identities = 57/113 (50%), Positives = 58/113 (51%), Gaps = 4/113 (3%)
 Frame = +3

Query: 6   YKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVE 173
           YK P   PPVYK   P   PPVY PP   P  YK P   PPV  YK P   PPVY PP  
Sbjct: 45  YKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHH 104

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P  YK P   PPVY PP + P  YK P   PPVY PP   P  YK P   PP
Sbjct: 105 PPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPP 157

 Score =  104 bits (259), Expect = 4e-21
 Identities = 56/111 (50%), Positives = 56/111 (50%), Gaps = 3/111 (2%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKP 179
           YK P   PPVY PP   P  YK P   PPVYK   P   PPVY PP   P  YK P   P
Sbjct: 57  YKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPPPPPPVYSPPHHPPYKYKSPPPPP 116

Query: 180 PVYKPPAEKPPV-YKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PVY  P   PP  YK P   PPVY PP   P  YK P   PPVY PP   P
Sbjct: 117 PVYS-PPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPP 166

 Score =  100 bits (249), Expect = 5e-20
 Identities = 54/110 (49%), Positives = 55/110 (50%), Gaps = 5/110 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY PP   P  YK P   PPVY PP   P  YK P   PPVY PP   P  YK P   PP
Sbjct: 98  VYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPP 157

Query: 183 VYKPPAEKPPVYKPPVYKPPVYK-----PPVEKPPVYKPPVEKPPVYKPP 317
           VY PP   P  YK P   PPVYK     PP +KP  YK P   PP Y  P
Sbjct: 158 VYSPPHHPPYKYKSPPPPPPVYKYKSPPPPHKKPYKYKSP--PPPPYNLP 205

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 60/140 (42%), Positives = 61/140 (43%), Gaps = 31/140 (22%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK P   PPVY PP   P  YK P   PPVY PP   P  YK P   PPVY PP   P  
Sbjct: 109 YKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYK 168

Query: 186 YKPPAEKPPVYK-----PPVYKPPVYKPP-----------------VEKPPVYK--PPVE 293
           YK P   PPVYK     PP  KP  YK P                  + PP YK   P  
Sbjct: 169 YKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPP 228

Query: 294 KPPVYK-------PPVEKPP 332
            PPVYK       PPV  PP
Sbjct: 229 PPPVYKYKSPPPPPPVHSPP 248

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 50/104 (48%), Positives = 51/104 (49%), Gaps = 2/104 (1%)
 Frame = +3

Query: 27  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPA 200
           P  YK P   PPVYK        YK P   PPVY PP   P  YK P   PPV  YK P 
Sbjct: 42  PYYYKSPPPPPPVYK--------YKSPPPPPPVYSPPHHPPYKYKSPPPPPPVYKYKSPP 93

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PPVY PP + P  YK P   PPVY PP   P  YK P   PP
Sbjct: 94  PPPPVYSPPHHPPYKYKSPPPPPPVYSPPHHPPYKYKSPPPPPP 137

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 54/116 (46%), Positives = 55/116 (47%), Gaps = 7/116 (6%)
 Frame = +3

Query: 6   YKPPVEKPPVYK--PPVEKPPVYKPPVEKPPV-YKPPVEKPPVYK----PPVEKPPVYKP 164
           YK P   PPVYK   P   PPV+ PP   PP  YK P   PPVYK    PP   P  YK 
Sbjct: 223 YKSPPPPPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKS 282

Query: 165 PVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P   P  YK P   P  YK P   P  YK P   PPVYK     PPVYK     PP
Sbjct: 283 PPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPP 338

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 57/129 (44%), Positives = 59/129 (45%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYK---PPVEKPPV-----------YKPPV 140
           YK P   PPV+ PP   PP  YK P   PPVYK   PP   PP            YK P 
Sbjct: 235 YKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPP 294

Query: 141 EKPPVYKPPVEKPPVYKPPAEKPPVYK-----PPVYKPPVYKPPVEKPPVYKPPVEKPPV 305
             P  YK P   P  YK P   PPVYK     PPVYK   YK P   P +YK P   PPV
Sbjct: 295 PPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYK---YKSPPPPPYMYKSPPPPPPV 351

Query: 306 YKPPVEKPP 332
           YK     PP
Sbjct: 352 YKYKSPPPP 360

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 52/120 (43%), Positives = 54/120 (45%), Gaps = 11/120 (9%)
 Frame = +3

Query: 6   YKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           YK P   PPVYK    PP   P  YK P   P  YK P   P  YK P   P  YK P  
Sbjct: 256 YKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPYKYKSPPPPPLQYKSPPPPPYKYKSPPP 315

Query: 174 KPPVYKPPAEKPPVYK-------PPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PPVYK  +  PPVYK       P +YK P   PPV K   YK P   PP Y      PP
Sbjct: 316 PPPVYKYKSPPPPVYKYKSPPPPPYMYKSPPPPPPVYK---YKSPPPPPPKYYYSSPPPP 372

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 56/139 (40%), Positives = 59/139 (42%), Gaps = 31/139 (22%)
 Frame = +3

Query: 6   YKPPVEKPPVYK-----PPVEKPPVYKPP-----------------VEKPPVYK--PPVE 113
           YK P   PPVYK     PP +KP  YK P                  + PP YK   P  
Sbjct: 169 YKSPPPPPPVYKYKSPPPPHKKPYKYKSPPPPPYNLPSGTSADEYEYKSPPPYKYKSPPP 228

Query: 114 KPPV--YKPPVEKPPVYKPPVEKPPV-YKPPAEKPPVYK----PPVYKPPVYKPPVEKPP 272
            PPV  YK P   PPV+ PP   PP  YK P   PPVYK    PP   P  YK P   P 
Sbjct: 229 PPPVYKYKSPPPPPPVHSPPPPPPPYKYKSPPPPPPVYKYKSPPPPSPPYKYKSPPPPPY 288

Query: 273 VYKPPVEKPPVYKPPVEKP 329
            YK P   P  YK P   P
Sbjct: 289 KYKSPPPPPLQYKSPPPPP 307

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 43/104 (41%), Positives = 44/104 (42%), Gaps = 3/104 (2%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK P   P  YK P   P  YK P   PPVYK     PPVYK        YK P   P +
Sbjct: 290 YKSPPPPPLQYKSPPPPPYKYKSPPPPPPVYKYKSPPPPVYK--------YKSPPPPPYM 341

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVY---KPPVEKPPVY 308
           YK P   PPVYK        YK P   PP Y    PP   P  Y
Sbjct: 342 YKSPPPPPPVYK--------YKSPPPPPPKYYYSSPPPPPPHHY 377

[72][TOP]
>UniRef100_Q40336 Proline-rich cell wall protein n=1 Tax=Medicago sativa
           RepID=Q40336_MEDSA
          Length = 381

 Score =  110 bits (276), Expect = 4e-23
 Identities = 73/141 (51%), Positives = 78/141 (55%), Gaps = 33/141 (23%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEK----PPVYKPPVEKPPVY--------------KPP-VEKPPVY- 128
           KPP   PP+ KPPV K     P  KPPV KPP Y              KPP V KPP + 
Sbjct: 34  KPPTHHPPIVKPPVHKRRKYSPTPKPPVHKPPRYPPKPSPCPPPSSTPKPPHVPKPPHHP 93

Query: 129 KPPVEKPP-VYKPPVEKPPVYKPPAEKPPVYKPP-VYKPPVYKPP--VEKPPVYKPP-VE 293
           KPPV  PP V KPPV  P V KPP  KPP+  PP V KPPV KPP  V KPPV +PP V 
Sbjct: 94  KPPVVHPPHVPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPPYVP 153

Query: 294 KPPVY--------KPPVEKPP 332
           KPPV         KPPV +PP
Sbjct: 154 KPPVVPVTPPYVPKPPVVRPP 174

 Score =  110 bits (276), Expect = 4e-23
 Identities = 68/135 (50%), Positives = 78/135 (57%), Gaps = 25/135 (18%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVY--KPPVEKPP-VYKPP- 167
           V+ P V KPPV+ P V KPP+ KPP+  PP V KPPV KPP Y  KPPV +PP V KPP 
Sbjct: 98  VHPPHVPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPPYVPKPPV 157

Query: 168 -------VEKPPVYKPP-AEKPPVY--------KPPVYKPPVYKPP-VEKPPVYKPP--- 287
                  V KPPV +PP   KPPV         KPP+ KPP+  PP V  PPV   P   
Sbjct: 158 VPVTPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPIVKPPIVFPPHVPLPPVVPSPPPY 217

Query: 288 VEKPPVYKPPVEKPP 332
           V  PP+ KPP+  PP
Sbjct: 218 VPSPPIVKPPIVFPP 232

 Score =  109 bits (273), Expect = 8e-23
 Identities = 71/143 (49%), Positives = 80/143 (55%), Gaps = 34/143 (23%)
 Frame = +3

Query: 6   YKPPVEKPPVYK----PPVEKPPVYKPP--------------------VEKPPVY-KPPV 110
           + PP+ KPPV+K     P  KPPV+KPP                    V KPP + KPPV
Sbjct: 38  HHPPIVKPPVHKRRKYSPTPKPPVHKPPRYPPKPSPCPPPSSTPKPPHVPKPPHHPKPPV 97

Query: 111 EKPP-VYKPPVEKPPVYKPPVEKPPVYKPP-AEKPPVYKPPVY--KPPVYKPP-VEKPPV 275
             PP V KPPV  P V KPP+ KPP+  PP   KPPV KPP Y  KPPV +PP V KPPV
Sbjct: 98  VHPPHVPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVPKPPVVRPPYVPKPPV 157

Query: 276 Y---KPPVEKPPVYKPP-VEKPP 332
                P V KPPV +PP V KPP
Sbjct: 158 VPVTPPYVPKPPVVRPPYVPKPP 180

 Score =  108 bits (270), Expect = 2e-22
 Identities = 66/129 (51%), Positives = 74/129 (57%), Gaps = 23/129 (17%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYK----PPVEKPPVYKPP--------------VEKPP-VYKPP 137
           P  KPP + PP+ KPPV+K     P  KPPV+KPP                KPP V KPP
Sbjct: 31  PSPKPPTHHPPIVKPPVHKRRKYSPTPKPPVHKPPRYPPKPSPCPPPSSTPKPPHVPKPP 90

Query: 138 VE-KPPVYKPP-VEKPPVYKPPAEKPPVYKPPVYKPP-VYKPPVEKPPVYKPPVEKPPVY 308
              KPPV  PP V KPPV+ P   KPP+ KPP+  PP V KPPV KPP Y P   KPPV 
Sbjct: 91  HHPKPPVVHPPHVPKPPVHPPYVPKPPIVKPPIVHPPYVPKPPVVKPPPYVP---KPPVV 147

Query: 309 KPP-VEKPP 332
           +PP V KPP
Sbjct: 148 RPPYVPKPP 156

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 64/146 (43%), Positives = 73/146 (50%), Gaps = 36/146 (24%)
 Frame = +3

Query: 3   VYKPPVEKPPVY--KPPVEKPP-VYKPPV--------EKPPVYKPP-------------- 107
           V KPPV KPP Y  KPPV +PP V KPPV         KPPV +PP              
Sbjct: 129 VPKPPVVKPPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPVVRPPYVPKPPVVPVTPPY 188

Query: 108 VEKPPVYKPPVEKPP-VYKPP-VEKPPVYKPPAEKPPVYKPPVYKP---------PVYKP 254
           V KPP+ KPP+  PP V  PP V  PP Y P    PP+ KPP+  P         PV  P
Sbjct: 189 VPKPPIVKPPIVFPPHVPLPPVVPSPPPYVP---SPPIVKPPIVFPPHVPLPPVVPVTPP 245

Query: 255 PVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V+ PP+  PP   PP+  PPV  PP
Sbjct: 246 YVQPPPIVTPPTPTPPIVTPPVVSPP 271

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 56/134 (41%), Positives = 64/134 (47%), Gaps = 24/134 (17%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPP-VEKPPVY--------KPPVEKPPVYKPP--------------VE 113
           V  P V KPPV +PP V KPPV         KPP+ KPP+  PP              V 
Sbjct: 160 VTPPYVPKPPVVRPPYVPKPPVVPVTPPYVPKPPIVKPPIVFPPHVPLPPVVPSPPPYVP 219

Query: 114 KPPVYKPPVEKPP-VYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPV 290
            PP+ KPP+  PP V  PPV   PV  P  + PP+  PP   PP+  PPV  PP   PP 
Sbjct: 220 SPPIVKPPIVFPPHVPLPPV--VPVTPPYVQPPPIVTPPTPTPPIVTPPVVSPPT--PPS 275

Query: 291 EKPPVYKPPVEKPP 332
           E P    P V  PP
Sbjct: 276 ETPCPPPPLVPYPP 289

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 51/113 (45%), Positives = 60/113 (53%), Gaps = 5/113 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPP-VEKPPVYKPP---VEKPPVYKPPVEKPP-VYKPPVEKPPVYKPP 167
           V KPP+ KPP+  PP V  PPV   P   V  PP+ KPP+  PP V  PPV   PV  P 
Sbjct: 189 VPKPPIVKPPIVFPPHVPLPPVVPSPPPYVPSPPIVKPPIVFPPHVPLPPV--VPVTPPY 246

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           V+ PP+  PP   PP+  PPV  PP   PP E P    P V  PP   PP ++
Sbjct: 247 VQPPPIVTPPTPTPPIVTPPVVSPPT--PPSETPCPPPPLVPYPPT--PPAQQ 295

[73][TOP]
>UniRef100_O82066 Proline-rich protein n=1 Tax=Solanum tuberosum RepID=O82066_SOLTU
          Length = 491

 Score =  110 bits (276), Expect = 4e-23
 Identities = 81/180 (45%), Positives = 89/180 (49%), Gaps = 70/180 (38%)
 Frame = +3

Query: 3   VYKPPVEKPPV--YKP----PVEK-----------PPVYKPPVEKPPVYK------PPVE 113
           VYKP  + PPV  YKP    PV+K           PPV KP   K P YK      PPV 
Sbjct: 284 VYKPKPKPPPVPTYKPKPEPPVKKPCPPSVPKPKPPPVKKPCPPKVPTYKPKPKPEPPVV 343

Query: 114 KP-----PVYKPPVEKP-----PVYKPPVEKP-----PVYKPPAEKP-----PVYK---- 221
           KP     PVYKPPV KP     PVYKPPV KP     PVYKPP  KP     P+YK    
Sbjct: 344 KPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPIYKKPCP 403

Query: 222 --------PPVYKP-----PVYKPPVEKP-----PVYKPPVEKP-----PVYKPPVEKPP 332
                   PP+ KP     P+Y PPV KP     P+Y+PPV KP     P+YKPP  K P
Sbjct: 404 PFPHLPPLPPIVKPLPPPVPIYVPPVVKPLPPPVPIYEPPVVKPLPPPVPIYKPPFYKKP 463

 Score =  110 bits (275), Expect = 5e-23
 Identities = 71/131 (54%), Positives = 77/131 (58%), Gaps = 22/131 (16%)
 Frame = +3

Query: 3   VYKPPVEKPPV--YKPPVEKPPV--YKPPVEKPPV--YKP----PVEKP-PVYKPPVEKP 149
           VYKP  + PPV  YKP  + PPV  YKP  + PPV  YKP    PV+KP P   P  + P
Sbjct: 260 VYKPKPKPPPVPVYKPKPKPPPVPVYKPKPKPPPVPTYKPKPEPPVKKPCPPSVPKPKPP 319

Query: 150 PVYKPPVEKPPVYKP-PAEKPPVYKP-----PVYKPPVYKPPVEKPPVYKPPVEKP---- 299
           PV KP   K P YKP P  +PPV KP     PVYKPPV KP     PVYKPPV KP    
Sbjct: 320 PVKKPCPPKVPTYKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPP 379

Query: 300 -PVYKPPVEKP 329
            PVYKPPV KP
Sbjct: 380 VPVYKPPVVKP 390

 Score =  102 bits (253), Expect = 2e-20
 Identities = 67/130 (51%), Positives = 73/130 (56%), Gaps = 25/130 (19%)
 Frame = +3

Query: 3   VYKPPVEKPPV--YKPPVEKPPV--YKP----PVEKP-PVYKPPVEKPPVYKPPVEKPPV 155
           VYKP  + PPV  YKP  + PPV  YKP    PV+KP P   P  + PPV KP   K P 
Sbjct: 272 VYKPKPKPPPVPVYKPKPKPPPVPTYKPKPEPPVKKPCPPSVPKPKPPPVKKPCPPKVPT 331

Query: 156 YKP-PVEKPPVYKP-----PAEKPPVYKP-----PVYKPPVYKPPVEKPPVYKPPVEKP- 299
           YKP P  +PPV KP     P  KPPV KP     PVYKPPV KP     PVYKPPV KP 
Sbjct: 332 YKPKPKPEPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPL 391

Query: 300 ----PVYKPP 317
               P+YK P
Sbjct: 392 PPPVPIYKKP 401

 Score =  102 bits (253), Expect = 2e-20
 Identities = 70/155 (45%), Positives = 80/155 (51%), Gaps = 47/155 (30%)
 Frame = +3

Query: 9   KPPVEKP-----PVYKPPVEKP-----PVYKPPVEKP-----PVYKPPVEKP-----PVY 128
           +PPV KP     PVYKPPV KP     PVYKPPV KP     PVYKPPV KP     P+Y
Sbjct: 339 EPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPIY 398

Query: 129 K------------PPVEKP-----PVYKPPVEKP-----PVYKPPAEKP-----PVYKPP 227
           K            PP+ KP     P+Y PPV KP     P+Y+PP  KP     P+YKPP
Sbjct: 399 KKPCPPFPHLPPLPPIVKPLPPPVPIYVPPVVKPLPPPVPIYEPPVVKPLPPPVPIYKPP 458

Query: 228 VYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            YK P   PP+  PP  K P    P++ P   K P
Sbjct: 459 FYKKPC--PPL--PPFPKIPPFHHPLFPPLPPKIP 489

 Score =  102 bits (253), Expect = 2e-20
 Identities = 63/136 (46%), Positives = 72/136 (52%), Gaps = 27/136 (19%)
 Frame = +3

Query: 3   VYKPPVEKP-----PVYKPPVEKP-----PVYKPPVEKP-----PVYKPPVEK------- 116
           VYKPPV KP     PVYKPPV KP     PVYKPPV KP     P+YK P          
Sbjct: 352 VYKPPVVKPLPPPVPVYKPPVVKPLPPPVPVYKPPVVKPLPPPVPIYKKPCPPFPHLPPL 411

Query: 117 PPVYKPPVEKPPVYKPPVEKP-----PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYK 281
           PP+ KP     P+Y PPV KP     P+Y+PP  KP     P+YKPP YK P   PP+  
Sbjct: 412 PPIVKPLPPPVPIYVPPVVKPLPPPVPIYEPPVVKPLPPPVPIYKPPFYKKPC--PPL-- 467

Query: 282 PPVEKPPVYKPPVEKP 329
           PP  K P +  P+  P
Sbjct: 468 PPFPKIPPFHHPLFPP 483

[74][TOP]
>UniRef100_Q1MTH2 Novel protein (Fragment) n=1 Tax=Danio rerio RepID=Q1MTH2_DANRE
          Length = 201

 Score =  110 bits (275), Expect = 5e-23
 Identities = 52/104 (50%), Positives = 63/104 (60%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  
Sbjct: 61  ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAP 120

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 121 ERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 164

 Score =  105 bits (262), Expect = 2e-21
 Identities = 51/104 (49%), Positives = 61/104 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PPV  P  E+PP
Sbjct: 65  VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 124

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           V  P  E+PPV  P   +PPV  P  E+PPV  P  E+PPV  P
Sbjct: 125 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 168

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 37/104 (35%), Positives = 49/104 (47%)
 Frame = +2

Query: 5   LQAPS*ETTSVQAPSREATGVQASS*EATRVQAPS*EATCLQTSGGEATSVQAPS*ETPS 184
           + AP+ E   V AP+ E   V A + E   V AP+ E   +     E   V AP+ E P 
Sbjct: 65  VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 124

Query: 185 LQAPGGEAPSLQAPGLQATGVQAPS*EATSVQAPS*EATCVQAP 316
           + AP  E P + AP  +   V AP+ E   V AP+ E   V AP
Sbjct: 125 VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAP 168

[75][TOP]
>UniRef100_A6LW67 Cytochrome b5 n=1 Tax=Clostridium beijerinckii NCIMB 8052
           RepID=A6LW67_CLOB8
          Length = 325

 Score =  110 bits (275), Expect = 5e-23
 Identities = 55/110 (50%), Positives = 78/110 (70%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           GG + GG+ TGG + GG+ TGG ++GG+ TGG   GG+ TGG + GG+ TGG + GG+ T
Sbjct: 199 GGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGT 258

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*T 2
           GG + GG+ TGG ++GG+ TGG ++GG+ TGG + GG  TGG + GG+ T
Sbjct: 259 GGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGGTTGGGMGT 308

 Score =  107 bits (267), Expect = 4e-22
 Identities = 53/106 (50%), Positives = 75/106 (70%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           GG + GG+ TGG ++GG+ TGG + GG+ TGG   GG+ TGG + GG+ TGG + GG+ T
Sbjct: 209 GGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGT 268

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           GG ++GG+ TGG ++GG+ TGG + GG  TGG + GG+ TGG + G
Sbjct: 269 GGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGGTTGGGMGTGGTTRG 314

 Score =  105 bits (263), Expect = 1e-21
 Identities = 54/107 (50%), Positives = 58/107 (54%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           GG  TGG   GG  TGG  +GG  TGG   GG+ TGG   GG   GG   GG  TGG   
Sbjct: 204 GGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTGGGMGTGGTTG 263

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
           GG  TGG  +GG  TGG  +GG  TGG   GG  TGG   GG  TGG
Sbjct: 264 GGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGGTGTGGTTGGGMGTGG 310

 Score =  105 bits (262), Expect = 2e-21
 Identities = 52/102 (50%), Positives = 73/102 (71%)
 Frame = -2

Query: 316 GGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYTGGFST 137
           GG  TGG + GG+ TGG + GG+ TGG  +GG+ TGG + GG+ TGG + GG+ TGG + 
Sbjct: 194 GGPSTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTG 253

Query: 136 GGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
           GG+ TGG + GG+ TGG ++GG+ TGG ++GG+ TGG + GG
Sbjct: 254 GGMGTGGTTGGGMGTGGTTSGGMGTGGTTSGGMGTGGTTGGG 295

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 48/95 (50%), Positives = 68/95 (71%)
 Frame = -2

Query: 286 GGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYTGGFSTGGL*TGGFST 107
           GG  TGG + GG+ TGG   GG+ TGG ++GG+ TGG + GG+ TGG + GG+ TGG + 
Sbjct: 194 GGPSTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGMGTGGTTG 253

Query: 106 GGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*T 2
           GG+ TGG + GG+ TGG ++GG+ TGG ++GG+ T
Sbjct: 254 GGMGTGGTTGGGMGTGGTTSGGMGTGGTTSGGMGT 288

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 33/72 (45%), Positives = 48/72 (66%), Gaps = 1/72 (1%)
 Frame = -2

Query: 214 TGGFSAGGL*TGGFST-GGLYTGGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGL 38
           TG  +  G  + G +T GG+ TGG + GG+ TGG ++GG+ TGG + GG+ TGG + GG+
Sbjct: 187 TGATTLLGGPSTGGTTGGGMGTGGTTGGGMGTGGTTSGGMGTGGTTGGGMGTGGTTGGGM 246

Query: 37  YTGGFSTGGL*T 2
            TGG + GG+ T
Sbjct: 247 GTGGTTGGGMGT 258

[76][TOP]
>UniRef100_A8NQG1 Predicted protein n=1 Tax=Coprinopsis cinerea okayama7#130
           RepID=A8NQG1_COPC7
          Length = 418

 Score =  110 bits (274), Expect = 6e-23
 Identities = 76/129 (58%), Positives = 76/129 (58%), Gaps = 22/129 (17%)
 Frame = +3

Query: 9   KPPVE--KPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY-----KPPVEKPPV 155
           KPPVE  KPPV   KPPVE P   KPPVE P   KPPVE  KPPV      KPPVE P  
Sbjct: 110 KPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPPVEPPKPPVVPPFPPKPPVEPPAP 169

Query: 156 YKPPVE--KPPVYKPPAEKPPVY--KPPVYKPPVYKPPVEKPPVYKPPVE--KPPVY--- 308
            KPPVE  KPPV  P   KPPV   KPPV  P   KPPVE P   KPPVE  KPPV    
Sbjct: 170 PKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPF 229

Query: 309 --KPPVEKP 329
             KPPVE P
Sbjct: 230 PPKPPVEPP 238

 Score =  108 bits (271), Expect = 1e-22
 Identities = 75/126 (59%), Positives = 75/126 (59%), Gaps = 19/126 (15%)
 Frame = +3

Query: 9   KPPVE--KPPVY--KPPVE--KPPVY--KPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY 158
           KPPVE  KPPV   KPPVE  KPPV   KPPVE P   KPPVE P   KPPVE  KPPV 
Sbjct: 96  KPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPPVEPPKPPVV 155

Query: 159 KPPVEKPPVYKPPAEKPPVY--KPPVYKPPVYKPPVE--KPPVY-----KPPVEKPPVYK 311
            P   KPPV  P   KPPV   KPPV  P   KPPVE  KPPV      KPPVE P   K
Sbjct: 156 PPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPAPPK 215

Query: 312 PPVEKP 329
           PPVE P
Sbjct: 216 PPVEPP 221

 Score =  107 bits (266), Expect = 5e-22
 Identities = 75/132 (56%), Positives = 75/132 (56%), Gaps = 25/132 (18%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVE--KPPVY-----KPPVEKPPVYKPPVE--KPPVY-----KPPVE- 143
           KPPVE P   KPPVE  KPPV      KPPVE P   KPPVE  KPPV      KPPVE 
Sbjct: 134 KPPVEPPVPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEP 193

Query: 144 -KPPVYKPPVEKPPVYKPPAEKPPVY--KPPVYKPPVYKPPVE--KPPVY-----KPPVE 293
            KPPV  P   KPPV  P   KPPV   KPPV  P   KPPVE  KPPV      KPPVE
Sbjct: 194 PKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVE 253

Query: 294 KPPVYKPPVEKP 329
            P   KPPVE P
Sbjct: 254 PPVPPKPPVEPP 265

 Score =  101 bits (251), Expect = 3e-20
 Identities = 69/120 (57%), Positives = 69/120 (57%), Gaps = 12/120 (10%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVE--KPPVY-----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 167
           KPPVE P   KPPVE  KPPV      KPPVE P   KPPV  P   KPPVE P   KPP
Sbjct: 161 KPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPP---KPPVVPPFPPKPPVEPPAPPKPP 217

Query: 168 VE--KPPVYKPPAEKPPVY--KPPVYKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPP 332
           VE  KPPV  P   KPPV   KPPV  P   KPPVE P   KPPVE P P   PP  KPP
Sbjct: 218 VEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPVPPKPPVEPPKPTAVPP--KPP 275

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 69/123 (56%), Positives = 71/123 (57%), Gaps = 16/123 (13%)
 Frame = +3

Query: 9   KPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVY--KPPVE 173
           KPPV+ P P  +PP       KPPVE P   KPPVE P   KPPVE  KPPV   KPPVE
Sbjct: 61  KPPVDPPKPTVEPPKPTVAPPKPPVEPP---KPPVEPP---KPPVEPPKPPVEPPKPPVE 114

Query: 174 --KPPVY--KPPAEKPPVYKPPVYKPPVYKPPVE--KPPVY-----KPPVEKPPVYKPPV 320
             KPPV   KPP E P   KPPV  P   KPPVE  KPPV      KPPVE P   KPPV
Sbjct: 115 PPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPPVEPPKPPVVPPFPPKPPVEPPAPPKPPV 174

Query: 321 EKP 329
           E P
Sbjct: 175 EPP 177

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 64/119 (53%), Positives = 64/119 (53%), Gaps = 12/119 (10%)
 Frame = +3

Query: 9   KPPVE--KPPVY-----KPPVEKPPVYKPPVE--KPPVYKPPVEKPPVY--KPPVEKPPV 155
           KPPVE  KPPV      KPPVE P   KPPVE  KPPV  P   KPPV   KPPV  P  
Sbjct: 188 KPPVEPPKPPVVPPFPPKPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFP 247

Query: 156 YKPPVEKPPVYKPPAEKP-PVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            KPPVE P   KPP E P P   PP  KPPV  P   KP V  P   KPPV  P   KP
Sbjct: 248 PKPPVEPPVPPKPPVEPPKPTAVPP--KPPVVPPLPPKPTVVPP---KPPVVPPAPPKP 301

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 67/128 (52%), Positives = 67/128 (52%), Gaps = 21/128 (16%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVE--KPPVY-----KPPVE--KPPVY-----KPPVEKPPVYKPPVEK 146
           KPPVE P   KPPVE  KPPV      KPPVE  KPPV      KPPVE P   KPPVE 
Sbjct: 205 KPPVEPPAPPKPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPVPPKPPVEP 264

Query: 147 P-PVYKPPVEKPPVYKPPAEKPPVY--KPPVYKPPVYKPP--VEKPPVYKPPVEKPPVY- 308
           P P   PP  KPPV  P   KP V   KPPV  P   KP     KPPV  P   KP V  
Sbjct: 265 PKPTAVPP--KPPVVPPLPPKPTVVPPKPPVVPPAPPKPTDVPPKPPVVPPAPPKPTVVP 322

Query: 309 -KPPVEKP 329
            KPPV  P
Sbjct: 323 PKPPVVPP 330

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 67/136 (49%), Positives = 68/136 (50%), Gaps = 29/136 (21%)
 Frame = +3

Query: 9   KPPVE--KPPVY-----KPPVE--KPPVY-----KPPVEKPPVYKPPVE---------KP 119
           KPPVE  KPPV      KPPVE  KPPV      KPPVE P   KPPVE         KP
Sbjct: 215 KPPVEPPKPPVVPPFPPKPPVEPPKPPVVPPFPPKPPVEPPVPPKPPVEPPKPTAVPPKP 274

Query: 120 PVYKPPVEKPPVY--KPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPV--EKPPVYKPP 287
           PV  P   KP V   KPPV  PP    P + PP  KPPV  P   KP V   KPPV  P 
Sbjct: 275 PVVPPLPPKPTVVPPKPPV-VPPAPPKPTDVPP--KPPVVPPAPPKPTVVPPKPPVVPPA 331

Query: 288 VEKPPVY--KPPVEKP 329
             KP V   KPPV  P
Sbjct: 332 PPKPTVAPPKPPVVPP 347

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 64/133 (48%), Positives = 64/133 (48%), Gaps = 26/133 (19%)
 Frame = +3

Query: 9   KPPVE--KPPVY-----KPPVEKPPVYKPPVE---------KPPVYKPPVEKPPVY--KP 134
           KPPVE  KPPV      KPPVE P   KPPVE         KPPV  P   KP V   KP
Sbjct: 232 KPPVEPPKPPVVPPFPPKPPVEPPVPPKPPVEPPKPTAVPPKPPVVPPLPPKPTVVPPKP 291

Query: 135 PVEKPPVYKPP--VEKPPVYKPPAEKPPVY--KPPVYKPPVYKPPV--EKPPVYKPPVEK 296
           PV  P   KP     KPPV  P   KP V   KPPV  P   KP V   KPPV  P   K
Sbjct: 292 PVVPPAPPKPTDVPPKPPVVPPAPPKPTVVPPKPPVVPPAPPKPTVAPPKPPVVPPAPPK 351

Query: 297 PPVY--KPPVEKP 329
           P V   KPPV  P
Sbjct: 352 PTVVPPKPPVVPP 364

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 60/116 (51%), Positives = 62/116 (53%), Gaps = 16/116 (13%)
 Frame = +3

Query: 30  PVYKPPVEKPPVYKPPVEKPPV---YKPPVEKP-PVYKPPVEKPPVYKPPVE--KPPVY- 188
           PV   P   PP   PPV   P     KPPV+ P P  +PP       KPPVE  KPPV  
Sbjct: 37  PVPGQPTILPPW--PPVPPQPTDLPTKPPVDPPKPTVEPPKPTVAPPKPPVEPPKPPVEP 94

Query: 189 -KPPAE--KPPVY--KPPVY--KPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            KPP E  KPPV   KPPV   KPPV   KPPVE P   KPPVE P   KPPVE P
Sbjct: 95  PKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPKPPVEPPVPPKPPVEPP 150

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 54/114 (47%), Positives = 55/114 (48%), Gaps = 6/114 (5%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPP 182
           KPPV  PP    P + PP  KPPV  P   KP V   KPPV  P   KP V  P   KPP
Sbjct: 290 KPPVV-PPAPPKPTDVPP--KPPVVPPAPPKPTVVPPKPPVVPPAPPKPTVAPP---KPP 343

Query: 183 VYKPPAEKPPVY--KPPVYKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPP 332
           V  P   KP V   KPPV  P   KP V   KPPV  P   KP V  P   KPP
Sbjct: 344 VVPPAPPKPTVVPPKPPVVPPAPPKPTVAPPKPPVVPPAPPKPTVVPPSPPKPP 397

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 52/109 (47%), Positives = 52/109 (47%), Gaps = 2/109 (1%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           KPPV  P   KP V   KPPV  P   KP V  P   KPPV  P   KP V  P   KPP
Sbjct: 307 KPPVVPPAPPKPTVVPPKPPVVPPAPPKPTVAPP---KPPVVPPAPPKPTVVPP---KPP 360

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V  PPA   P   PP  KPPV  P   KP V  P   KPPV  P   KP
Sbjct: 361 VV-PPAPPKPTVAPP--KPPVVPPAPPKPTVVPPSPPKPPVVPPFPPKP 406

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 49/106 (46%), Positives = 49/106 (46%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP  KPPV  P   KP V  P   KPPV  P   KP V  P   KPPV  P   KP V  
Sbjct: 322 PP--KPPVVPPAPPKPTVAPP---KPPVVPPAPPKPTVVPP---KPPVVPPAPPKPTVAP 373

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           P   KPPV  P   KP V  P   KPPV  PP    P   PP  KP
Sbjct: 374 P---KPPVVPPAPPKPTVVPPSPPKPPVV-PPFPPKPTVVPPKPKP 415

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 46/99 (46%), Positives = 46/99 (46%), Gaps = 2/99 (2%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           KPPV  P   KP V   KPPV  P   KP V  P   KPPV  P   KP V  P   KPP
Sbjct: 324 KPPVVPPAPPKPTVAPPKPPVVPPAPPKPTVVPP---KPPVVPPAPPKPTVAPP---KPP 377

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP 299
           V  P   KP V  P   KPPV  PP    P   PP  KP
Sbjct: 378 VVPPAPPKPTVVPPSPPKPPVV-PPFPPKPTVVPPKPKP 415

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 53/109 (48%), Positives = 56/109 (51%), Gaps = 18/109 (16%)
 Frame = +3

Query: 60  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPP-----AEKPPVY- 218
           P    PV   P   PP   PPV   P + P   KPPV+ P P  +PP       KPPV  
Sbjct: 32  PTLVIPVPGQPTILPPW--PPVPPQPTDLPT--KPPVDPPKPTVEPPKPTVAPPKPPVEP 87

Query: 219 -KPPVY--KPPVY--KPPVE--KPPVY--KPPVE--KPPVYKPPVEKPP 332
            KPPV   KPPV   KPPVE  KPPV   KPPVE  KPPV  P   KPP
Sbjct: 88  PKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPVEPPKPPKPP 136

[77][TOP]
>UniRef100_C5V8E8 Iron-sulphur-binding reductase n=1 Tax=Corynebacterium matruchotii
            ATCC 14266 RepID=C5V8E8_9CORY
          Length = 1034

 Score =  109 bits (273), Expect = 8e-23
 Identities = 56/126 (44%), Positives = 63/126 (50%), Gaps = 20/126 (15%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEK-----------------PPVYKPPVEKPPVYKPPV 140
            PP   PP  +PPV +PP    P                    P   +PPV KPP   PP 
Sbjct: 894  PPKAAPPTAQPPVARPPAATAPTAPAAPGGSVPKTVAPGATIPGTARPPVAKPPAPTPPT 953

Query: 141  EKPPVYKPPVEKPPVYKPPAEKPPVYKP---PVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
             KPP   PPV KPP   PP   PP  +P   PV KPP  KPPV +PPV KPPV KPP+ K
Sbjct: 954  AKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVAKPPVAKPPMAK 1013

Query: 312  PPVEKP 329
            PP+  P
Sbjct: 1014 PPMVPP 1019

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 44/80 (55%), Positives = 49/80 (61%), Gaps = 3/80 (3%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---PVEKPPVYKPPVEKP 179
            +PPV KPP   PP  KPP   PPV KPP   PP   PP  +P   PV KPP  KPPV +P
Sbjct: 940  RPPVAKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQP 999

Query: 180  PVYKPPAEKPPVYKPPVYKP 239
            PV KPP  KPP+ KPP+  P
Sbjct: 1000 PVAKPPVAKPPMAKPPMVPP 1019

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 60/167 (35%), Positives = 65/167 (38%), Gaps = 60/167 (35%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPP-VEKP--------------PVYKPPVEKPPVYKPPV-- 140
            PP   PP   PP  +P    PP V  P              P   PP   PP  +PPV  
Sbjct: 849  PPAATPPGATPPGGRPATPTPPGVAVPGAAAPGSAVPPAAMPKATPPKAAPPTAQPPVAR 908

Query: 141  ------------------------------EKPPVYKPPVEKPPVYKPPAEKPPVYKPPV 230
                                           +PPV KPP   PP  KPPA  PPV KPP 
Sbjct: 909  PPAATAPTAPAAPGGSVPKTVAPGATIPGTARPPVAKPPAPTPPTAKPPAAAPPVAKPPT 968

Query: 231  YKP-------------PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              P             PV KPP  KPPV +PPV KPPV KPP+ KPP
Sbjct: 969  ATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVAKPPVAKPPMAKPP 1015

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 43/77 (55%), Positives = 46/77 (59%), Gaps = 3/77 (3%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPVE 173
            V KPP   PP  KPP   PPV KPP   PP   PP  +P   PV KPP  KPPV +PPV 
Sbjct: 943  VAKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVA 1002

Query: 174  KPPVYKPPAEKPPVYKP 224
            KPPV KPP  KPP+  P
Sbjct: 1003 KPPVAKPPMAKPPMVPP 1019

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 36/107 (33%), Positives = 40/107 (37%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
            PP   PP   PP  +P    P    P    P V KP    P    PP   PP   PP  +
Sbjct: 808  PPAATPPGATPPTARPAA--PGAAIPGAAVPGVAKPAA--PGAAIPPAATPPGATPPGGR 863

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P    PP    P    P    P    P   PP   PP  +PPV +PP
Sbjct: 864  PATPTPPGVAVPGAAAPGSAVPPAAMPKATPPKAAPPTAQPPVARPP 910

[78][TOP]
>UniRef100_Q9LIE9 Similarity to cell wall-plasma membrane linker protein n=1
           Tax=Arabidopsis thaliana RepID=Q9LIE9_ARATH
          Length = 334

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/131 (43%), Positives = 59/131 (45%), Gaps = 23/131 (17%)
 Frame = +3

Query: 9   KPPVEKPPVYKPP------------VEKPPVYKPP--VEKPPVYKPP---------VEKP 119
           KPP+ KPP   PP              KPP  KPP    KPP +KPP            P
Sbjct: 113 KPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTP 172

Query: 120 PVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP 299
           PV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   P
Sbjct: 173 PVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTP 232

Query: 300 PVYKPPVEKPP 332
           PV  PP   PP
Sbjct: 233 PVVTPPTPTPP 243

 Score =  106 bits (265), Expect = 7e-22
 Identities = 59/131 (45%), Positives = 64/131 (48%), Gaps = 23/131 (17%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVE-----KPPVYKPPVEKPP-VYKPPVE------KPPVYKPP--VEK 146
           KPP  KPP  KPP +     KPP+ KPP + PP   KPP +      KPP  KPP    K
Sbjct: 93  KPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPK 152

Query: 147 PPVYKP---------PVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP 299
           PP +KP         P   PPV  PP   PPV  PP   PPV  PP   PPV  PP   P
Sbjct: 153 PPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTP 212

Query: 300 PVYKPPVEKPP 332
           PV  PP   PP
Sbjct: 213 PVITPPTPTPP 223

 Score =  103 bits (256), Expect = 8e-21
 Identities = 61/120 (50%), Positives = 63/120 (52%), Gaps = 12/120 (10%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP--------PVEKPPVYKP 164
           KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP  KP        P  KPP  KP
Sbjct: 45  KPP--KPPAVKPP--KPPAVKPPTPKPPTVKPH-PKPPTVKPHPKPPTVKPHPKPPTVKP 99

Query: 165 PVEKPPVYKPPAEKPPVYKPPVYKPP-VYKPPVEKPP-VYKPPVEKPP--VYKPPVEKPP 332
           P  KPP    P  KPP+ KPP   PP   KPP + PP   KPP  KPP    KPP  KPP
Sbjct: 100 PHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPP 159

 Score =  101 bits (252), Expect = 2e-20
 Identities = 51/111 (45%), Positives = 52/111 (46%), Gaps = 9/111 (8%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPP---------VEKPPVYKPPVEKPPVYKPPVEKPPVYK 161
           KPP  KPP   P   KPP +KPP            PPV  PP   PPV  PP   PPV  
Sbjct: 140 KPPTTKPP---PSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVT 196

Query: 162 PPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PP   P
Sbjct: 197 PPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIP 247

 Score =  100 bits (250), Expect = 4e-20
 Identities = 58/122 (47%), Positives = 62/122 (50%), Gaps = 15/122 (12%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---- 164
           PP   P  +KPP       KPP  KPP  KPP  KPP  KPP  KP   KPP  KP    
Sbjct: 29  PPKPSPAPHKPPKHPVKPPKPPAVKPP--KPPAVKPPTPKPPTVKPH-PKPPTVKPHPKP 85

Query: 165 ----PVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPP-VYKPPVEKPP-VYKPPVEK 326
               P  KPP  KPP  KPP    P  KPP+ KPP + PP   KPP + PP   KPP  K
Sbjct: 86  PTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTK 145

Query: 327 PP 332
           PP
Sbjct: 146 PP 147

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 60/138 (43%), Positives = 64/138 (46%), Gaps = 30/138 (21%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPV----EKPPVYKP--------PVEKPPVYKPPVEKPPVYKPPVEKPP 152
           KPP  KPP  KPP      KPP  KP        P  KPP  KPP  KPP    P  KPP
Sbjct: 56  KPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPP 115

Query: 153 VYKPPVE------KPPVYKPPA-EKPPVYKPP--VYKPPVYKP---------PVEKPPVY 278
           + KPP +      KPP   PP+  KPP  KPP    KPP +KP         P   PPV 
Sbjct: 116 IVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVV 175

Query: 279 KPPVEKPPVYKPPVEKPP 332
            PP   PPV  PP   PP
Sbjct: 176 TPPTPTPPVITPPTPTPP 193

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 36/74 (48%), Positives = 36/74 (48%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 174 VVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPP 233

Query: 183 VYKPPAEKPPVYKP 224
           V  PP   PP   P
Sbjct: 234 VVTPPTPTPPTPIP 247

[79][TOP]
>UniRef100_Q39353 Cell wall-plasma membrane linker protein n=1 Tax=Brassica napus
           RepID=Q39353_BRANA
          Length = 376

 Score =  108 bits (271), Expect = 1e-22
 Identities = 54/107 (50%), Positives = 54/107 (50%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  
Sbjct: 187 PPTPTPPVVTPPTPAPPVVTPPTPTPPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVT 244

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 245 PPT--PPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPTPTPP 287

 Score =  101 bits (252), Expect = 2e-20
 Identities = 53/110 (48%), Positives = 54/110 (49%), Gaps = 3/110 (2%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           P   KPP +KPP   P   P   PPV  PP   PP   PPV  PP   PPV  PP   PP
Sbjct: 156 PSTPKPPTHKPPTVCPPPTPTPTPPVVTPPT--PPTPTPPVVTPPTPAPPVVTPPTPTPP 213

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 214 VVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PPVVTPPTPTPP 259

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/114 (48%), Positives = 55/114 (48%), Gaps = 6/114 (5%)
 Frame = +3

Query: 9   KPPVEKPPVYKPP---VEKPPVYKPPVEK---PPVYKPPVEKPPVYKPPVEKPPVYKPPV 170
           KPP  KPP   PP      PPV  PP      PPV  PP   PPV  PP   PPV  PP 
Sbjct: 160 KPPTHKPPTVCPPPTPTPTPPVVTPPTPPTPTPPVVTPPTPAPPVVTPPTPTPPVVTPPT 219

Query: 171 EKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 220 PTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PP 267

 Score =  100 bits (248), Expect = 7e-20
 Identities = 54/120 (45%), Positives = 55/120 (45%), Gaps = 11/120 (9%)
 Frame = +3

Query: 6   YKPPVEKPPVY-----------KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 152
           +KPP   PP              PP   PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 164 HKPPTVCPPPTPTPTPPVVTPPTPPTPTPPVVTPPTPAPPVVTPPTPTPPVVTPPTPTPP 223

Query: 153 VYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 224 VVTPPT--PPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PPVVTPPTPTPP 277

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 50/100 (50%), Positives = 50/100 (50%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 194 VVTPPTPAPPVVTPPTPTPPVVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPT--PP 249

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP 302
           V  PP   PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 250 VVTPPTPTPPVVTPPT--PPVVTPPTPTPPVVTPPTPTPP 287

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 60/120 (50%), Positives = 63/120 (52%), Gaps = 12/120 (10%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVE--- 173
           KPP  KPP  KPP  KPP  KP P  KPP  +P P  KPP    P+ KPP  KPP     
Sbjct: 56  KPPAVKPP--KPPT-KPPTLKPHPHPKPPTVRPHPHPKPPTKPHPIPKPPTIKPPPSTPK 112

Query: 174 ---KPPVYKPPAEKP-PVYKPPVYKPPVYKP-PVEKPPVYKPP--VEKPPVYKPPVEKPP 332
              KPP  KPP   P P  KPP  KPP   P P  KPP  KPP    KPP +KPP   PP
Sbjct: 113 PPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTHKPPTVCPP 172

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 57/128 (44%), Positives = 58/128 (45%), Gaps = 20/128 (15%)
 Frame = +3

Query: 9   KPPVEKPPVY------KPPVEKPPVYKP-PVEKPPVYKPP--VEKPPVYKPPVEKPPVY- 158
           KPP  KPP        KPP  KPP   P P  KPP  KPP    KPP +KPP   PP   
Sbjct: 116 KPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTHKPPTVCPPPTP 175

Query: 159 ----------KPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
                      PP   PPV  PP   PPV  PP   PPV  PP   PPV  PP   PPV 
Sbjct: 176 TPTPPVVTPPTPPTPTPPVVTPPTPAPPVVTPPTPTPPVVTPPTPTPPVVTPPT--PPVV 233

Query: 309 KPPVEKPP 332
            PP   PP
Sbjct: 234 TPPTPTPP 241

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 57/125 (45%), Positives = 60/125 (48%), Gaps = 17/125 (13%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKP-PVYKPPVEKPP--VYKPPVEK 176
           KPP +  P+ KPP  KPP   P P  KPP  KPP   P P  KPP  KPP    KPP  K
Sbjct: 90  KPPTKPHPIPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPT-K 148

Query: 177 PPVYKPP--AEKPPVYKPPVYKPPVY-----------KPPVEKPPVYKPPVEKPPVYKPP 317
           PP  KPP    KPP +KPP   PP              PP   PPV  PP   PPV  PP
Sbjct: 149 PPTVKPPPSTPKPPTHKPPTVCPPPTPTPTPPVVTPPTPPTPTPPVVTPPTPAPPVVTPP 208

Query: 318 VEKPP 332
              PP
Sbjct: 209 TPTPP 213

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 62/126 (49%), Positives = 65/126 (51%), Gaps = 17/126 (13%)
 Frame = +3

Query: 6   YKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKP---- 164
           +KPP    KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP P  KPP  +P    
Sbjct: 37  HKPPKHPVKPP--KPPAAKPP--KPPAVKPP--KPPT-KPPTLKPHPHPKPPTVRPHPHP 89

Query: 165 -------PVEKPPVYKPPAEKP-PVYKPPVYKPPVYKP-PVEKPPVYKPPVEKP-PVYKP 314
                  P+ KPP  KPP   P P  KPP  KPP   P P  KPP  KPP   P P  KP
Sbjct: 90  KPPTKPHPIPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPPPSTPKPPTKP 149

Query: 315 PVEKPP 332
           P  KPP
Sbjct: 150 PTVKPP 155

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 59/118 (50%), Positives = 62/118 (52%), Gaps = 11/118 (9%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPP 182
           PP   P  +KPP    KPP  KPP  KPP  KPP  KPP  KPP  KPP  KP P  KPP
Sbjct: 29  PPKPSPRPHKPPKHPVKPP--KPPAAKPP--KPPAVKPP--KPPT-KPPTLKPHPHPKPP 81

Query: 183 VYKP-PAEKPPVYKPPVYKPPVYKPPVE------KPPVYKPPVEKP-PVYKPPVEKPP 332
             +P P  KPP    P+ KPP  KPP        KPP  KPP   P P  KPP  KPP
Sbjct: 82  TVRPHPHPKPPTKPHPIPKPPTIKPPPSTPKPPTKPPTVKPPPSTPKPPTKPPTVKPP 139

[80][TOP]
>UniRef100_UPI0001AEEAC9 secreted protein n=1 Tax=Streptomyces albus J1074
           RepID=UPI0001AEEAC9
          Length = 255

 Score =  108 bits (270), Expect = 2e-22
 Identities = 43/86 (50%), Positives = 59/86 (68%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEK 266
           +PP E+PP  +PP  +PP  +PP E+
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPPTER 214

 Score =  108 bits (270), Expect = 2e-22
 Identities = 43/86 (50%), Positives = 59/86 (68%)
 Frame = +3

Query: 39  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVY 218
           KPP  KPP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 219 KPPVYKPPVYKPPVEKPPVYKPPVEK 296
           +PP  +PP  +PP E+PP  +PP E+
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPPTER 214

 Score =  108 bits (270), Expect = 2e-22
 Identities = 43/86 (50%), Positives = 59/86 (68%)
 Frame = +3

Query: 69  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVY 248
           KPP  KPP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP  +PP  
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 249 KPPVEKPPVYKPPVEKPPVYKPPVEK 326
           +PP E+PP  +PP E+PP  +PP E+
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPPTER 214

 Score =  108 bits (270), Expect = 2e-22
 Identities = 43/83 (51%), Positives = 58/83 (69%)
 Frame = +3

Query: 24  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAE 203
           KPP  KPP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 204 KPPVYKPPVYKPPVYKPPVEKPP 272
           +PP  +PP  +PP  +PP E+PP
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPP 211

 Score =  108 bits (270), Expect = 2e-22
 Identities = 43/83 (51%), Positives = 58/83 (69%)
 Frame = +3

Query: 54  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVY 233
           KPP  KPP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP  
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 234 KPPVYKPPVEKPPVYKPPVEKPP 302
           +PP  +PP E+PP  +PP E+PP
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPP 211

 Score =  108 bits (270), Expect = 2e-22
 Identities = 43/83 (51%), Positives = 58/83 (69%)
 Frame = +3

Query: 84  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVE 263
           KPP  KPP E+PP  +PP E+PP  +PP E+PP  +PP E+PP  +PP  +PP  +PP E
Sbjct: 130 KPPT-KPPTEEPPTEQPPTEEPPTEQPPTEEPPTEEPPTEEPPTEEPPTEEPPTEEPPTE 188

Query: 264 KPPVYKPPVEKPPVYKPPVEKPP 332
           +PP  +PP E+PP  +PP E+PP
Sbjct: 189 QPPTEEPPTEEPPTEQPPAEQPP 211

[81][TOP]
>UniRef100_Q39949 Hydroxyproline-rich protein n=1 Tax=Helianthus annuus
           RepID=Q39949_HELAN
          Length = 263

 Score =  108 bits (270), Expect = 2e-22
 Identities = 78/138 (56%), Positives = 83/138 (60%), Gaps = 28/138 (20%)
 Frame = +3

Query: 3   VYKPPVEKPPVYK---PPVEK---PPVYK---PPVEK---PPVYK--PPVEKPPVYKPPV 140
           VYK P   PPVYK   PPV K   PPV+K   PPV K   PPVYK  PP +KP VYK P 
Sbjct: 53  VYKSPP-PPPVYKSPPPPVYKSPPPPVHKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPP 111

Query: 141 EKPPVYKPPVEKPPVYKPPAEKPPVYK---PPVYK---PPVYK---PPVEK---PPVYK- 281
             PPV+K P   PPVYK P   PPVY+   PPVYK   PPVYK   PPV K   PPVYK 
Sbjct: 112 PPPPVHKSP--PPPVYKSP--PPPVYESPPPPVYKSPPPPVYKSPPPPVHKSPPPPVYKS 167

Query: 282 -PPVEKPPVYKPPVEKPP 332
            PP +KP VYK P   PP
Sbjct: 168 PPPPKKPYVYKSPPPPPP 185

 Score =  107 bits (266), Expect = 5e-22
 Identities = 82/155 (52%), Positives = 90/155 (58%), Gaps = 45/155 (29%)
 Frame = +3

Query: 3   VYK--PPVEKPPVYKPPVEKPPVYK---PPVEK---PPVYK---PPVEK---PPVYK--- 131
           VYK  PP +KP VYK P   PPV+K   PPV K   PPVY+   PPV K   PPVYK   
Sbjct: 94  VYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPPPPVYESPPPPVYKSPPPPVYKSPP 153

Query: 132 PPVEK---PPVYK--PPVEKPPVYKPPAEKPPVYK---PPVYK---PPVYKP-------- 254
           PPV K   PPVYK  PP +KP VYK P   PPV+K   PPVYK   PPV+K         
Sbjct: 154 PPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPTPPVHKSPPHPVYKS 213

Query: 255 --PVEK--PPVYK--PPVEKPPVYK---PPVEKPP 332
             PV K  PPVYK  PP +KP VYK   PPV+K P
Sbjct: 214 PLPVHKSPPPVYKSPPPPKKPYVYKSPPPPVKKHP 248

 Score =  105 bits (261), Expect = 2e-21
 Identities = 79/143 (55%), Positives = 85/143 (59%), Gaps = 33/143 (23%)
 Frame = +3

Query: 3   VYK---PPVEK---PPVYK---PPVEK---PPVYK--PPVEKPPVYK-----PPVEK--- 116
           VYK   PPV K   PPV+K   PPV K   PPVYK  PP +KP VYK     PPV K   
Sbjct: 62  VYKSPPPPVYKSPPPPVHKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPP 121

Query: 117 PPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYK---PPVYK---PPVYK--PPVEKPP 272
           PPVYK P   PPVY+ P   PPVYK P   PPVYK   PPV+K   PPVYK  PP +KP 
Sbjct: 122 PPVYKSP--PPPVYESP--PPPVYKSP--PPPVYKSPPPPVHKSPPPPVYKSPPPPKKPY 175

Query: 273 VYKPPVEKPPVYK---PPVEKPP 332
           VYK P   PPV+K   PPV K P
Sbjct: 176 VYKSPPPPPPVHKSPPPPVYKSP 198

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 75/140 (53%), Positives = 83/140 (59%), Gaps = 34/140 (24%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEK---PPVYK---PPVEK---PPV 155
           PP + PP   PP ++  VYK P   PPVYK   PPV K   PPV+K   PPV K   PPV
Sbjct: 39  PPKKSPP---PPPKQQYVYKSP-PPPPVYKSPPPPVYKSPPPPVHKSPPPPVHKSPPPPV 94

Query: 156 YK--PPVEKPPVYKPPAEKPPVYK---PPVYK---PPVYK---PPVEK---PPVYK---P 284
           YK  PP +KP VYK P   PPV+K   PPVYK   PPVY+   PPV K   PPVYK   P
Sbjct: 95  YKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPPPPVYESPPPPVYKSPPPPVYKSPPP 154

Query: 285 PVEK---PPVYK--PPVEKP 329
           PV K   PPVYK  PP +KP
Sbjct: 155 PVHKSPPPPVYKSPPPPKKP 174

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 67/124 (54%), Positives = 74/124 (59%), Gaps = 17/124 (13%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP ++  VYK P   PPVYK P   PPVYK P   PPV+K P   PPV+K P   PPVYK
Sbjct: 46  PPPKQQYVYKSP-PPPPVYKSP--PPPVYKSP--PPPVHKSP--PPPVHKSP--PPPVYK 96

Query: 192 --PPAEKPPVYKPPVYKPPVYK---PPVEK---PPVYK---PPVEK---PPVYK---PPV 320
             PP +KP VYK P   PPV+K   PPV K   PPVY+   PPV K   PPVYK   PPV
Sbjct: 97  SPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSPPPPVYESPPPPVYKSPPPPVYKSPPPPV 156

Query: 321 EKPP 332
            K P
Sbjct: 157 HKSP 160

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 66/126 (52%), Positives = 70/126 (55%), Gaps = 16/126 (12%)
 Frame = +3

Query: 3   VYK---PPVEK---PPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKP 149
           VYK   PPV K   PPVYK  PP +KP VYK P   PPV+K P   PPVYK   PPV K 
Sbjct: 148 VYKSPPPPVHKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSP--PPPVYKSPTPPVHKS 205

Query: 150 P---VYKPPVEKPPVYKPPAEKPPVYK--PPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           P   VYK P+   PV+K P   PPVYK  PP  KP VYK P   PPV K P   PP Y  
Sbjct: 206 PPHPVYKSPL---PVHKSP---PPVYKSPPPPKKPYVYKSP--PPPVKKHP---PPHYIY 254

Query: 315 PVEKPP 332
               PP
Sbjct: 255 SSPPPP 260

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 53/102 (51%), Positives = 60/102 (58%), Gaps = 11/102 (10%)
 Frame = +3

Query: 60  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYK---PPV 230
           P   PP + PP   PP ++  VYK P   PPVYK P   PPVYK P   PPV+K   PPV
Sbjct: 35  PPPPPPKKSPP---PPPKQQYVYKSP-PPPPVYKSP--PPPVYKSP--PPPVHKSPPPPV 86

Query: 231 YK---PPVYK--PPVEKPPVYKPPVEKPPVYK---PPVEKPP 332
           +K   PPVYK  PP +KP VYK P   PPV+K   PPV K P
Sbjct: 87  HKSPPPPVYKSPPPPKKPYVYKSPPPPPPVHKSPPPPVYKSP 128

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 55/108 (50%), Positives = 60/108 (55%), Gaps = 16/108 (14%)
 Frame = +3

Query: 3   VYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPP---VYKPPV----EK 146
           VYK  PP +KP VYK P   PPV+K P   PPVYK   PPV K P   VYK P+      
Sbjct: 164 VYKSPPPPKKPYVYKSPPPPPPVHKSP--PPPVYKSPTPPVHKSPPHPVYKSPLPVHKSP 221

Query: 147 PPVYK--PPVEKPPVYKPPAEKPPVYKPPVYKPP--VYKPPVEKPPVY 278
           PPVYK  PP +KP VYK P   PPV K P   PP  +Y  P   PP Y
Sbjct: 222 PPVYKSPPPPKKPYVYKSP--PPPVKKHP---PPHYIYSSP---PPPY 261

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 45/87 (51%), Positives = 47/87 (54%), Gaps = 18/87 (20%)
 Frame = +3

Query: 126 YKPPVEKPPVYKPPVEKPP----VYKPPAEKPPVYK---PPVYK---PPVYK---PPVEK 266
           Y  P   PP   PP   PP    VYK P   PPVYK   PPVYK   PPV+K   PPV K
Sbjct: 32  YSSPPPPPPKKSPP--PPPKQQYVYKSP-PPPPVYKSPPPPVYKSPPPPVHKSPPPPVHK 88

Query: 267 ---PPVYK--PPVEKPPVYKPPVEKPP 332
              PPVYK  PP +KP VYK P   PP
Sbjct: 89  SPPPPVYKSPPPPKKPYVYKSPPPPPP 115

[82][TOP]
>UniRef100_B4G234 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B4G234_MAIZE
          Length = 304

 Score =  107 bits (268), Expect = 3e-22
 Identities = 57/110 (51%), Positives = 64/110 (58%), Gaps = 3/110 (2%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPP---VYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           PPV  PP  K PV +PPV +PPV  PP   V +PPV +PPV  PPV  PP+  PP   PP
Sbjct: 91  PPVVGPP--KGPVTRPPVMRPPVVGPPKGPVTRPPVTRPPVVGPPVTYPPITGPPTT-PP 147

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP   PP+  PP   PPV  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 148 VVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPPATTPPVTGPPVTYPP 196

 Score =  105 bits (261), Expect = 2e-21
 Identities = 55/103 (53%), Positives = 61/103 (59%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           K PV +PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+  PP   PPV  PPV 
Sbjct: 98  KGPVTRPPVMRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVT 154

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
            PP   PP   PPV  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 155 YPPITGPPT-TPPVVGPPVTYPPITGPPATTPPVTGPPVTYPP 196

 Score =  103 bits (256), Expect = 8e-21
 Identities = 53/100 (53%), Positives = 60/100 (60%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 101 VTRPPVMRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPP 157

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP 302
           +  PP   PPV  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 158 ITGPPT-TPPVVGPPVTYPPITGPPATTPPVTGPPVTYPP 196

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 55/117 (47%), Positives = 62/117 (52%), Gaps = 10/117 (8%)
 Frame = +3

Query: 12  PPVEKP----PVYKPPVEKPPV----YKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYK 161
           PP  KP    P  KP   KPP     Y  P  +PP     PPV  PP  K PV +PPV +
Sbjct: 51  PPKTKPSHPSPSPKPKNPKPPKGSTGYPAPGHQPPKSPSYPPVVGPP--KGPVTRPPVMR 108

Query: 162 PPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PPV  PP  K P  +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP+  PP
Sbjct: 109 PPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPP 162

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 48/103 (46%), Positives = 53/103 (51%), Gaps = 4/103 (3%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 119 VTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPP 176

Query: 183 VYKPPAEKPPVYKPPVYKPP----VYKPPVEKPPVYKPPVEKP 299
           +  PPA  PPV  PPV  PP        P   PP   P    P
Sbjct: 177 ITGPPATTPPVTGPPVTYPPGGGGGSSTPCPPPPSPTPTPSSP 219

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/106 (46%), Positives = 53/106 (50%), Gaps = 4/106 (3%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           K PV +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP+  PP   PPV  PPV 
Sbjct: 116 KGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPPT-TPPVVGPPVT 173

Query: 189 KPPAEKPPVYKPPVYKPPVYKPP----VEKPPVYKPPVEKPPVYKP 314
            PP   PP   PPV  PPV  PP        P   PP   P    P
Sbjct: 174 YPPITGPPATTPPVTGPPVTYPPGGGGGSSTPCPPPPSPTPTPSSP 219

[83][TOP]
>UniRef100_A9WG95 Helicase n=2 Tax=Chloroflexus RepID=A9WG95_CHLAA
          Length = 1007

 Score =  107 bits (266), Expect = 5e-22
 Identities = 54/115 (46%), Positives = 77/115 (66%), Gaps = 7/115 (6%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVY-KPPVEKPPVYKPPVE--KPPVYKPPVEKPPVY-KPPVEK 176
            +PP  +PPV +PPV +PPV  +PPV +PP  +PP    +PPV +PP  +P V  +PPV +
Sbjct: 717  EPPAREPPVREPPVREPPVRSEPPVREPPAREPPARSAEPPVREPPAREPSVRSEPPVRE 776

Query: 177  PPVYKPPAE-KPPVYKPPVY-KPPVYKPPVEKPPVYKPPV-EKPPVYKPPVEKPP 332
            PPV +PPA  +PP  +P +  +PP  +PPV +PPV +PPV  +P V +PP  +PP
Sbjct: 777  PPVREPPARSEPPAREPSIRSEPPAREPPVREPPVREPPVRSEPSVREPPAREPP 831

 Score =  100 bits (250), Expect = 4e-20
 Identities = 53/119 (44%), Positives = 75/119 (63%), Gaps = 9/119 (7%)
 Frame = +3

Query: 3    VYKPPVEKPPV-YKPPVEKPPVYKPPVE--KPPVYKPPVEKPPV-YKPPVEKPPVYKPPV 170
            V +PPV +PPV  +PPV +PP  +PP    +PPV +PP  +P V  +PPV +PPV +PP 
Sbjct: 725  VREPPVREPPVRSEPPVREPPAREPPARSAEPPVREPPAREPSVRSEPPVREPPVREPPA 784

Query: 171  EKPPVYKPPA--EKPPVYKPPVYKPPVYKPPV-EKPPVYKPPVEKPPV--YKPPVEKPP 332
               P  + P+   +PP  +PPV +PPV +PPV  +P V +PP  +PP    +PPV +PP
Sbjct: 785  RSEPPAREPSIRSEPPAREPPVREPPVREPPVRSEPSVREPPAREPPARSAEPPVREPP 843

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/132 (41%), Positives = 76/132 (57%), Gaps = 24/132 (18%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVE-KPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE-KPPVYKPPVEK 176
            +PPV +PPV +PPV  +PPV +PP  +PP    +PPV +PP  +P V  +PPV +PPV +
Sbjct: 722  EPPVREPPVREPPVRSEPPVREPPAREPPARSAEPPVREPPAREPSVRSEPPVREPPVRE 781

Query: 177  PPVY------------KPPAEKPPVYKPPVYKPPVY------KPPVEKPPVY--KPPVEK 296
            PP              +PPA +PPV +PPV +PPV       +PP  +PP    +PPV +
Sbjct: 782  PPARSEPPAREPSIRSEPPAREPPVREPPVREPPVRSEPSVREPPAREPPARSAEPPVRE 841

Query: 297  PPVYKPPVEKPP 332
            PP  +P V   P
Sbjct: 842  PPAREPSVRSEP 853

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 50/120 (41%), Positives = 70/120 (58%), Gaps = 22/120 (18%)
 Frame = +3

Query: 39   KPPVEKPPVYKPPVEKPPVY-KPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPAE--K 206
            +PPV +P   +PP  +PP   +PP  +PPV +PPV +PPV  +PPV +PP  +PPA   +
Sbjct: 699  EPPVREP---EPPAREPPARSEPPAREPPVREPPVREPPVRSEPPVREPPAREPPARSAE 755

Query: 207  PPVYKPPV------YKPPVYKPPVEKPPV------------YKPPVEKPPVYKPPVEKPP 332
            PPV +PP        +PPV +PPV +PP              +PP  +PPV +PPV +PP
Sbjct: 756  PPVREPPAREPSVRSEPPVREPPVREPPARSEPPAREPSIRSEPPAREPPVREPPVREPP 815

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 49/113 (43%), Positives = 69/113 (61%), Gaps = 6/113 (5%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPV-EKPP 182
            + P E  P   P   +PPV +P   +PP  +PP   +PP  +PPV +PPV +PPV  +PP
Sbjct: 687  RTPGENRPARTP---EPPVREP---EPPAREPPARSEPPAREPPVREPPVREPPVRSEPP 740

Query: 183  VYKPPAEKPPV--YKPPVYKPPVYKPPV-EKPPVYKPPVEKPPV-YKPPVEKP 329
            V +PPA +PP    +PPV +PP  +P V  +PPV +PPV +PP   +PP  +P
Sbjct: 741  VREPPAREPPARSAEPPVREPPAREPSVRSEPPVREPPVREPPARSEPPAREP 793

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 12/106 (11%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEK-------PPVYKPPVEKPPVYKP 164
            +PPV +PP  +P V  +PPV +PPV +PP    P  +       PP  +PPV +PPV +P
Sbjct: 755  EPPVREPPAREPSVRSEPPVREPPVREPPARSEPPAREPSIRSEPPAREPPVREPPVREP 814

Query: 165  PV-EKPPVYKPPAEKPPV--YKPPVYKPPVYKPPV-EKPPVYKPPV 290
            PV  +P V +PPA +PP    +PPV +PP  +P V  +PP  +PPV
Sbjct: 815  PVRSEPSVREPPAREPPARSAEPPVREPPAREPSVRSEPPAREPPV 860

[84][TOP]
>UniRef100_Q9FUF1 Putative proline-rich protein (Fragment) n=1 Tax=Solanum
           lycopersicum RepID=Q9FUF1_SOLLC
          Length = 158

 Score =  107 bits (266), Expect = 5e-22
 Identities = 53/96 (55%), Positives = 61/96 (63%), Gaps = 1/96 (1%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+  PP+ KPPV  PPV  PP+ KPPV  PPV  PP+ KPPV+ PPV  PPV  PP+ K
Sbjct: 1   PPIGIPPIVKPPVILPPVGIPPIVKPPVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVK 60

Query: 192 PPAEKPPVYKPPVYKPPVYKP-PVEKPPVYKPPVEK 296
           PP + PP+  PPV  PPV KP P  K P   PP  K
Sbjct: 61  PPVDLPPIGIPPVTVPPVIKPSPKGKKPC--PPTTK 94

 Score =  105 bits (262), Expect = 2e-21
 Identities = 50/88 (56%), Positives = 58/88 (65%), Gaps = 1/88 (1%)
 Frame = +3

Query: 72  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYK 251
           PP+  PP+ KPPV  PPV  PP+ KPPV  PPV  PP+ KPP + PPV  PPV  PP+ K
Sbjct: 1   PPIGIPPIVKPPVILPPVGIPPIVKPPVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVK 60

Query: 252 PPVEKPPVYKPPVEKPPVYKP-PVEKPP 332
           PPV+ PP+  PPV  PPV KP P  K P
Sbjct: 61  PPVDLPPIGIPPVTVPPVIKPSPKGKKP 88

 Score =  102 bits (254), Expect = 1e-20
 Identities = 50/91 (54%), Positives = 58/91 (63%)
 Frame = +3

Query: 57  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYK 236
           PP+  PP+ KPPV  PPV  PP+ KPPV+ PPV  PP+ KPPV  PP   PPV  PP+ K
Sbjct: 1   PPIGIPPIVKPPVILPPVGIPPIVKPPVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVK 60

Query: 237 PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PPV  PP+  PPV  PPV KP    P  +KP
Sbjct: 61  PPVDLPPIGIPPVTVPPVIKP---SPKGKKP 88

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 49/89 (55%), Positives = 56/89 (62%), Gaps = 1/89 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + KPPV  PPV  PP+ KPPV  PPV  PP+ KPPV+ PPV  PPV  PP+ KPPV+ PP
Sbjct: 8   IVKPPVILPPVGIPPIVKPPVKLPPVGIPPIVKPPVDLPPVGIPPVTVPPIVKPPVDLPP 67

Query: 183 VYKPPAEKPPVYKP-PVYKPPVYKPPVEK 266
           +  PP   PPV KP P  K P   PP  K
Sbjct: 68  IGIPPVTVPPVIKPSPKGKKPC--PPTTK 94

[85][TOP]
>UniRef100_A5AVB2 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5AVB2_VITVI
          Length = 296

 Score =  107 bits (266), Expect = 5e-22
 Identities = 54/107 (50%), Positives = 64/107 (59%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   PP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +
Sbjct: 45  PPNGIPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQ 104

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  KPP  +PP  KPP  +PP  KPP  +PP   PP  +PPV KPP
Sbjct: 105 PPNGKPPGAQPPNGKPPGAQPPNGKPPGAQPPKGTPPGAQPPVAKPP 151

 Score =  105 bits (261), Expect = 2e-21
 Identities = 54/110 (49%), Positives = 65/110 (59%), Gaps = 2/110 (1%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  
Sbjct: 54  QPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGA 113

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPP 332
           +PP  KPP  +PP  KPP  +PP   PP  +PPV KPP +   PP   PP
Sbjct: 114 QPPNGKPPGAQPPNGKPPGAQPPKGTPPGAQPPVAKPPSHYGYPPYGSPP 163

 Score =  100 bits (249), Expect = 5e-20
 Identities = 52/107 (48%), Positives = 63/107 (58%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+  PP   PP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  K
Sbjct: 41  PPLS-PPNGIPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPKGK 99

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  +PP  KPP  +PP  KPP  +PP  KPP  +PP   PP  +PP
Sbjct: 100 PPGAQPPNGKPPGAQPPNGKPPGAQPPNGKPPGAQPPKGTPPGAQPP 146

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 50/106 (47%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P    P   PP   PP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +P
Sbjct: 36  PYTASPPLSPPNGIPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQP 95

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP   PP
Sbjct: 96  PKGKPPGAQPPNGKPPGAQPPNGKPPGAQPPNGKPPGAQPPKGTPP 141

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 50/106 (47%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P   P    PP+  PP   PP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KP
Sbjct: 32  PAPAPYTASPPLS-PPNGIPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKP 90

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP
Sbjct: 91  PGAQPPKGKPPGAQPPNGKPPGAQPPNGKPPGAQPPNGKPPGAQPP 136

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 52/116 (44%), Positives = 62/116 (53%), Gaps = 8/116 (6%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  
Sbjct: 74  QPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPNGKPPGAQPPNGKPPGA 133

Query: 189 KPPAEKPPVYKPPVYKPPVYK--PPVEKPPVY------KPPVEKPPVYKPPVEKPP 332
           +PP   PP  +PPV KPP +   PP   PP+Y       PP        PPV  PP
Sbjct: 134 QPPKGTPPGAQPPVAKPPSHYGYPPYGSPPIYASPPYAAPPTNGSITPTPPVLSPP 189

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/112 (45%), Positives = 61/112 (54%), Gaps = 3/112 (2%)
 Frame = +3

Query: 6   YKPPVEKP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           Y+PP       P   P    PP+  PP   PP  +PP  KPP  +PP  KPP  +PP  K
Sbjct: 21  YQPPTPTTTPTPAPAPYTASPPL-SPPNGIPPGAQPPKGKPPGAQPPNGKPPGAQPPKGK 79

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP
Sbjct: 80  PPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPNGKPPGAQPPNGKPP 131

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 46/110 (41%), Positives = 55/110 (50%), Gaps = 6/110 (5%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPV---YKPPVEKP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + PP   P    PP    Y+PP       P   P    PP+  PP   PP  +PP  KPP
Sbjct: 3   QXPPPPPPQHPMPPCKCGYQPPTPTTTPTPAPAPYTASPPL-SPPNGIPPGAQPPKGKPP 61

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP  +PP  KPP
Sbjct: 62  GAQPPNGKPPGAQPPKGKPPGAQPPNGKPPGAQPPKGKPPGAQPPNGKPP 111

[86][TOP]
>UniRef100_UPI0001983484 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001983484
          Length = 306

 Score =  106 bits (265), Expect = 7e-22
 Identities = 66/116 (56%), Positives = 77/116 (66%), Gaps = 9/116 (7%)
 Frame = +3

Query: 12  PPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPP--VEKP 179
           PP +KPP  +KP VEKP    PP  K P   P  EKP P +KPP    P+ KPP   + P
Sbjct: 28  PPTKKPPPEHKPSVEKP----PPEHKSPTKPPKGEKPLPEHKPPT---PIGKPPKGEKPP 80

Query: 180 PVYKPPAEK-PPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEK-PPVYKP-PVEKPP 332
           P +KPP EK PP +KPPV K PP +KPPVEK PP +KPPVEK PP +KP P+EKPP
Sbjct: 81  PEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPTPLEKPP 136

 Score =  102 bits (255), Expect = 1e-20
 Identities = 75/135 (55%), Positives = 86/135 (63%), Gaps = 26/135 (19%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPV--EKPPVYKPPVEKPPV-YKPPVEK-PPVYKPPVEK-PPVYKPPV 170
           +KPP    P+ KPP   + PP +KPPVEKPP  +KPPVEK PP +KPPVEK PP +KPPV
Sbjct: 64  HKPPT---PIGKPPKGEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPV 120

Query: 171 EK-PPVYKP-PAEKPPVYKPPV--YKP--PVYKPPV-EKPPVY-----KPPVE------K 296
           EK PP +KP P EKPP  + P+  +KP  PV KPP  EKPP Y      PP E      K
Sbjct: 121 EKPPPEHKPTPLEKPPKGEKPLPEHKPPTPVGKPPKGEKPPHYGHNPGHPPAENAEDSYK 180

Query: 297 P--PVYKPPV-EKPP 332
           P  PV KPP  EKPP
Sbjct: 181 PPTPVGKPPKGEKPP 195

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 61/105 (58%), Positives = 68/105 (64%), Gaps = 7/105 (6%)
 Frame = +3

Query: 39  KPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKP-PVYKPPVEKPPVYKPP--AEK 206
           KPP  K P   PP  KP V KPP E K P   P  EKP P +KPP    P+ KPP   + 
Sbjct: 26  KPPPTKKP---PPEHKPSVEKPPPEHKSPTKPPKGEKPLPEHKPPT---PIGKPPKGEKP 79

Query: 207 PPVYKPPVYK-PPVYKPPVEK-PPVYKPPVEK-PPVYKPPVEKPP 332
           PP +KPPV K PP +KPPVEK PP +KPPVEK PP +KPPVEKPP
Sbjct: 80  PPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPPVEKPP 124

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 71/208 (34%), Positives = 81/208 (38%), Gaps = 99/208 (47%)
 Frame = +3

Query: 6   YKPPVEKPPV-YKPPVEKPPV-YKPPVEKPPV-YKP-PVEKPPV---------------- 125
           +KPPVEKPP  +KPPVEKPP  +KPPVEKPP  +KP P+EKPP                 
Sbjct: 94  HKPPVEKPPPEHKPPVEKPPPEHKPPVEKPPPEHKPTPLEKPPKGEKPLPEHKPPTPVGK 153

Query: 126 -------------------------YKPPV--------EKPPVYKPPVEKP--------- 179
                                    YKPP         EKPP +K P + P         
Sbjct: 154 PPKGEKPPHYGHNPGHPPAENAEDSYKPPTPVGKPPKGEKPPEHKSPTKPPKGEKPLLEH 213

Query: 180 -----------------------PVYKPP-AEKPPVY-----KPPV------YKPPVYKP 254
                                  PV KPP  EKPP Y      PPV      YKPP    
Sbjct: 214 KPPTPIGKPPKGEKQLPEHKPPTPVGKPPKGEKPPHYGHNPGHPPVESKEDSYKPPHKIE 273

Query: 255 PVEKPPVYKPPVEKPPV--YKPPVEKPP 332
           P   P   + P +KPP   +KPP  KPP
Sbjct: 274 PPSAPKKPQAPEKKPPTPPHKPP-HKPP 300

[87][TOP]
>UniRef100_O24300 PtxA protein n=1 Tax=Pisum sativum RepID=O24300_PEA
          Length = 352

 Score =  106 bits (265), Expect = 7e-22
 Identities = 65/108 (60%), Positives = 69/108 (63%), Gaps = 6/108 (5%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVY-KPPVEKPP-V 185
           P  KPP +KPP+ KPPV+KPP  KP    PP   P   KPP V KPP Y KPP   PP V
Sbjct: 31  PSPKPPTHKPPIVKPPVHKPP--KPQPCPPPSSSP---KPPHVPKPPHYPKPPAVHPPHV 85

Query: 186 YKPPAEKPP-VYKPPVYKPPVYKPP-VEKPPVYKPPVEKPP-VYKPPV 320
            KPPA  PP V KPPV  PP+  PP V KPPV KPPV KPP V KPPV
Sbjct: 86  PKPPAVHPPHVPKPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPV 133

 Score =  105 bits (263), Expect = 1e-21
 Identities = 66/119 (55%), Positives = 70/119 (58%), Gaps = 11/119 (9%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKP-----PVEKPP-VYKPP-VEKPPVYKPP-VEKPPVYKP 164
           KPP  KPP+ KPPV KPP  +P        KPP V KPP   KPP   PP V KPP   P
Sbjct: 34  KPPTHKPPIVKPPVHKPPKPQPCPPPSSSPKPPHVPKPPHYPKPPAVHPPHVPKPPAVHP 93

Query: 165 P-VEKPPVYKPPAEKPP-VYKPPVYKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPP 332
           P V KPPV  PP   PP V KPPV KPPV KPP V KPPV   PV  P + KPP+  PP
Sbjct: 94  PHVPKPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPVV--PVTPPYIPKPPIVFPP 150

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 56/96 (58%), Positives = 61/96 (63%), Gaps = 10/96 (10%)
 Frame = +3

Query: 75  PVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPP-VEKPPVY-KPPAEKPP-VYKPPV 230
           P  KPP +KPP+ KPPV+KPP  +P        KPP V KPP Y KPPA  PP V KPP 
Sbjct: 31  PSPKPPTHKPPIVKPPVHKPPKPQPCPPPSSSPKPPHVPKPPHYPKPPAVHPPHVPKPPA 90

Query: 231 YKPP-VYKPPVEKPPVYKPP-VEKPPVYKPPVEKPP 332
             PP V KPPV  PP+  PP V KPPV KPPV KPP
Sbjct: 91  VHPPHVPKPPVVHPPIVHPPYVPKPPVVKPPVVKPP 126

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 62/121 (51%), Positives = 68/121 (56%), Gaps = 11/121 (9%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPP-VEKPPVYKPPVEKPP-VYKPPVEKPPVYKPP-VEKPPVY---KP 164
           V+ P V KPP   PP V KPPV  PP+  PP V KPPV KPPV KPP V KPPV     P
Sbjct: 80  VHPPHVPKPPAVHPPHVPKPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPVVPVTPP 139

Query: 165 PVEKPPVYKPP----AEKPPVYKPPVYKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKP 329
            + KPP+  PP        PV  P V KPP+  PP V  PPV   PV  P V KPP+  P
Sbjct: 140 YIPKPPIVFPPHVPLPPVVPVTPPYVPKPPIVFPPHVPLPPVV--PVTPPYVPKPPIVFP 197

Query: 330 P 332
           P
Sbjct: 198 P 198

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 63/155 (40%), Positives = 70/155 (45%), Gaps = 45/155 (29%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYKPP-VEKPPVYK---PPVEKPPVYKPP 167
           V+ P V KPPV  PP+  PP V KPPV KPPV KPP V KPPV     P + KPP+  PP
Sbjct: 91  VHPPHVPKPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPVVPVTPPYIPKPPIVFPP 150

Query: 168 --------------VEKPPVYKPP--------------AEKPPVYKPP-VYKPPV----- 245
                         V KPP+  PP                KPP+  PP V  PPV     
Sbjct: 151 HVPLPPVVPVTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPKPPIVFPPHVPLPPVVPVTP 210

Query: 246 -YKP-----PVEKPPVYKPPVEKPPVYKPPVEKPP 332
            Y P     PV  P V  PP+  PP    PV  PP
Sbjct: 211 PYVPLPPVVPVTPPFVPTPPIITPPTPTVPVPSPP 245

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 63/160 (39%), Positives = 68/160 (42%), Gaps = 50/160 (31%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPP-VEKPPVYKPPVEKPP-VYKPPV--------EKPPVYKPP----- 137
           V KPPV  PP+  PP V KPPV KPPV KPP V KPPV         KPP+  PP     
Sbjct: 96  VPKPPVVHPPIVHPPYVPKPPVVKPPVVKPPHVPKPPVVPVTPPYIPKPPIVFPPHVPLP 155

Query: 138 ---------VEKPPVYKPP--------------VEKPPVYKPP-AEKPPV------YKP- 224
                    V KPP+  PP              V KPP+  PP    PPV      Y P 
Sbjct: 156 PVVPVTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPKPPIVFPPHVPLPPVVPVTPPYVPL 215

Query: 225 ----PVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
               PV  P V  PP+  PP    PV  PP   P    PP
Sbjct: 216 PPVVPVTPPFVPTPPIITPPTPTVPVPSPPSETPCPPPPP 255

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 39/88 (44%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           V  P V KPP+  PP V  PPV   PV  P V  PPV   PV  P V  PP+  PP    
Sbjct: 184 VTPPYVPKPPIVFPPHVPLPPVV--PVTPPYVPLPPVV--PVTPPFVPTPPIITPPTPTV 239

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVE 263
           PV  PP+E P    PP   P  Y PP +
Sbjct: 240 PVPSPPSETPCPPPPPTVVP--YPPPAQ 265

[88][TOP]
>UniRef100_C0E650 Putative uncharacterized protein n=1 Tax=Corynebacterium matruchotii
            ATCC 33806 RepID=C0E650_9CORY
          Length = 1035

 Score =  106 bits (264), Expect = 9e-22
 Identities = 54/117 (46%), Positives = 60/117 (51%), Gaps = 10/117 (8%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPV-------EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 167
            +PPV +PP    P          P    P    P   +PPV KPP   PP  KPP   PP
Sbjct: 904  QPPVARPPTATAPAVPAAPGGSVPKTVAPGAAIPGTARPPVAKPPAPTPPTAKPPAAAPP 963

Query: 168  VEKPPVYKPPAEKPPVYKP---PVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            V KPP   PP   PP  +P   PV KPP  KPPV +PPV KPPV KPP+ KPP   P
Sbjct: 964  VAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVAKPPVAKPPMAKPPTIPP 1020

 Score =  105 bits (262), Expect = 2e-21
 Identities = 54/116 (46%), Positives = 60/116 (51%), Gaps = 10/116 (8%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYK-------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
            P  +PPV +PP    P          P    P    P   +PPV KPP   PP  KPP  
Sbjct: 901  PKAQPPVARPPTATAPAVPAAPGGSVPKTVAPGAAIPGTARPPVAKPPAPTPPTAKPPAA 960

Query: 174  KPPVYKPPAEKPPVYKPPVYKP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PPV KPP   PP   PP  +P   PV KPP  KPPV +PPV KPPV KPP+ KPP
Sbjct: 961  APPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVAKPPVAKPPMAKPP 1016

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 43/77 (55%), Positives = 45/77 (58%), Gaps = 3/77 (3%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP---PVYKPPVEKPPVYKPPVE 173
            V KPP   PP  KPP   PPV KPP   PP   PP  +P   PV KPP  KPPV +PPV 
Sbjct: 944  VAKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAKPPVAQPPVA 1003

Query: 174  KPPVYKPPAEKPPVYKP 224
            KPPV KPP  KPP   P
Sbjct: 1004 KPPVAKPPMAKPPTIPP 1020

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 45/127 (35%), Positives = 49/127 (38%), Gaps = 20/127 (15%)
 Frame = +3

Query: 12   PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPPV 185
            P    P    PP    P   PP    P  +PPV +PP    P     P    P    P  
Sbjct: 875  PGAAAPGSVAPPAAATPKATPPKAALPKAQPPVARPPTATAPAVPAAPGGSVPKTVAPGA 934

Query: 186  YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKP------------------PVEKPPVYK 311
              P   +PPV KPP   PP  KPP   PPV KP                  PV KPP  K
Sbjct: 935  AIPGTARPPVAKPPAPTPPTAKPPAAAPPVAKPPTATPPGAMPPGSRPAASPVAKPPAAK 994

Query: 312  PPVEKPP 332
            PPV +PP
Sbjct: 995  PPVAQPP 1001

[89][TOP]
>UniRef100_Q9LFR3 Putative uncharacterized protein F2G14_40 n=1 Tax=Arabidopsis
           thaliana RepID=Q9LFR3_ARATH
          Length = 275

 Score =  106 bits (264), Expect = 9e-22
 Identities = 61/116 (52%), Positives = 66/116 (56%), Gaps = 8/116 (6%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEK 176
           KPPV  PP+  PPV+ PP YKPP    P  KPP  +PP YKPP    KPP   P  P   
Sbjct: 89  KPPVSTPPIKLPPVQ-PPTYKPPT---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTT 144

Query: 177 PPVYKPPAEKPPVYKPPV--YKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPP 332
           PPV  PP + PP YKPP    KPP   PPV KPP   PPV+ PP Y PP    KPP
Sbjct: 145 PPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPP 197

 Score =  103 bits (257), Expect = 6e-21
 Identities = 61/121 (50%), Positives = 69/121 (57%), Gaps = 13/121 (10%)
 Frame = +3

Query: 6   YKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP--PVYKP 164
           YKPP       KPP  KPPV+ P +   PV KPPV  PP++ PPV +PP  KP  P  KP
Sbjct: 59  YKPPTLPTTPIKPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPV-QPPTYKPPTPTVKP 116

Query: 165 PVEKPPVYKPPAE--KPPVYKP--PVYKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEK 326
           P  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV+ 
Sbjct: 117 PSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPVKP 175

Query: 327 P 329
           P
Sbjct: 176 P 176

 Score =  102 bits (253), Expect = 2e-20
 Identities = 58/114 (50%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = +3

Query: 15  PVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           P  KPP   YKPP       KPP  KPPV  P +   PV KPPV  PP+  PPV+ PP Y
Sbjct: 50  PALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPVQ-PPTY 107

Query: 189 KPPAE--KPPVYKPPVYKP--PVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPP 332
           KPP    KPP  +PP YKP  P  KPP   P  P   PPV+ PPV +PP  KPP
Sbjct: 108 KPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPV-QPPTYKPP 160

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 61/119 (51%), Positives = 68/119 (57%), Gaps = 10/119 (8%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKP 164
           V  PP++ PPV +PP  KP  P  KPP  +PP YKPP    KPP   P  P   PPV  P
Sbjct: 92  VSTPPIKLPPV-QPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSP 150

Query: 165 PVEKPPVYKPPAE--KPPVYKPPVYKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP 329
           PV+ PP YKPP    KPP   PPV KPP   PPV+ PP Y PP    KPP   PPV+ P
Sbjct: 151 PVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPVKPP 205

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 54/102 (52%), Positives = 57/102 (55%), Gaps = 8/102 (7%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPV 170
           KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV
Sbjct: 115 KPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV 173

Query: 171 EKPPVYKPPAEKPPVYKPPV--YKPPVYKPPVEKPPVYKPPV 290
            KPP   PP + PP Y PP    KPP   PPV KPP   PPV
Sbjct: 174 -KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPV-KPPT-PPPV 210

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/104 (44%), Positives = 50/104 (48%), Gaps = 7/104 (6%)
 Frame = +3

Query: 42  PPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVY 218
           P +  P P  KPP    P  KPP    P YKPP       KPP  KPPV      KPP  
Sbjct: 36  PTLPSPSPATKPP---SPALKPPT---PSYKPPTLPTTPIKPPTTKPPV------KPPTI 83

Query: 219 KPPVYKPPVYKPPVEKPPV----YKPPVE--KPPVYKPPVEKPP 332
                KPPV  PP++ PPV    YKPP    KPP  +PP  KPP
Sbjct: 84  PVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPP 127

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 39/71 (54%), Positives = 41/71 (57%), Gaps = 2/71 (2%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           V  PPV+ PP YKPP    KPP   PPV KPP   PPV+ PP Y PP    PV KPP   
Sbjct: 147 VQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPT--TPV-KPPT-A 199

Query: 177 PPVYKPPAEKP 209
           PPV KPP   P
Sbjct: 200 PPV-KPPTPPP 209

[90][TOP]
>UniRef100_Q8LBI7 Putative uncharacterized protein n=1 Tax=Arabidopsis thaliana
           RepID=Q8LBI7_ARATH
          Length = 275

 Score =  106 bits (264), Expect = 9e-22
 Identities = 61/116 (52%), Positives = 66/116 (56%), Gaps = 8/116 (6%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEK 176
           KPPV  PP+  PPV+ PP YKPP    P  KPP  +PP YKPP    KPP   P  P   
Sbjct: 89  KPPVSTPPIKLPPVQ-PPTYKPPT---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTT 144

Query: 177 PPVYKPPAEKPPVYKPPV--YKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPP 332
           PPV  PP + PP YKPP    KPP   PPV KPP   PPV+ PP Y PP    KPP
Sbjct: 145 PPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPP 197

 Score =  103 bits (256), Expect = 8e-21
 Identities = 61/121 (50%), Positives = 67/121 (55%), Gaps = 13/121 (10%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVE-----KPPVYKPPVEKPPVYKPPVEKP--PVYKP 164
           YKPP       KPP  KPPV KPP       KPPV  PP++ PPV +PP  KP  P  KP
Sbjct: 59  YKPPTLPTTPIKPPTTKPPV-KPPTTSVTPVKPPVSTPPIKLPPV-QPPTYKPPTPTVKP 116

Query: 165 PVEKPPVYKPPAE--KPPVYKP--PVYKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEK 326
           P  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV+ 
Sbjct: 117 PSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPVKP 175

Query: 327 P 329
           P
Sbjct: 176 P 176

 Score =  101 bits (252), Expect = 2e-20
 Identities = 58/114 (50%), Positives = 63/114 (55%), Gaps = 8/114 (7%)
 Frame = +3

Query: 15  PVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           P  KPP   YKPP       KPP  KPPV KPP       KPPV  PP+  PPV+ PP Y
Sbjct: 50  PALKPPTPSYKPPTLPTTPIKPPTTKPPV-KPPTTSVTPVKPPVSTPPIKLPPVQ-PPTY 107

Query: 189 KPPAE--KPPVYKPPVYKP--PVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPP 332
           KPP    KPP  +PP YKP  P  KPP   P  P   PPV+ PPV +PP  KPP
Sbjct: 108 KPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPV-QPPTYKPP 160

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 61/119 (51%), Positives = 68/119 (57%), Gaps = 10/119 (8%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKP 164
           V  PP++ PPV +PP  KP  P  KPP  +PP YKPP    KPP   P  P   PPV  P
Sbjct: 92  VSTPPIKLPPV-QPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSP 150

Query: 165 PVEKPPVYKPPAE--KPPVYKPPVYKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP 329
           PV+ PP YKPP    KPP   PPV KPP   PPV+ PP Y PP    KPP   PPV+ P
Sbjct: 151 PVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPVKPP 205

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 54/102 (52%), Positives = 57/102 (55%), Gaps = 8/102 (7%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPV 170
           KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV
Sbjct: 115 KPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV 173

Query: 171 EKPPVYKPPAEKPPVYKPPV--YKPPVYKPPVEKPPVYKPPV 290
            KPP   PP + PP Y PP    KPP   PPV KPP   PPV
Sbjct: 174 -KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPV-KPPT-PPPV 210

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 39/71 (54%), Positives = 41/71 (57%), Gaps = 2/71 (2%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           V  PPV+ PP YKPP    KPP   PPV KPP   PPV+ PP Y PP    PV KPP   
Sbjct: 147 VQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPT--TPV-KPPT-A 199

Query: 177 PPVYKPPAEKP 209
           PPV KPP   P
Sbjct: 200 PPV-KPPTPPP 209

[91][TOP]
>UniRef100_Q39835 Extensin n=1 Tax=Glycine max RepID=Q39835_SOYBN
          Length = 432

 Score =  106 bits (264), Expect = 9e-22
 Identities = 68/136 (50%), Positives = 69/136 (50%), Gaps = 27/136 (19%)
 Frame = +3

Query: 6   YKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVE 143
           YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PPV 
Sbjct: 248 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 307

Query: 144 K----PPVYKPPVEKPPVYKPPAEKPPVYK-----PPVYK----PPVYKPPVEKPPVYKP 284
           K    PP YK P   PP YK P+  PPVYK     PPVYK    PP YK P   PP YK 
Sbjct: 308 KYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKY 367

Query: 285 PVEKPPVYKPPVEKPP 332
           P   PPVYK     PP
Sbjct: 368 PSPPPPVYKYKSPPPP 383

 Score =  104 bits (260), Expect = 3e-21
 Identities = 68/134 (50%), Positives = 69/134 (51%), Gaps = 25/134 (18%)
 Frame = +3

Query: 6   YKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVE 143
           YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PPV 
Sbjct: 287 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 346

Query: 144 K----PPVYKPPVEKPPVYKPPAEKPPVYKPPVYK--PPVYKPPVEKPPVYKPPVEKPPV 305
           K    PP YK P   PP YK P+  PPVYK   YK  PP YK P   PP YK P   PPV
Sbjct: 347 KYKSPPPPYKYPSPPPPPYKYPSPPPPVYK---YKSPPPPYKYPSPPPPPYKYPSPPPPV 403

Query: 306 YK-----PPVEKPP 332
           YK     PPV  PP
Sbjct: 404 YKYKSPPPPVHSPP 417

 Score =  102 bits (255), Expect = 1e-20
 Identities = 67/136 (49%), Positives = 68/136 (50%), Gaps = 27/136 (19%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVY 158
           YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVY
Sbjct: 238 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVY 297

Query: 159 K-----PPVEK----PPVYKPPAEKPPVYKPPVYKPPVYK-----PPVEK----PPVYKP 284
           K     PPV K    PP YK P+  PP YK P   PPVYK     PPV K    PP YK 
Sbjct: 298 KYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKY 357

Query: 285 PVEKPPVYKPPVEKPP 332
           P   PP YK P   PP
Sbjct: 358 PSPPPPPYKYPSPPPP 373

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 63/128 (49%), Positives = 64/128 (50%), Gaps = 21/128 (16%)
 Frame = +3

Query: 12  PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPP 152
           PPV K    PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP
Sbjct: 265 PPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 324

Query: 153 VYKPPVEKPPVYKPPAEKPPVYK----PPVYKPPVYKPPVEKPPVYKPPVEK----PPVY 308
            YK P   PPVYK  +  PPVYK    PP YK P   PP  K P   PPV K    PP Y
Sbjct: 325 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPY 384

Query: 309 KPPVEKPP 332
           K P   PP
Sbjct: 385 KYPSPPPP 392

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 62/125 (49%), Positives = 64/125 (51%), Gaps = 18/125 (14%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK 176
           PP +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK     PPV K
Sbjct: 213 PPPKKP--YKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYK 269

Query: 177 ----PPVYKPPAEKPPVYKPPVYKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPP 317
               PP YK P+  PP YK P   PPVYK     PPV K    PP YK P   PP YK P
Sbjct: 270 YKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYP 329

Query: 318 VEKPP 332
              PP
Sbjct: 330 SPPPP 334

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 63/125 (50%), Positives = 64/125 (51%), Gaps = 18/125 (14%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVY 158
           YK P   PPVYK     PP YK P   PP YK P   PPVYK     PPV K    PP Y
Sbjct: 219 YKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPY 277

Query: 159 KPPVEKPPVYKPPAEKPPVYK-----PPVYK----PPVYKPPVEKPPVYKPPVEKPPVYK 311
           K P   PP YK P+  PPVYK     PPVYK    PP YK P   PP YK P   PP   
Sbjct: 278 KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYP--SPP--- 332

Query: 312 PPVEK 326
           PPV K
Sbjct: 333 PPVYK 337

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 57/118 (48%), Positives = 59/118 (50%), Gaps = 9/118 (7%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVY 158
           YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVY
Sbjct: 316 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVY 375

Query: 159 KPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           K     PP YK P+  PP YK P   PPVYK     PPV+ PP   PP Y      PP
Sbjct: 376 KYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVHSPP---PPHYIYASPPPP 429

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 58/122 (47%), Positives = 62/122 (50%), Gaps = 13/122 (10%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y     PP +KP  YK P   PPVYK     PP YK P  
Sbjct: 193 HSPP---PPKHSPP---PPYYYKSPPPPPKKP--YKYPSPPPPVYKYK-SPPPPYKYPSP 243

Query: 174 KPPVYKPPAEKPPVYK-----PPVYK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
            PP YK P+  PPVYK     PPVYK    PP YK P   PP YK P   PPVYK     
Sbjct: 244 PPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPP 303

Query: 327 PP 332
           PP
Sbjct: 304 PP 305

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 58/122 (47%), Positives = 60/122 (49%), Gaps = 15/122 (12%)
 Frame = +3

Query: 12  PPVEKPP---VYK---PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           PP   PP    YK   PP +KP  YK P   PPVYK     PP YK P   PP YK P  
Sbjct: 197 PPKHSPPPPYYYKSPPPPPKKP--YKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSP 253

Query: 174 KPPVYKPPAEKPPVYK----PPVYKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
            PPVYK  +  PPVYK    PP YK      P YK P   PPVYK     PPVYK     
Sbjct: 254 PPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPP 313

Query: 327 PP 332
           PP
Sbjct: 314 PP 315

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 56/124 (45%), Positives = 60/124 (48%), Gaps = 17/124 (13%)
 Frame = +3

Query: 12  PPVEKPP----VYKPPVEKPPVYKPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKPP 167
           PP   PP     + PP   PP + PP   PP Y     PP +KP  YK P   PPVYK  
Sbjct: 181 PPKHSPPPPYYYHSPP---PPKHSPP---PPYYYKSPPPPPKKP--YKYPSPPPPVYKYK 232

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPV 320
              PP YK P+  PP YK P   PPVYK     PPV K    PP YK P   PP YK P 
Sbjct: 233 -SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPS 291

Query: 321 EKPP 332
             PP
Sbjct: 292 PPPP 295

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 53/115 (46%), Positives = 56/115 (48%), Gaps = 14/115 (12%)
 Frame = +3

Query: 6   YKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYK-----PPVEKPPVYKPPVE 143
           YK P   PPVYK     PPV K    PP YK P   PP YK     PPV K   YK P  
Sbjct: 326 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYK---YKSP-- 380

Query: 144 KPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
            PP YK P   PP YK P+  PPVYK     PPV+ PP   PP Y      PP +
Sbjct: 381 -PPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVHSPP---PPHYIYASPPPPYH 431

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 52/115 (45%), Positives = 57/115 (49%), Gaps = 6/115 (5%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY----KPPVEKPPVYKPP 167
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y     PP +KP  YK P
Sbjct: 177 HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYKSPPPPPKKP--YKYP 222

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PPVYK  +  PP YK P   PP YK P   PPVYK     PPVYK     PP
Sbjct: 223 SPPPPVYKYKSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 276

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 43/92 (46%), Positives = 46/92 (50%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYK     PP YK P   PP YK P   PPVYK     PP YK P   PP YK P   PP
Sbjct: 345 VYKYKSPPPP-YKYPSPPPPPYKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPP 402

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVY 278
           VYK  +  PPV+ PP   PP Y      PP +
Sbjct: 403 VYKYKSPPPPVHSPP---PPHYIYASPPPPYH 431

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 53/130 (40%), Positives = 57/130 (43%), Gaps = 23/130 (17%)
 Frame = +3

Query: 12  PPVEKPP----VYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 167
           PP   PP     + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 149 PPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 196

Query: 168 VEK---PPVYKPPAEKPPVYK--------PPVYK----PPVYKPPVEKPPVYKPPVEKPP 302
             K   PP Y   +  PP  K        PPVYK    PP YK P   PP YK P   PP
Sbjct: 197 PPKHSPPPPYYYKSPPPPPKKPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPP 256

Query: 303 VYKPPVEKPP 332
           VYK     PP
Sbjct: 257 VYKYKSPPPP 266

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 50/128 (39%), Positives = 56/128 (43%), Gaps = 21/128 (16%)
 Frame = +3

Query: 12  PPVEKPP----VYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 167
           PP   PP     + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 117 PPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 164

Query: 168 VEK---PPVYKPPAEKPPVYKPPVYKPPVY--KPPVEK---PPVY-----KPPVEKPPVY 308
             K   PP Y   +  PP + PP   PP Y   PP  K   PP Y      PP +KP  Y
Sbjct: 165 PPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPPPPYYYKSPPPPPKKP--Y 219

Query: 309 KPPVEKPP 332
           K P   PP
Sbjct: 220 KYPSPPPP 227

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/119 (39%), Positives = 53/119 (44%), Gaps = 14/119 (11%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPV 170
           +Y  P   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP 
Sbjct: 31  IYSSP--PPPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP- 75

Query: 171 EKPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
             PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 76  --PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 123

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/118 (39%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 49  HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 91

Query: 174 KPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 92  -PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 139

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/118 (39%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 65  HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 107

Query: 174 KPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 108 -PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 155

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/118 (39%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 81  HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 123

Query: 174 KPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 124 -PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 171

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/118 (39%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 97  HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 139

Query: 174 KPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 140 -PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 187

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/118 (39%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 113 HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 155

Query: 174 KPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 156 -PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 203

[92][TOP]
>UniRef100_Q2V375 Putative uncharacterized protein At5g14920.2 n=1 Tax=Arabidopsis
           thaliana RepID=Q2V375_ARATH
          Length = 223

 Score =  106 bits (264), Expect = 9e-22
 Identities = 61/116 (52%), Positives = 66/116 (56%), Gaps = 8/116 (6%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPPVYKP--PVEK 176
           KPPV  PP+  PPV+ PP YKPP    P  KPP  +PP YKPP    KPP   P  P   
Sbjct: 89  KPPVSTPPIKLPPVQ-PPTYKPPT---PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTT 144

Query: 177 PPVYKPPAEKPPVYKPPV--YKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE--KPP 332
           PPV  PP + PP YKPP    KPP   PPV KPP   PPV+ PP Y PP    KPP
Sbjct: 145 PPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPP 197

 Score =  103 bits (257), Expect = 6e-21
 Identities = 61/121 (50%), Positives = 69/121 (57%), Gaps = 13/121 (10%)
 Frame = +3

Query: 6   YKPPVE-----KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP--PVYKP 164
           YKPP       KPP  KPPV+ P +   PV KPPV  PP++ PPV +PP  KP  P  KP
Sbjct: 59  YKPPTLPTTPIKPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPV-QPPTYKPPTPTVKP 116

Query: 165 PVEKPPVYKPPAE--KPPVYKP--PVYKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEK 326
           P  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV+ 
Sbjct: 117 PSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPVKP 175

Query: 327 P 329
           P
Sbjct: 176 P 176

 Score =  102 bits (253), Expect = 2e-20
 Identities = 58/114 (50%), Positives = 64/114 (56%), Gaps = 8/114 (7%)
 Frame = +3

Query: 15  PVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           P  KPP   YKPP       KPP  KPPV  P +   PV KPPV  PP+  PPV+ PP Y
Sbjct: 50  PALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPVQ-PPTY 107

Query: 189 KPPAE--KPPVYKPPVYKP--PVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPP 332
           KPP    KPP  +PP YKP  P  KPP   P  P   PPV+ PPV +PP  KPP
Sbjct: 108 KPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPV-QPPTYKPP 160

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 61/119 (51%), Positives = 68/119 (57%), Gaps = 10/119 (8%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKP 164
           V  PP++ PPV +PP  KP  P  KPP  +PP YKPP    KPP   P  P   PPV  P
Sbjct: 92  VSTPPIKLPPV-QPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSP 150

Query: 165 PVEKPPVYKPPAE--KPPVYKPPVYKPPVYKPPVEKPPVYKPPVE--KPPVYKPPVEKP 329
           PV+ PP YKPP    KPP   PPV KPP   PPV+ PP Y PP    KPP   PPV+ P
Sbjct: 151 PVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPVKPP 205

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 54/102 (52%), Positives = 57/102 (55%), Gaps = 8/102 (7%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVE--KPPVYKP--PVEKPPVYKPPVEKPPVYKPPVE--KPPVYKPPV 170
           KPP  +PP YKPP    KPP   P  P   PPV  PPV+ PP YKPP    KPP   PPV
Sbjct: 115 KPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQ-PPTYKPPTSPVKPPTTTPPV 173

Query: 171 EKPPVYKPPAEKPPVYKPPV--YKPPVYKPPVEKPPVYKPPV 290
            KPP   PP + PP Y PP    KPP   PPV KPP   PPV
Sbjct: 174 -KPPTTTPPVQ-PPTYNPPTTPVKPPT-APPV-KPPT-PPPV 210

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/104 (44%), Positives = 50/104 (48%), Gaps = 7/104 (6%)
 Frame = +3

Query: 42  PPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVY 218
           P +  P P  KPP    P  KPP    P YKPP       KPP  KPPV      KPP  
Sbjct: 36  PTLPSPSPATKPP---SPALKPPT---PSYKPPTLPTTPIKPPTTKPPV------KPPTI 83

Query: 219 KPPVYKPPVYKPPVEKPPV----YKPPVE--KPPVYKPPVEKPP 332
                KPPV  PP++ PPV    YKPP    KPP  +PP  KPP
Sbjct: 84  PVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPP 127

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 39/71 (54%), Positives = 41/71 (57%), Gaps = 2/71 (2%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           V  PPV+ PP YKPP    KPP   PPV KPP   PPV+ PP Y PP    PV KPP   
Sbjct: 147 VQSPPVQ-PPTYKPPTSPVKPPTTTPPV-KPPTTTPPVQ-PPTYNPPT--TPV-KPPT-A 199

Query: 177 PPVYKPPAEKP 209
           PPV KPP   P
Sbjct: 200 PPV-KPPTPPP 209

[93][TOP]
>UniRef100_Q9T0K5 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9T0K5_ARATH
          Length = 760

 Score =  105 bits (263), Expect = 1e-21
 Identities = 54/106 (50%), Positives = 54/106 (50%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   PPVY PP   PP   PPV  PP   PP   PPVY PP   PP    P   PPVY 
Sbjct: 428 PPSPPPPVYSPPPPPPP--PPPVYSPPPPPPPPPPPPVYSPPPPPPP----PPPPPPVYS 481

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PP   PP   PPVY PP   PP   PPVY PP   PPVY  P   P
Sbjct: 482 PPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP--PPPVYSSPPPPP 525

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 52/111 (46%), Positives = 53/111 (47%), Gaps = 4/111 (3%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYK---PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           P +  PP   P    PP      PP   PPVY PP   PP   PPV  PP   PP   PP
Sbjct: 405 PSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPP--PPPVYSPPPPPPPPPPPP 462

Query: 183 VYKPPAEKPPVYKPP-VYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VY PP   PP   PP VY PP   PP   PPVY PP   PP   PPV  PP
Sbjct: 463 VYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP 513

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 54/115 (46%), Positives = 55/115 (47%), Gaps = 8/115 (6%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPV-EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           PP   PPVY PP   PP   PPV   PP   PP   PPVY PP   PP   PPV  PP  
Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP 500

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKP-----PVY--KPPVEKPPVYKPPVEKPP 332
            PP   PPVY PP   PPVY  P   P     PVY  +PP   P    PP   PP
Sbjct: 501 PPPPPPPPVYSPP--PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPP 553

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/116 (46%), Positives = 54/116 (46%), Gaps = 6/116 (5%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPPVEKP 179
           VY PP   PP   PPV  PP   PP   PPVY PP   PP   PP V  PP   PP   P
Sbjct: 435 VYSPPPPPPP--PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY-----KPPVEKPP 332
           PVY PP   PP   PPVY PP   PPV   P   P     PVY      PP   PP
Sbjct: 493 PVYSPPPPPPPPPPPPVYSPP--PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP 546

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 52/117 (44%), Positives = 55/117 (47%), Gaps = 11/117 (9%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPP------VYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           PPV  PP   PP   PPVY PP   PP      VY PP   PP   PPV  PP   PP  
Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505

Query: 174 KPPVYKPPAEKPPVYKPPVYKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            PPVY PP   PPVY  P   P     PVY      PP + PP   PP + PP  +P
Sbjct: 506 PPPVYSPP--PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP---PPQFSPPPPEP 557

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 51/118 (43%), Positives = 54/118 (45%), Gaps = 11/118 (9%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPP------VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           PP   PPVY PP   PP      VY PP   PP   PPV  PP   PP   PPVY PP  
Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP-- 513

Query: 174 KPPVYKPPAEKPPVYKPPVY--KPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPP 332
            PPVY  P   P     PVY  +PP   P    PP + PP  +P  Y    PP   PP
Sbjct: 514 PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPP 571

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 49/112 (43%), Positives = 52/112 (46%), Gaps = 5/112 (4%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP---- 179
           PP   PPVY PP   PP   PPV  PP   PP   PPVY PP   PPVY  P   P    
Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP--PPPVYSSPPPPPSPAP 529

Query: 180 -PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PVY      PP + PP   PP + PP  +P  Y  P   PP   PP   PP
Sbjct: 530 TPVYCTRPPPPPPHSPP---PPQFSPPPPEPYYYSSP--PPPHSSPPPHSPP 576

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 49/115 (42%), Positives = 52/115 (45%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPP 167
           VY PP   PP   PPV  PP   PP   PPVY PP   PPVY  P   P     PVY   
Sbjct: 479 VYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP--PPPVYSSPPPPPSPAPTPVYCTR 536

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PP + PP   PP + PP  +P  Y  P   PP   PP   PP   PP   PP
Sbjct: 537 PPPPPPHSPP---PPQFSPPPPEPYYYSSP--PPPHSSPPPHSPP---PPHSPPP 583

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 48/121 (39%), Positives = 53/121 (43%), Gaps = 14/121 (11%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPV---EKPPVYKPPVEKP-----PVYKPPVEKPPVYKPP 167
           PP   PPVY PP   PP   PPV     PPVY  P   P     PVY      PP + PP
Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP 546

Query: 168 VEKPPVYKPPAEKPPVYK---PPVYKPPVYKPP---VEKPPVYKPPVEKPPVYKPPVEKP 329
              PP + PP  +P  Y    PP   PP + PP      PP+Y  P   PP    PV  P
Sbjct: 547 ---PPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIY--PYLSPPPPPTPVSSP 601

Query: 330 P 332
           P
Sbjct: 602 P 602

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 50/126 (39%), Positives = 56/126 (44%), Gaps = 19/126 (15%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           PP   PPVY PP   PPVY  P   P     PVY      PP + PP   PP + PP  +
Sbjct: 502 PPPPPPPVYSPP--PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP---PPQFSPPPPE 556

Query: 177 PPVYK---PPAEKPPVYKPP---VYKPPVY---KPPVEKPPVYKPPVEKPPVYKPP---- 317
           P  Y    PP   PP + PP      PP+Y    PP    PV  PP    PVY PP    
Sbjct: 557 PYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPP--PTPVYSPPPPPP 614

Query: 318 -VEKPP 332
            +E PP
Sbjct: 615 CIEPPP 620

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 46/111 (41%), Positives = 49/111 (44%), Gaps = 8/111 (7%)
 Frame = +3

Query: 24  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV------ 185
           +PPV  P +  P +  PP   P    PP    P   PP   PPVY PP    P       
Sbjct: 395 RPPVVTP-LPPPSLPSPPPPAPIFSTPPTLTSP--PPPSPPPPVYSPP----PPPPPPPP 447

Query: 186 -YKPPAEKPPVYKPPVYK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            Y PP   PP   PPVY  PP   PP   PPVY PP   PP   PPV  PP
Sbjct: 448 VYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPP 498

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 51/139 (36%), Positives = 58/139 (41%), Gaps = 29/139 (20%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKP-----PVY--KPPVEKP-----PVYKPPVEKPPVYK---PP 137
           VY PP   PPVY  P   P     PVY  +PP   P     P + PP  +P  Y    PP
Sbjct: 509 VYSPP--PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPP 566

Query: 138 VEKPPVYKPP---VEKPPVY---KPPAEKPPVYKP---PVYKPPVYKPPVEKPP-----V 275
              PP + PP      PP+Y    PP    PV  P   PVY PP   P +E PP      
Sbjct: 567 HSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIE 626

Query: 276 YKPPVEKPPVYKPPVEKPP 332
           Y PP   P V+      PP
Sbjct: 627 YSPPPPPPVVHYSSPPPPP 645

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 44/119 (36%), Positives = 51/119 (42%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYK---PPVEKPPVYKPPVEK---PPVY---KPPVEKPPVYKPPVEKPPVY 158
           + PP  +P  Y    PP   PP + PP      PP+Y    PP    PV  PP    PVY
Sbjct: 550 FSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPP--PTPVY 607

Query: 159 KPPVEKPPVYKPPAEKPPV-YKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   PP  +PP   P + Y PP   P V+      PPVY      PPVY      PP
Sbjct: 608 SPP-PPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPP 665

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 41/105 (39%), Positives = 45/105 (42%), Gaps = 3/105 (2%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-Y 188
           PP   PP + PP    P   PP    PV  PP    PVY PP   PP  +PP   P + Y
Sbjct: 571 PPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPP--PTPVYSPP-PPPPCIEPPPPPPCIEY 627

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP   P V+      PPVY      PPVY   PP   P  Y  P
Sbjct: 628 SPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSP 672

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 40/109 (36%), Positives = 43/109 (39%), Gaps = 3/109 (2%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVY 188
           PP    PV  PP    PVY PP   PP  +PP   P + Y PP   P V+      PPVY
Sbjct: 591 PPPPPTPVSSPP--PTPVYSPP-PPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVY 647

Query: 189 KPPAEKPPVY--KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
                 PPVY   PP   P  Y  P      Y  P   P  Y  P   P
Sbjct: 648 YSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPP 696

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 40/113 (35%), Positives = 44/113 (38%), Gaps = 3/113 (2%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVE 173
           VY PP   PP  +PP   P + Y PP   P V+      PPVY      PPVY   PP  
Sbjct: 606 VYSPPP-PPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPP 664

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P  Y  P      Y  P   P  Y  P   PP    P E+ P   P V   P
Sbjct: 665 PPVHYSSPPPPEVHYHSPPPSPVHYSSP---PPPPSAPCEESPPPAPVVHHSP 714

[94][TOP]
>UniRef100_Q39599 Extensin n=1 Tax=Catharanthus roseus RepID=Q39599_CATRO
          Length = 225

 Score =  105 bits (263), Expect = 1e-21
 Identities = 65/128 (50%), Positives = 67/128 (52%), Gaps = 18/128 (14%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPPVYKPPVEKPPVYK---P 164
           V+K P   PP YK P   PPVYK P   P  YK   PP  KP  YK P   PPVYK   P
Sbjct: 39  VHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYKSPPPPPHKPYKYKSPPPPPPVYKSPPP 98

Query: 165 PVEKPPVYK------PPAEKPPVYK----PPVYKPP-VYKPPVEKPPVYK-PPVEKPPVY 308
           P  KP  YK      PP  KP  YK    PPVYKPP VYK P   P V+K PP   PPVY
Sbjct: 99  PPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVY 158

Query: 309 KPPVEKPP 332
           K P   PP
Sbjct: 159 KSPPSPPP 166

 Score =  100 bits (250), Expect = 4e-20
 Identities = 60/114 (52%), Positives = 62/114 (54%), Gaps = 5/114 (4%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPPVYKPPVEK 176
           YK P   PPV+K P   PP YK P   PPVYK P   P  YK   PP  KP  YK P   
Sbjct: 30  YKSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYKSPPPPPHKPYKYKSPPPP 89

Query: 177 PPVYKPPAEKPPVYKPPVYK-PPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPP 332
           PPVYK P   PP +KP  YK PP   PP  KP  YK P   PPVYKPP V K P
Sbjct: 90  PPVYKSPP--PPPHKPYKYKSPPPPPPPPHKPYKYKSP-PPPPVYKPPYVYKSP 140

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 65/141 (46%), Positives = 70/141 (49%), Gaps = 32/141 (22%)
 Frame = +3

Query: 6   YKPPVEKPPVYK-------------PPVEKPPVYKPPVEKPPVYK---PPVEKPPVYK-- 131
           YK P   PPVYK             PP  KP  YK P   PPVYK   PP  KP  YK  
Sbjct: 50  YKSPPPPPPVYKSPPPPPYKYKSPPPPPHKPYKYKSPPPPPPVYKSPPPPPHKPYKYKSP 109

Query: 132 ----PPVEKPPVYK----PPVEKPP-VYKPPAEKPPVYK-PPVYKPPVYK----PPVEKP 269
               PP  KP  YK    PPV KPP VYK P   P V+K PP   PPVYK    PP +KP
Sbjct: 110 PPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVYKSPPSPPPKKP 169

Query: 270 PVYKPPVEKPPVYKPPVEKPP 332
             YK P   PP++K P+  PP
Sbjct: 170 YKYKSP-PPPPIHKSPLPSPP 189

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 57/118 (48%), Positives = 58/118 (49%), Gaps = 16/118 (13%)
 Frame = +3

Query: 27  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---PP 197
           PP Y PP      YK P   PPV+K P   PP YK P   PPVYK P   P  YK   PP
Sbjct: 21  PPHYSPPYH----YKSPPPPPPVHKYPPPPPPFYKSPPPPPPVYKSPPPPPYKYKSPPPP 76

Query: 198 AEKPPVYKPPVYKPPVYK---PPVEKPPVYK------PPVEKPPVYK----PPVEKPP 332
             KP  YK P   PPVYK   PP  KP  YK      PP  KP  YK    PPV KPP
Sbjct: 77  PHKPYKYKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPP 134

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 59/119 (49%), Positives = 66/119 (55%), Gaps = 14/119 (11%)
 Frame = +3

Query: 3   VYK---PPVEKPPVYK-PPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYK-P 164
           VYK   PP  KP  YK PP   PP +KP   K P   PPV KPP VYK P   P V+K P
Sbjct: 92  VYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPP-PPPVYKPPYVYKSPPPPPSVHKYP 150

Query: 165 PVEKPPVYK----PPAEKPPVYK----PPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           P   PPVYK    PP +KP  YK    PP++K P+  PP +KP  YK P    PVYK P
Sbjct: 151 PPSPPPVYKSPPSPPPKKPYKYKSPPPPPIHKSPLPSPP-KKPYKYKYP-PPTPVYKSP 207

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 59/140 (42%), Positives = 64/140 (45%), Gaps = 32/140 (22%)
 Frame = +3

Query: 6   YKPPVEKPPVYK---PPVEKPPVYK------PPVEKPPVYK----PPVEKPP-VYKPPVE 143
           YK P   PPVYK   PP  KP  YK      PP  KP  YK    PPV KPP VYK P  
Sbjct: 83  YKSPPPPPPVYKSPPPPPHKPYKYKSPPPPPPPPHKPYKYKSPPPPPVYKPPYVYKSPPP 142

Query: 144 KPPVYK-PPVEKPPVYK----PPAEKPPVYK----PPVYKPP---------VYKPPVEKP 269
            P V+K PP   PPVYK    PP +KP  YK    PP++K P          YK P   P
Sbjct: 143 PPSVHKYPPPSPPPVYKSPPSPPPKKPYKYKSPPPPPIHKSPLPSPPKKPYKYKYPPPTP 202

Query: 270 PVYKPPVEKPPVYKPPVEKP 329
               PP     +Y  P   P
Sbjct: 203 VYKSPPPPHHYLYTSPPPPP 222

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 55/117 (47%), Positives = 60/117 (51%), Gaps = 10/117 (8%)
 Frame = +3

Query: 12  PPVEKPPVYK----PPVEKPP-VYKPPVEKPPVYK-PPVEKPPVYK----PPVEKPPVYK 161
           PP  KP  YK    PPV KPP VYK P   P V+K PP   PPVYK    PP +KP  YK
Sbjct: 114 PPPHKPYKYKSPPPPPVYKPPYVYKSPPPPPSVHKYPPPSPPPVYKSPPSPPPKKPYKYK 173

Query: 162 PPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P   PP++K P   PP  KP  YK   Y PP    PVYK P   PP +      PP
Sbjct: 174 SP-PPPPIHKSPLPSPP-KKPYKYK---YPPPT---PVYKSP---PPPHHYLYTSPP 219

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 43/103 (41%), Positives = 49/103 (47%), Gaps = 1/103 (0%)
 Frame = +3

Query: 3   VYKPPVEKPPVYK-PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           VYK P   P V+K PP   PPVYK P   PP      +KP  YK P   PP   PP+ K 
Sbjct: 136 VYKSPPPPPSVHKYPPPSPPPVYKSPPSPPP------KKPYKYKSP---PP---PPIHKS 183

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
           P+  PP +KP  YK P   P    PP     +Y  P   PP Y
Sbjct: 184 PLPSPP-KKPYKYKYPPPTPVYKSPPPPHHYLYTSP--PPPPY 223

[95][TOP]
>UniRef100_Q1XBU0 Foot protein 1 n=1 Tax=Mytilus edulis RepID=Q1XBU0_MYTED
          Length = 565

 Score =  105 bits (263), Expect = 1e-21
 Identities = 53/116 (45%), Positives = 57/116 (49%), Gaps = 6/116 (5%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKP +  PP YKP    PP YK      P YKP +  PP YK     PP YKP    PP
Sbjct: 126 VYKPKMTYPPTYKPKPSYPPTYK----SKPTYKPKITCPPTYKAKPSYPPTYKPKKTYPP 181

Query: 183 VYKPPAEKPPVYKP-----PVYKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            YKP    PP YKP     P+YK  P YKP +  PP YK     PP YK     PP
Sbjct: 182 TYKPKVTYPPTYKPKPSYPPIYKSKPTYKPKITYPPTYKAKPSYPPTYKAKPSYPP 237

 Score =  104 bits (259), Expect = 4e-21
 Identities = 50/109 (45%), Positives = 54/109 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y      PPVYKP +  PP YKP    PP YK      P YKP +  PP YK     PP 
Sbjct: 117 YNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYK----SKPTYKPKITCPPTYKAKPSYPPT 172

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP V  PP YKP    PP+YK      P YKP +  PP
Sbjct: 173 YKPKKTYPPTYKPKVTYPPTYKPKPSYPPIYK----SKPTYKPKITYPP 217

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 53/131 (40%), Positives = 56/131 (42%), Gaps = 22/131 (16%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK------PP 167
           YKP +  PP YK     PP YKP    PP YKP V  PP YKP    PP+YK      P 
Sbjct: 153 YKPKITCPPTYKAKPSYPPTYKPKKTYPPTYKPKVTYPPTYKPKPSYPPIYKSKPTYKPK 212

Query: 168 VEKPPVYKPPAEKPPVYK-----PPVYK-----------PPVYKPPVEKPPVYKPPVEKP 299
           +  PP YK     PP YK     PP YK           P  YK     PP YK     P
Sbjct: 213 ITYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPPTYKAKPSYP 272

Query: 300 PVYKPPVEKPP 332
           P YK     PP
Sbjct: 273 PTYKAKPSYPP 283

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 45/108 (41%), Positives = 48/108 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YKP    PP YK     P  YKP    PP YKP +  PP 
Sbjct: 455 YKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPT 514

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP    PP YKP +  P  YK     PP YK     PP Y   +  P
Sbjct: 515 YKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTSYPPTYNKKISYP 562

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 45/109 (41%), Positives = 47/109 (43%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y    +  P YK     PP YK     PP YKP    PP YK     P  YKP    PP 
Sbjct: 445 YPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPT 504

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP    PP YKP +  P  YK     PP YK     PP
Sbjct: 505 YKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTSYPP 553

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 44/108 (40%), Positives = 48/108 (44%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KP  +  P Y    +  P YK     PP YK     PP YKP    PP YK     P  Y
Sbjct: 436 KPTYKAKPTYPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSSYPSSY 495

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KP    PP YKP +  PP YKP    PP YKP +  P  YK     PP
Sbjct: 496 KPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPP 543

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 42/101 (41%), Positives = 44/101 (43%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP 
Sbjct: 465 YKAKPSYPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPS 524

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
           YKP    P  YK     PP YK     PP Y   +  P  Y
Sbjct: 525 YKPKITYPSTYKLKPSYPPTYKSKTSYPPTYNKKISYPSQY 565

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 53/136 (38%), Positives = 58/136 (42%), Gaps = 27/136 (19%)
 Frame = +3

Query: 6   YKPP----VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-------PVEKPP 152
           YKPP    ++K   Y+P    PP Y         Y P  +K   YKP           PP
Sbjct: 70  YKPPTYQQLKKKVDYRPTKSYPPTYGSKTN----YLPLAKKLSSYKPIKTTYNAKTNYPP 125

Query: 153 VYKPPVEKPPVYKPPAEKPPVYK-----------PPVYK-----PPVYKPPVEKPPVYKP 284
           VYKP +  PP YKP    PP YK           PP YK     PP YKP    PP YKP
Sbjct: 126 VYKPKMTYPPTYKPKPSYPPTYKSKPTYKPKITCPPTYKAKPSYPPTYKPKKTYPPTYKP 185

Query: 285 PVEKPPVYKPPVEKPP 332
            V  PP YKP    PP
Sbjct: 186 KVTYPPTYKPKPSYPP 201

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 45/121 (37%), Positives = 47/121 (38%), Gaps = 12/121 (9%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEK-- 176
           Y P  +  P Y      PP YK     PP YK     PP YK     PP YK  P  K  
Sbjct: 281 YPPTYKAKPTYIAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKSSYPPTYKAKPTYKAK 340

Query: 177 ---PPVYKPPAEKPPVYK-PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
              P  YK     PP YK  P YK     P  YK     P  YK     PP YKP +  P
Sbjct: 341 PTYPSTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPSTYKAKPSYPPTYKPKISYP 400

Query: 330 P 332
           P
Sbjct: 401 P 401

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 39/111 (35%), Positives = 43/111 (38%), Gaps = 2/111 (1%)
 Frame = +3

Query: 6   YKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           YK     PP YK  P  +  P Y    +  P Y P  +  P YK     P  YK     P
Sbjct: 321 YKAKSSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYP 380

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             YK     PP YKP +  PP YK     P  YK     PP YK     PP
Sbjct: 381 STYKAKPSYPPTYKPKISYPPTYKAKPSYPSTYKAKSSYPPTYKAKPSYPP 431

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 36/101 (35%), Positives = 39/101 (38%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KP  +  P Y    +  P Y P  +  P YK     P  YK     P  YK     PP Y
Sbjct: 334 KPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPSTYKAKPSYPPTY 393

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
           KP    PP YK     P  YK     PP YK     PP YK
Sbjct: 394 KPKISYPPTYKAKPSYPSTYKAKSSYPPTYKAKPSYPPTYK 434

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 48/143 (33%), Positives = 51/143 (35%), Gaps = 34/143 (23%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEK---------------PPVYKPP 137
           YKP +  PP YK     PP YK     PP YK  P  K               PP YK  
Sbjct: 209 YKPKITYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPPTYKAK 268

Query: 138 VEKPPVYK-----PPVEK-----------PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKP 269
              PP YK     PP  K           PP YK     PP YK     PP YK     P
Sbjct: 269 PSYPPTYKAKPSYPPTYKAKPTYIAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKSSYP 328

Query: 270 PVY--KPPVEKPPVYKPPVEKPP 332
           P Y  KP  +  P Y    +  P
Sbjct: 329 PTYKAKPTYKAKPTYPSTYKAKP 351

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 46/141 (32%), Positives = 49/141 (34%), Gaps = 32/141 (22%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y    +  P Y P  +  P YK     P  YK     P  YK     PP YKP +  PP 
Sbjct: 343 YPSTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYPSTYKAKPSYPPTYKPKISYPPT 402

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYK-PPVEK---------------------P 269
           YK     P  YK     PP YK     PP YK  P  K                     P
Sbjct: 403 YKAKPSYPSTYKAKSSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTYP 462

Query: 270 PVYKPPVEKPPVYKPPVEKPP 332
           P YK     PP YKP    PP
Sbjct: 463 PTYKAKPSYPPTYKPKPSYPP 483

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 42/115 (36%), Positives = 49/115 (42%), Gaps = 14/115 (12%)
 Frame = +3

Query: 27  PPVYKPPVEKPPVYKPPVE------KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           P  Y    +  PVYKP         KPP Y+  ++K   Y+P    PP Y         Y
Sbjct: 46  PNAYPYGTKPEPVYKPVKTSYSAPYKPPTYQQ-LKKKVDYRPTKSYPPTYGSKTN----Y 100

Query: 189 KPPAEKPPVYKP-------PVYKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKP 329
            P A+K   YKP           PPVYKP +  PP YKP    PP YK  P  KP
Sbjct: 101 LPLAKKLSSYKPIKTTYNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYKSKPTYKP 155

[96][TOP]
>UniRef100_UPI000198347D PREDICTED: hypothetical protein isoform 2 n=1 Tax=Vitis vinifera
           RepID=UPI000198347D
          Length = 217

 Score =  105 bits (262), Expect = 2e-21
 Identities = 74/122 (60%), Positives = 78/122 (63%), Gaps = 12/122 (9%)
 Frame = +3

Query: 3   VYK-PPVEKPPV-YKPPVEKPPVYKP-PVEKP--PVYK-PPVEK-PPVYKPPVEKPPVYK 161
           VYK PP+ KPP  YKPP    PVYKP PVEKP  PVY+ PPVEK PP YKPP    PVYK
Sbjct: 38  VYKSPPLGKPPPEYKPPT---PVYKPPPVEKPPTPVYRPPPVEKPPPEYKPPT---PVYK 91

Query: 162 -PPVEK-PPVYKPPAEKPPVYKPPVYK--PPVYKPPVE-KPPVYKPPVEKPPVYKPPVEK 326
            PPVEK PP YKPP    PVYKPP  +  PP YKPP   KPP   PP  K P   P V +
Sbjct: 92  PPPVEKPPPEYKPPT---PVYKPPPVEKPPPEYKPPTPVKPP--PPPKHKTPTLPPRVVR 146

Query: 327 PP 332
           PP
Sbjct: 147 PP 148

 Score =  104 bits (259), Expect = 4e-21
 Identities = 74/136 (54%), Positives = 79/136 (58%), Gaps = 26/136 (19%)
 Frame = +3

Query: 3   VYKPP-VEKPP--VYKPP-VEK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPVEKPPVYK 161
           VYKPP VEKPP  VY+PP VEK PP YKPP    PVYK PPVEK PP YKPP    PVYK
Sbjct: 57  VYKPPPVEKPPTPVYRPPPVEKPPPEYKPPT---PVYKPPPVEKPPPEYKPPT---PVYK 110

Query: 162 -PPVEK-PPVYKPPA----EKPPVYKPPVYKPPVYK-PPVEKPPVYKPPVEKPPVYK--- 311
            PPVEK PP YKPP       PP +K P   P V + PP  KPP   P + +PP  K   
Sbjct: 111 PPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPTKEPS 170

Query: 312 ---------PPVEKPP 332
                    PPVE PP
Sbjct: 171 PPQGHYPGHPPVETPP 186

 Score =  103 bits (257), Expect = 6e-21
 Identities = 74/121 (61%), Positives = 79/121 (65%), Gaps = 12/121 (9%)
 Frame = +3

Query: 6   YKPPVEKPPVYK-PPVEKPPV-YKPPVEKPPVYKP-PVEKP--PVYK-PPVEK-PPVYKP 164
           +KPP+   PVYK PP+ KPP  YKPP    PVYKP PVEKP  PVY+ PPVEK PP YKP
Sbjct: 32  HKPPL---PVYKSPPLGKPPPEYKPPT---PVYKPPPVEKPPTPVYRPPPVEKPPPEYKP 85

Query: 165 PVEKPPVYKPP--AEKPPVYKPPVYKPPVYK-PPVEK-PPVYKPPVE-KPPVYKPPVEKP 329
           P    PVYKPP   + PP YKPP    PVYK PPVEK PP YKPP   KPP   PP  K 
Sbjct: 86  PT---PVYKPPPVEKPPPEYKPPT---PVYKPPPVEKPPPEYKPPTPVKPP--PPPKHKT 137

Query: 330 P 332
           P
Sbjct: 138 P 138

 Score =  100 bits (249), Expect = 5e-20
 Identities = 71/118 (60%), Positives = 76/118 (64%), Gaps = 15/118 (12%)
 Frame = +3

Query: 24  KPPVY--KPPV---EKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKP--PVYK-PPVEK 176
           KPP Y  KPP+   + PP+ KP    PP YKPP    PVYK PPVEKP  PVY+ PPVEK
Sbjct: 26  KPPPYEHKPPLPVYKSPPLGKP----PPEYKPPT---PVYKPPPVEKPPTPVYRPPPVEK 78

Query: 177 -PPVYKPPAEKPPVYKPPVYK--PPVYKPPVEKPPVYK-PPVEK-PPVYKPPVE-KPP 332
            PP YKPP    PVYKPP  +  PP YKPP    PVYK PPVEK PP YKPP   KPP
Sbjct: 79  PPPEYKPPT---PVYKPPPVEKPPPEYKPPT---PVYKPPPVEKPPPEYKPPTPVKPP 130

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 44/113 (38%), Positives = 51/113 (45%), Gaps = 31/113 (27%)
 Frame = +3

Query: 3   VYKPP-VEKPPV-YKPPVE-KPP--------------VYKPPVEKPPVYKPPVEKPPVYK 131
           VYKPP VEKPP  YKPP   KPP              V  PP  KPP   P + +PP  K
Sbjct: 108 VYKPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPTK 167

Query: 132 ------------PPVEKPPVYKPPVEKPPVYKPPAEKP--PVYKPPVYKPPVY 248
                       PPVE PP    P +KPP    P +KP  P +K     PP++
Sbjct: 168 EPSPPQGHYPGHPPVETPP--STPYKKPPT---PEKKPWAPHHKHFKAPPPIH 215

[97][TOP]
>UniRef100_B9T135 Lipid binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9T135_RICCO
          Length = 246

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/97 (57%), Positives = 63/97 (64%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+ KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  
Sbjct: 53  PPIVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI- 108

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP 302
           PP  KPP+  PPV  PPV KPP+  PPV  PPV   P
Sbjct: 109 PPVVKPPINLPPVI-PPVIKPPINLPPVTVPPVITNP 144

 Score =  105 bits (262), Expect = 2e-21
 Identities = 56/97 (57%), Positives = 63/97 (64%)
 Frame = +3

Query: 27  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEK 206
           PP+ KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PP   
Sbjct: 53  PPIVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI- 108

Query: 207 PPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           PPV KPP+  PPV  PPV KPP+  PPV  PPV   P
Sbjct: 109 PPVVKPPINLPPVI-PPVIKPPINLPPVTVPPVITNP 144

 Score =  105 bits (261), Expect = 2e-21
 Identities = 57/97 (58%), Positives = 63/97 (64%)
 Frame = +3

Query: 42  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYK 221
           PP+ KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP   PPV  
Sbjct: 53  PPIVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI- 108

Query: 222 PPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PPV KPP+  PPV  PPV KPP+  PPV  PPV   P
Sbjct: 109 PPVVKPPINLPPV-IPPVIKPPINLPPVTVPPVITNP 144

 Score =  101 bits (252), Expect = 2e-20
 Identities = 55/95 (57%), Positives = 61/95 (64%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PP
Sbjct: 55  IVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI-PPVVKPPINLPPVI-PP 110

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPP 287
           V KPP   PPV  PPV KPP+  PPV  PPV   P
Sbjct: 111 VVKPPINLPPVI-PPVIKPPINLPPVTVPPVITNP 144

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 35/67 (52%), Positives = 40/67 (59%), Gaps = 3/67 (4%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE---KPP 182
           PPV KPP+  PPV  PPV KPP+  PPV  PPV KPP+  PPV  PPV   P +     P
Sbjct: 95  PPVVKPPINLPPVI-PPVVKPPINLPPVI-PPVIKPPINLPPVTVPPVITNPPKGSGGKP 152

Query: 183 VYKPPAE 203
              PPA+
Sbjct: 153 CPPPPAK 159

[98][TOP]
>UniRef100_B4R4F7 GD16675 n=1 Tax=Drosophila simulans RepID=B4R4F7_DROSI
          Length = 1284

 Score =  105 bits (262), Expect = 2e-21
 Identities = 44/105 (41%), Positives = 62/105 (59%), Gaps = 4/105 (3%)
 Frame = +3

Query: 30   PVYKPPVEKP--PVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
            P+  PP E P  P  +PP + P  P  +PP E PP Y PP  +PP  +PP  +PP  +PP
Sbjct: 1146 PITSPPTEPPTEPPTEPPTQPPTQPPTQPPTE-PPTYGPPTNEPPTVQPPTHQPPTVQPP 1204

Query: 198  AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP ++PP
Sbjct: 1205 TVQPPTNQPPTVQPPTVQPPTHQPPTNEPPTNRPPTDQPPTKRPP 1249

 Score =  104 bits (259), Expect = 4e-21
 Identities = 43/109 (39%), Positives = 64/109 (58%), Gaps = 4/109 (3%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKP--PVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            P+  PP  +PP E P  P  +PP + P  P  +PP   PP  +PP  +PP ++PP  +PP
Sbjct: 1146 PITSPPT-EPPTEPPTEPPTQPPTQPPTQPPTEPPTYGPPTNEPPTVQPPTHQPPTVQPP 1204

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
              +PP  +PP  +PP  +PP ++PP  +PP  +PP ++PP  +PP   P
Sbjct: 1205 TVQPPTNQPPTVQPPTVQPPTHQPPTNEPPTNRPPTDQPPTKRPPSPSP 1253

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 40/101 (39%), Positives = 60/101 (59%), Gaps = 4/101 (3%)
 Frame = +3

Query: 9    KPPVEKP--PVYKPPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
            +PP E P  P  +PP + P  P  +PP   PP  +PP  +PP ++PP  +PP  +PP  +
Sbjct: 1153 EPPTEPPTEPPTQPPTQPPTQPPTEPPTYGPPTNEPPTVQPPTHQPPTVQPPTVQPPTNQ 1212

Query: 177  PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP 299
            PP  +PP  +PP ++PP  +PP  +PP ++PP  +PP   P
Sbjct: 1213 PPTVQPPTVQPPTHQPPTNEPPTNRPPTDQPPTKRPPSPSP 1253

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 30/73 (41%), Positives = 44/73 (60%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
            Y PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP  +PP 
Sbjct: 1181 YGPPTNEPPTVQPPTHQPPTVQPPTVQPPTNQPPTVQPPTVQPPTHQPPTNEPPTNRPPT 1240

Query: 186  YKPPAEKPPVYKP 224
             +PP ++PP   P
Sbjct: 1241 DQPPTKRPPSPSP 1253

[99][TOP]
>UniRef100_C9ZT09 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei
           gambiense DAL972 RepID=C9ZT09_TRYBG
          Length = 507

 Score =  105 bits (261), Expect = 2e-21
 Identities = 66/174 (37%), Positives = 83/174 (47%), Gaps = 65/174 (37%)
 Frame = +3

Query: 3   VYKPPVEKPP--VYKPPVEKPP--VYKPPVEKP--PVYKPPVEKPP-------------- 122
           VY+PP EKP    Y+PP +KP    YKPP +KP    Y+PP +KP               
Sbjct: 238 VYRPPTEKPTSGAYRPPTDKPATGAYKPPTDKPFSGAYRPPADKPSSGAYRPTAAKLGEV 297

Query: 123 ------------------VYKPPVEKPP--VYKPPVEKPP--VYKPPAEKPPV--YKPPV 230
                              Y+PP++KP    YKPPV+KP    YKPP +KP +  YKPP 
Sbjct: 298 MAAATARDETSSEKPAVGAYRPPIDKPSSGAYKPPVDKPSSGAYKPPTDKPSLGAYKPPS 357

Query: 231 YKPP-----------------VYKPPVEKPP--VYKPPVEKPP--VYKPPVEKP 329
            KP                   Y+PP +KPP  VYKPPV+KP    Y+PP +KP
Sbjct: 358 EKPASVPAVPAESSAVKPSTGAYRPPTDKPPTGVYKPPVDKPSTGAYRPPTDKP 411

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 46/116 (39%), Positives = 61/116 (52%), Gaps = 21/116 (18%)
 Frame = +3

Query: 3   VYKPPVEKPP--VYKPPVEKPP---VYKPPVEKPPVYKP----PVEKPP--VYKPPVEK- 146
           VYKPPV+KP    Y+PP +KP     Y PP E+     P     VEKP    YKPP ++ 
Sbjct: 391 VYKPPVDKPSTGAYRPPTDKPSSGGAYVPPSERLATAAPGEQLSVEKPSAGTYKPPTDRV 450

Query: 147 -PPVYKPPVEKPP--VYKPPAEK--PPVYKPPVYKPP--VYKPPVEKP--PVYKPP 287
               YKPP ++P    YKPP +K     Y+PP  +P    Y+PP E+     ++PP
Sbjct: 451 SSGSYKPPTDRPSAGAYKPPTDKLSSGAYRPPTDRPSSGAYRPPAERSFGSTFRPP 506

[100][TOP]
>UniRef100_Q39614 Cuscuta reflexa proline-rich protein n=1 Tax=Cuscuta reflexa
           RepID=Q39614_CUSRE
          Length = 329

 Score =  104 bits (260), Expect = 3e-21
 Identities = 58/114 (50%), Positives = 68/114 (59%), Gaps = 6/114 (5%)
 Frame = +3

Query: 9   KPPVEKPPVY-KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEK- 176
           KPP  KPP + KPP  KPP + PP  KPPVY P V  PPV  PP     PP+  PPV K 
Sbjct: 60  KPPTVKPPHFPKPPTVKPP-HLPP--KPPVYPPHVPNPPVVTPPTVPRLPPIVTPPVVKP 116

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPP 332
           PP+ +PP   PP + PP  +PPVY P +  PPV  PP   + PP+  PPV KPP
Sbjct: 117 PPIVEPPVVIPPPHIPP--QPPVYPPYIPNPPVVTPPTVPKLPPIVTPPVVKPP 168

 Score =  102 bits (253), Expect = 2e-20
 Identities = 59/115 (51%), Positives = 65/115 (56%), Gaps = 7/115 (6%)
 Frame = +3

Query: 9   KPP--VEKPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVE 173
           KPP    KPPVY P V  PPV  PP     PP+  PPV K PP+ +PPV  PP + PP  
Sbjct: 76  KPPHLPPKPPVYPPHVPNPPVVTPPTVPRLPPIVTPPVVKPPPIVEPPVVIPPPHIPP-- 133

Query: 174 KPPVYKPPAEKPPVYKPPVYK--PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +PPVY P    PPV  PP     PP+  PPV KPP   P VE P V  PPV KPP
Sbjct: 134 QPPVYPPYIPNPPVVTPPTVPKLPPIVTPPVVKPP---PIVEPPVVIPPPVVKPP 185

 Score =  101 bits (251), Expect = 3e-20
 Identities = 58/125 (46%), Positives = 69/125 (55%), Gaps = 15/125 (12%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPV--EKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           VY P V  PPV  PP     PP+  PPV KPP + +PPV  PP + PP  +PPVY P + 
Sbjct: 86  VYPPHVPNPPVVTPPTVPRLPPIVTPPVVKPPPIVEPPVVIPPPHIPP--QPPVYPPYIP 143

Query: 174 KPPVYKPPA--EKPPVYKPPVYKPP-------VYKPPVEKPPVY---KPPVEKPPVYKPP 317
            PPV  PP   + PP+  PPV KPP       V  PPV KPP +   +PPV  P +  PP
Sbjct: 144 NPPVVTPPTVPKLPPIVTPPVVKPPPIVEPPVVIPPPVVKPPPHIQPQPPVYPPYIPNPP 203

Query: 318 VEKPP 332
           V  PP
Sbjct: 204 VVTPP 208

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 55/122 (45%), Positives = 65/122 (53%), Gaps = 13/122 (10%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVE---KPPVYKPPVEKPPVYKPPV--EKPPVYKPPVEKPPVYKPP 167
           V  PP+ +PPV  PP     +PPVY P +  PPV  PP   + PP+  PPV KPP   P 
Sbjct: 114 VKPPPIVEPPVVIPPPHIPPQPPVYPPYIPNPPVVTPPTVPKLPPIVTPPVVKPP---PI 170

Query: 168 VEKPPVYKPPAEKPPVY---KPPVYKPPVYKPPVEKPPVYKPPVEK--PPVY---KPPVE 323
           VE P V  PP  KPP +   +PPVY P +  PPV  PP    P  +  PP Y    PP E
Sbjct: 171 VEPPVVIPPPVVKPPPHIQPQPPVYPPYIPNPPVVTPPPIVIPTRQVLPPPYVPSPPPDE 230

Query: 324 KP 329
           KP
Sbjct: 231 KP 232

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 47/95 (49%), Positives = 54/95 (56%), Gaps = 6/95 (6%)
 Frame = +3

Query: 66  YKPPVEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPPVEKPPVYKPPA--EKPPVYKPPV 230
           + P   KPP  KPP   KPP  KPP    KPPVY P V  PPV  PP     PP+  PPV
Sbjct: 54  FPPHFPKPPTVKPPHFPKPPTVKPPHLPPKPPVYPPHVPNPPVVTPPTVPRLPPIVTPPV 113

Query: 231 YK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            K PP+ +PPV  PP + PP  +PPVY P +  PP
Sbjct: 114 VKPPPIVEPPVVIPPPHIPP--QPPVYPPYIPNPP 146

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 42/100 (42%), Positives = 50/100 (50%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  P V+ PP+ +PPV    V  PPV KPP +  P  +PPVY P +  PPV  P    PP
Sbjct: 160 VTPPVVKPPPIVEPPV----VIPPPVVKPPPHIQP--QPPVYPPYIPNPPVVTP----PP 209

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP 302
           +  P  +      PP Y P    PP EKP    PP EK P
Sbjct: 210 IVIPTRQ----VLPPPYVPS--PPPDEKP--CPPPPEKQP 241

[101][TOP]
>UniRef100_B6TWU3 Putative uncharacterized protein n=1 Tax=Zea mays
           RepID=B6TWU3_MAIZE
          Length = 304

 Score =  104 bits (260), Expect = 3e-21
 Identities = 56/110 (50%), Positives = 63/110 (57%), Gaps = 3/110 (2%)
 Frame = +3

Query: 12  PPVEKPP---VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           PPV  PP   V +PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+  PP   PP
Sbjct: 91  PPVVGPPKGPVTRPPVTRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPTT-PP 147

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP   PP+  PP   P V  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 148 VVGPPVTYPPITGPPT-TPXVVGPPVTYPPITGPPATTPPVTGPPVTYPP 196

 Score =  101 bits (252), Expect = 2e-20
 Identities = 54/103 (52%), Positives = 60/103 (58%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           K PV +PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+  PP   PPV  PPV 
Sbjct: 98  KGPVTRPPVTRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVT 154

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
            PP   PP   P V  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 155 YPPITGPPT-TPXVVGPPVTYPPITGPPATTPPVTGPPVTYPP 196

 Score =  100 bits (249), Expect = 5e-20
 Identities = 52/100 (52%), Positives = 59/100 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V +PPV +PPV  PP  K PV +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 101 VTRPPVTRPPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPTT-PPVVGPPVTYPP 157

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP 302
           +  PP   P V  PPV  PP+  PP   PPV  PPV  PP
Sbjct: 158 ITGPPTT-PXVVGPPVTYPPITGPPATTPPVTGPPVTYPP 196

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 55/117 (47%), Positives = 62/117 (52%), Gaps = 10/117 (8%)
 Frame = +3

Query: 12  PPVEKP----PVYKPPVEKPPV----YKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYK 161
           PP  KP    P  KP   KPP     Y  P  +PP     PPV  PP  K PV +PPV +
Sbjct: 51  PPKTKPSHPSPSPKPKNPKPPRGSTGYPAPGHQPPKSPSYPPVVGPP--KGPVTRPPVTR 108

Query: 162 PPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PPV  PP  K P  +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP+  PP
Sbjct: 109 PPVVGPP--KGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPP 162

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/105 (45%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP----VYKPPVEK 176
           K PV +PPV +PPV  PPV  PP+  PP   PPV  PPV  PP+  PP    V  PPV  
Sbjct: 116 KGPVTRPPVTRPPVVGPPVTYPPITGPPT-TPPVVGPPVTYPPITGPPTTPXVVGPPVTY 174

Query: 177 PPVYKPPAEKPPVYKPPVYKPP----VYKPPVEKPPVYKPPVEKP 299
           PP+  PPA  PPV  PPV  PP        P   PP   P    P
Sbjct: 175 PPITGPPATTPPVTGPPVTYPPGGGGGSSTPCPPPPSPTPTPSSP 219

[102][TOP]
>UniRef100_Q9M4I1 Putative proline-rich cell wall protein n=1 Tax=Vitis vinifera
           RepID=Q9M4I1_VITVI
          Length = 217

 Score =  104 bits (259), Expect = 4e-21
 Identities = 73/122 (59%), Positives = 78/122 (63%), Gaps = 12/122 (9%)
 Frame = +3

Query: 3   VYK-PPVEKPPV-YKPPVEKPPVYKP-PVEKP--PVYK-PPVEK-PPVYKPPVEKPPVYK 161
           VYK PP+ KPP  YKPP    PVYKP PVEKP  PVY+ PPVEK PP YKPP    PVYK
Sbjct: 38  VYKSPPLGKPPPEYKPPT---PVYKPPPVEKPPTPVYRPPPVEKPPPEYKPPT---PVYK 91

Query: 162 -PPVEK-PPVYKPPAEKPPVYKPPVYK--PPVYKPPVE-KPPVYKPPVEKPPVYKPPVEK 326
            PPVEK PP YKPP    PVY+PP  +  PP YKPP   KPP   PP  K P   P V +
Sbjct: 92  SPPVEKPPPEYKPPT---PVYRPPPVEKPPPEYKPPTPVKPP--PPPKHKTPTLPPRVVR 146

Query: 327 PP 332
           PP
Sbjct: 147 PP 148

 Score =  102 bits (254), Expect = 1e-20
 Identities = 75/121 (61%), Positives = 80/121 (66%), Gaps = 12/121 (9%)
 Frame = +3

Query: 6   YKPPVEKPPVYK-PPVEKPPV-YKPPVEKPPVYKP-PVEKP--PVYK-PPVEK-PPVYKP 164
           +KPP+   PVYK PP+ KPP  YKPP    PVYKP PVEKP  PVY+ PPVEK PP YKP
Sbjct: 32  HKPPL---PVYKSPPLGKPPPEYKPPT---PVYKPPPVEKPPTPVYRPPPVEKPPPEYKP 85

Query: 165 PVEKPPVYK-PPAEK-PPVYKPPVYKPPVYK-PPVEK-PPVYKPPVE-KPPVYKPPVEKP 329
           P    PVYK PP EK PP YKPP    PVY+ PPVEK PP YKPP   KPP   PP  K 
Sbjct: 86  PT---PVYKSPPVEKPPPEYKPPT---PVYRPPPVEKPPPEYKPPTPVKPP--PPPKHKT 137

Query: 330 P 332
           P
Sbjct: 138 P 138

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 72/118 (61%), Positives = 77/118 (65%), Gaps = 15/118 (12%)
 Frame = +3

Query: 24  KPPVY--KPPV---EKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKP--PVYK-PPVEK 176
           KPP Y  KPP+   + PP+ KP    PP YKPP    PVYK PPVEKP  PVY+ PPVEK
Sbjct: 26  KPPPYEHKPPLPVYKSPPLGKP----PPEYKPPT---PVYKPPPVEKPPTPVYRPPPVEK 78

Query: 177 -PPVYKPPAEKPPVYK-PPVYK-PPVYKPPVEKPPVYK-PPVEK-PPVYKPPVE-KPP 332
            PP YKPP    PVYK PPV K PP YKPP    PVY+ PPVEK PP YKPP   KPP
Sbjct: 79  PPPEYKPPT---PVYKSPPVEKPPPEYKPPT---PVYRPPPVEKPPPEYKPPTPVKPP 130

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 71/136 (52%), Positives = 77/136 (56%), Gaps = 26/136 (19%)
 Frame = +3

Query: 3   VYKPP-VEKPP--VYKPP-VEKPPV-YKPPV---EKPPVYKPPVE-KP--PVYK-PPVEK 146
           VYKPP VEKPP  VY+PP VEKPP  YKPP    + PPV KPP E KP  PVY+ PPVEK
Sbjct: 57  VYKPPPVEKPPTPVYRPPPVEKPPPEYKPPTPVYKSPPVEKPPPEYKPPTPVYRPPPVEK 116

Query: 147 -PPVYKPPVE-KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK--- 311
            PP YKPP   KPP   PP  K P   P V +P    PP  KPP   P + +PP  K   
Sbjct: 117 PPPEYKPPTPVKPP--PPPKHKTPTLPPRVVRP----PPTPKPPTLPPIIVRPPPTKEPS 170

Query: 312 ---------PPVEKPP 332
                    PPVE PP
Sbjct: 171 PPHGHYPGHPPVETPP 186

[103][TOP]
>UniRef100_Q39864 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Glycine max
           RepID=Q39864_SOYBN
          Length = 199

 Score =  104 bits (259), Expect = 4e-21
 Identities = 67/136 (49%), Positives = 69/136 (50%), Gaps = 27/136 (19%)
 Frame = +3

Query: 6   YKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVE 143
           YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PPV 
Sbjct: 35  YKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 94

Query: 144 K----PPVYKPPVEKPPVYKPPAEKPPVYK-----PPVYK----PPVYKPPVEKPPVYKP 284
           K    PP YK P   PP YK P+  PPVYK     PPVYK    PP +K P   PP YK 
Sbjct: 95  KYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKY 154

Query: 285 PVEKPPVYKPPVEKPP 332
           P   PPVYK     PP
Sbjct: 155 PSPPPPVYKYKSPPPP 170

 Score =  103 bits (257), Expect = 6e-21
 Identities = 64/127 (50%), Positives = 65/127 (51%), Gaps = 18/127 (14%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVY 158
           YK P   PPVYK     PP YK P   PP YK P   PPVYK     PPV K    PP Y
Sbjct: 6   YKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPY 64

Query: 159 KPPVEKPPVYKPPAEKPPVYK-----PPVYK----PPVYKPPVEKPPVYKPPVEKPPVYK 311
           K P   PP YK P+  PPVYK     PPVYK    PP YK P   PP YK P   PPVYK
Sbjct: 65  KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYK 124

Query: 312 PPVEKPP 332
                PP
Sbjct: 125 YKSPPPP 131

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 62/126 (49%), Positives = 62/126 (49%), Gaps = 17/126 (13%)
 Frame = +3

Query: 6   YKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 158
           YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PPVY
Sbjct: 74  YKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVY 133

Query: 159 K----PPVEKPPVYKPPAEKPPVYKPPVYK----PPVYKPPVEKPPVYKPPVEKPPVYKP 314
           K    PP  K P   PP  K P   PPVYK    PP YK P   PP YK P   PPVYK 
Sbjct: 134 KYKSPPPPHKYPSPPPPPYKYPSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKY 193

Query: 315 PVEKPP 332
               PP
Sbjct: 194 KSPPPP 199

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 63/129 (48%), Positives = 64/129 (49%), Gaps = 22/129 (17%)
 Frame = +3

Query: 12  PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPP 152
           PPV K    PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP
Sbjct: 13  PPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 72

Query: 153 VYKPPVEKPPVYKPPAEKPPVYK----PPVYKP-----PVYKPPVEKPPVYKPPVEKPPV 305
            YK P   PPVYK  +  PPVYK    PP YK      P YK P   PPVYK     PPV
Sbjct: 73  PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPV 132

Query: 306 YKPPVEKPP 332
           YK     PP
Sbjct: 133 YKYKSPPPP 141

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 62/128 (48%), Positives = 64/128 (50%), Gaps = 21/128 (16%)
 Frame = +3

Query: 12  PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPP 152
           PPV K    PP YK P   PP YK P   PPVYK     PPV K    PP YK P   PP
Sbjct: 52  PPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPP 111

Query: 153 VYKPPVEKPPVYKPPAEKPPVYK----PPVYKPPVYKPPVEKPPVYKPPVEK----PPVY 308
            YK P   PPVYK  +  PPVYK    PP +K P   PP  K P   PPV K    PP Y
Sbjct: 112 PYKYPSPPPPVYKYKSPPPPVYKYKSPPPPHKYPSPPPPPYKYPSPPPPVYKYKSPPPPY 171

Query: 309 KPPVEKPP 332
           K P   PP
Sbjct: 172 KYPSPPPP 179

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 53/106 (50%), Positives = 55/106 (51%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P +KP  YK P   PPVYK     PP YK P   PP YK P   PPVYK     PPVYK 
Sbjct: 1   PPKKP--YKYPSPPPPVYKYK-SPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKY 57

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP YK P   PP YK P   PPVYK     PPVYK     PP
Sbjct: 58  KSPPPP-YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPP 102

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 42/90 (46%), Positives = 44/90 (48%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYK     PPVYK        YK P   PP +K P   PP YK P   PPVYK     PP
Sbjct: 122 VYKYKSPPPPVYK--------YKSP---PPPHKYPSPPPPPYKYPSPPPPVYKYK-SPPP 169

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPP 272
            YK P+  PP YK P   PPVYK     PP
Sbjct: 170 PYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 199

[104][TOP]
>UniRef100_Q6Q4B6 Proline-rich protein n=1 Tax=Gossypium barbadense
           RepID=Q6Q4B6_GOSBA
          Length = 152

 Score =  103 bits (258), Expect = 5e-21
 Identities = 54/104 (51%), Positives = 64/104 (61%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           E P   KPP    PV+ PP  KPP Y+    KPPVY+PP ++ P  KPPV  PP  + P 
Sbjct: 26  ESPNYGKPPA---PVHNPPKLKPPPYE---HKPPVYEPPKKEKPEPKPPVYVPPKKEKPE 79

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            KPPVYKP   KPPVY+P   KPPVY PP ++ P  KPPV + P
Sbjct: 80  PKPPVYKPS-KKPPVYEPKPPKPPVYAPPKKERPEPKPPVHESP 122

 Score =  102 bits (254), Expect = 1e-20
 Identities = 52/98 (53%), Positives = 64/98 (65%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP    PV+ PP  KPP Y+    KPPVY+PP ++ P  KPPV  PP  + P  KPPVY
Sbjct: 32  KPPA---PVHNPPKLKPPPYE---HKPPVYEPPKKEKPEPKPPVYVPPKKEKPEPKPPVY 85

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP 302
           K P++KPPVY+P   KPPVY PP ++ P  KPPV + P
Sbjct: 86  K-PSKKPPVYEPKPPKPPVYAPPKKERPEPKPPVHESP 122

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 40/79 (50%), Positives = 51/79 (64%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           +KPPV +PP  + P  KPPVY PP ++ P  KPPV KP       +KPPVY+P   KPPV
Sbjct: 50  HKPPVYEPPKKEKPEPKPPVYVPPKKEKPEPKPPVYKPS------KKPPVYEPKPPKPPV 103

Query: 186 YKPPAEKPPVYKPPVYKPP 242
           Y PP ++ P  KPPV++ P
Sbjct: 104 YAPPKKERPEPKPPVHESP 122

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 30/60 (50%), Positives = 37/60 (61%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY PP ++ P  KPPV KP       +KPPVY+P   KPPVY PP ++ P  KPPV + P
Sbjct: 69  VYVPPKKEKPEPKPPVYKPS------KKPPVYEPKPPKPPVYAPPKKERPEPKPPVHESP 122

[105][TOP]
>UniRef100_O81765 Extensin-like protein n=1 Tax=Arabidopsis thaliana
           RepID=O81765_ARATH
          Length = 699

 Score =  103 bits (257), Expect = 6e-21
 Identities = 59/120 (49%), Positives = 69/120 (57%), Gaps = 10/120 (8%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PP
Sbjct: 530 VYSPPPPPPPVHSPP---PPVHSPP--PPPVYSPPPPPPPVHSPP---PPVFSPP---PP 578

Query: 183 VYKPP----AEKPPVYKP----PVYK--PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           VY PP    +  PPV+ P    PV+   PPV+ PP   PPVY PP   PPV+ PP  + P
Sbjct: 579 VYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPP-PPPPVYSPP---PPVFSPPPSQSP 634

 Score =  102 bits (255), Expect = 1e-20
 Identities = 57/118 (48%), Positives = 66/118 (55%), Gaps = 8/118 (6%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP- 179
           VY PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   P 
Sbjct: 555 VYSPPPPPPPVHSPP---PPVFSPP---PPVYSPP---PPVHSPP---PPVHSPPPPAPV 602

Query: 180 -----PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPP 332
                PV+ PP   PPVY PP   PPV+ PP  + P  VY PP   P +  PPV+ PP
Sbjct: 603 HSPPPPVHSPPPP-PPVYSPP---PPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPP 656

 Score =  102 bits (253), Expect = 2e-20
 Identities = 59/114 (51%), Positives = 65/114 (57%), Gaps = 4/114 (3%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP   PPVY PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PP
Sbjct: 523 VNSPP---PPVYSPPPPPPPVHSPP---PPVHSPP--PPPVYSPPPPPPPVHSPP---PP 571

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPP 332
           V+ PP   PPVY PP   PPV+ PP   PPV+ P    PV  PP   PPV  PP
Sbjct: 572 VFSPP---PPVYSPP---PPVHSPP---PPVHSPPPPAPVHSPP---PPVHSPP 613

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 53/100 (53%), Positives = 59/100 (59%)
 Frame = +3

Query: 30  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKP 209
           PV  PP   PPVY PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   P
Sbjct: 522 PVNSPP---PPVYSPPPPPPPVHSPP---PPVHSPP--PPPVYSPPPPPPPVHSPP---P 570

Query: 210 PVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PV+ PP   PPVY PP   PPV+ PP   PPV+ PP   P
Sbjct: 571 PVFSPP---PPVYSPP---PPVHSPP---PPVHSPPPPAP 601

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 59/127 (46%), Positives = 67/127 (52%), Gaps = 17/127 (13%)
 Frame = +3

Query: 3   VYKPPVEKP-PVYKPPVEKP------PVYKPPVEKPPVYK----PPV----EKPPVYKPP 137
           V   PV+KP PV   PV+KP      P    P ++ PV K    PP       PPVY PP
Sbjct: 475 VLATPVDKPSPVPSRPVQKPQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPP 534

Query: 138 VEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK-- 311
              PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPVY   
Sbjct: 535 PPPPPVHSPP---PPVHSPP--PPPVYSPPPPPPPVHSPP---PPVFSPP---PPVYSPP 583

Query: 312 PPVEKPP 332
           PPV  PP
Sbjct: 584 PPVHSPP 590

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 38/97 (39%), Positives = 46/97 (47%), Gaps = 5/97 (5%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           V+ PP   PPVY PP   PPV+ PP  + P  VY PP   P +  PPV+ PP    PVEK
Sbjct: 609 VHSPP-PPPPVYSPP---PPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPP--PAPVEK 662

Query: 177 ---PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVY 278
              PP + P         PP        PP   PP++
Sbjct: 663 KETPPAHAPAPSDDEFIIPPFIGHQYASPP---PPMF 696

[106][TOP]
>UniRef100_B9RPC0 LRX1, putative n=1 Tax=Ricinus communis RepID=B9RPC0_RICCO
          Length = 538

 Score =  103 bits (257), Expect = 6e-21
 Identities = 58/109 (53%), Positives = 58/109 (53%), Gaps = 4/109 (3%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYK----PPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           PV  PPVY PP    PVY PP   PPVY     PP   PPVY PP   PPVY PP   PP
Sbjct: 243 PVPSPPVYLPP----PVYSPP-PPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPP-PPPP 296

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           VY PP   PP   PP   PPVY PP   PP   PP   PPVY PP   P
Sbjct: 297 VYSPP---PPPPSPPPPPPPVYSPP--PPPSPPPPSPPPPVYSPPPPPP 340

 Score =  103 bits (256), Expect = 8e-21
 Identities = 60/115 (52%), Positives = 60/115 (52%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVE-KPPVYKPPVEKPPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPP 167
           V  PPV   PPVY PP   PPVY PP   P    PVY PP   PPVY PP   PPVY PP
Sbjct: 244 VPSPPVYLPPPVYSPP-PPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPP-PPPPVYSPP 301

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PP   PP   PPVY PP   PP   PP   PPVY PP   PP   PP   PP
Sbjct: 302 ---PPPPSPPPPPPPVYSPP--PPPSPPPPSPPPPVYSPP---PPPPSPPPPSPP 348

 Score =  103 bits (256), Expect = 8e-21
 Identities = 58/117 (49%), Positives = 60/117 (51%), Gaps = 7/117 (5%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 170
           VY PP   PPVY PP   P    PVY PP   PPVY PP   PPVY PP   PP   PP 
Sbjct: 255 VYSPP-PPPPVYSPPPPPPSPPPPVYSPPPPPPPVYSPP-PPPPVYSPP---PPPPSPPP 309

Query: 171 EKPPVYK---PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PPVY    PP+  PP   PPVY PP   PP   PP   PP   PP  +PP   PP
Sbjct: 310 PPPPVYSPPPPPSPPPPSPPPPVYSPPP-PPPSPPPPSPPPPSPLPPCVRPPPPPPP 365

 Score =  102 bits (254), Expect = 1e-20
 Identities = 54/107 (50%), Positives = 56/107 (52%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   PPVY PP   PPVY PP   PPVY PP   PP   PP   PPVY PP   PP   
Sbjct: 271 PPSPPPPVYSPPPPPPPVYSPP-PPPPVYSPP---PPPPSPPPPPPPVYSPP--PPPSPP 324

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP+  PPVY PP   PP   PP   PP   PP  +PP   PP   PP
Sbjct: 325 PPSPPPPVYSPPP-PPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPP 370

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 53/113 (46%), Positives = 57/113 (50%), Gaps = 4/113 (3%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY PP   PPVY PP   PPVY PP   PP   PP   PPVY PP   PP   PP   PP
Sbjct: 278 VYSPPPPPPPVYSPP-PPPPVYSPP---PPPPSPPPPPPPVYSPP--PPPSPPPPSPPPP 331

Query: 183 VYKP----PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           VY P    P+  PP   PP   PP  +PP   PP   PP   PP++ PP   P
Sbjct: 332 VYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPP--PPPLFSPPPPTP 382

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 54/107 (50%), Positives = 54/107 (50%), Gaps = 4/107 (3%)
 Frame = +3

Query: 24  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK----PPVEKPPVYK 191
           KP V   P   PP    PV  PPVY PP    PVY PP   PPVY     PP   PPVY 
Sbjct: 226 KPFVPTLPAPPPPSPPMPVPSPPVYLPP----PVYSPP-PPPPVYSPPPPPPSPPPPVYS 280

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PPVY PP   PPVY PP   PP   PP   PPVY PP    P
Sbjct: 281 PPPPPPPVYSPPP-PPPVYSPP---PPPPSPPPPPPPVYSPPPPPSP 323

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 49/112 (43%), Positives = 53/112 (47%), Gaps = 2/112 (1%)
 Frame = +3

Query: 3   VYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           VY PP   P     PP   PPVY PP   PP   PP   PPVY PP   PP   PP   P
Sbjct: 297 VYSPPPPPPS----PPPPPPPVYSPP--PPPSPPPPSPPPPVYSPP---PPPPSPPPPSP 347

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY-KPPVEKPP 332
           P   PP+  PP  +PP   PP   PP   PP++ PP   P  Y  PP   PP
Sbjct: 348 P---PPSPLPPCVRPPPPPPPNSPPP--PPPLFSPPPPTPYYYSSPPPPSPP 394

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/114 (40%), Positives = 54/114 (47%), Gaps = 6/114 (5%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           +PP   PP   PP   PP++ PP   P  Y  P    P + PP   PP + PP   PP  
Sbjct: 358 RPPPPPPPNSPPP--PPPLFSPPPPTPYYYSSPPPPSPPHSPP---PPPHSPPPPSPPHS 412

Query: 189 KPP---AEKPPVY---KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP   +  PP+Y    PP    PVY PP   PPVY PP   PP   PP  +PP
Sbjct: 413 PPPPPHSPPPPIYPYLSPPPPPHPVYSPP--PPPVYSPP---PPPSPPPCIEPP 461

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 44/107 (41%), Positives = 49/107 (45%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   PP   PP   PPVY PP   PP   PP   PP   PP   PP  +PP   PP   
Sbjct: 318 PPPPSPP---PPSPPPPVYSPP---PPPPSPPPPSPP---PPSPLPPCVRPPPPPPPNSP 368

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP   PP++ PP   P  Y  P    P + PP   PP + PP   PP
Sbjct: 369 PP--PPPLFSPPPPTPYYYSSPPPPSPPHSPP---PPPHSPPPPSPP 410

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 44/113 (38%), Positives = 49/113 (43%), Gaps = 6/113 (5%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKP----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           PP   PPVY PP   P    P   PP   PP  +PP   PP   PP   PP++ PP   P
Sbjct: 325 PPSPPPPVYSPPPPPPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPP--PPPLFSPPPPTP 382

Query: 180 PVYK--PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             Y   PP   P    PP + PP   PP   PP   PP   PP   P +  PP
Sbjct: 383 YYYSSPPPPSPPHSPPPPPHSPPPPSPPHSPPP---PPHSPPPPIYPYLSPPP 432

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 46/116 (39%), Positives = 50/116 (43%), Gaps = 9/116 (7%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   PP   P    PP + PP    P   PP    PVY PP   PPVY PP   PP   
Sbjct: 400 PPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPP--PPPVYSPP---PPPSP 454

Query: 192 PPAEKPPVYKP-PVYKPPVYKPPVEKPPVYKPPVE----KPPVY----KPPVEKPP 332
           PP  +PP   P   Y PP   P    P  YKPP       PPV+     PP + PP
Sbjct: 455 PPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSPPPPPVHYYSPPPPSQSPP 510

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 45/110 (40%), Positives = 50/110 (45%), Gaps = 1/110 (0%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           + PP   PP + PP   PP + PP   PP + PP    P   PP    PVY PP   PPV
Sbjct: 395 HSPP---PPPHSPPPPSPP-HSPP---PPPHSPPPPIYPYLSPPPPPHPVYSPP--PPPV 445

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPP 332
           Y PP   PP   PP  +PP   P  E  PP   P    P  YKPP    P
Sbjct: 446 YSPP---PPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPPSPSP 492

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/122 (37%), Positives = 52/122 (42%), Gaps = 12/122 (9%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK---PPVY---KP 164
           ++ PP   P  Y  P    P + PP   PP + PP   PP   PP      PP+Y    P
Sbjct: 374 LFSPPPPTPYYYSSPPPPSPPHSPP---PPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSP 430

Query: 165 PVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPP------VYKPPVEKPPVYKPPVEK 326
           P    PVY PP   PPVY PP   PP   PP  +PP       Y PP   P    P   K
Sbjct: 431 PPPPHPVYSPP--PPPVYSPP---PPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQYK 485

Query: 327 PP 332
           PP
Sbjct: 486 PP 487

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 45/123 (36%), Positives = 50/123 (40%), Gaps = 16/123 (13%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   PP   PP   PP  +PP   PP   PP   PP++ PP   P  Y  P    P + 
Sbjct: 339 PPSPPPPSPPPPSPLPPCVRPPPPPPPNSPPP--PPPLFSPPPPTPYYYSSPPPPSPPHS 396

Query: 192 PPAEKPPVYKPPVYKPPVYKPPV--EKP--------------PVYKPPVEKPPVYKPPVE 323
           PP   PP + PP   PP   PP     P              PVY PP   PPVY PP  
Sbjct: 397 PP---PPPHSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPP--PPPVYSPPPP 451

Query: 324 KPP 332
             P
Sbjct: 452 PSP 454

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 44/112 (39%), Positives = 50/112 (44%), Gaps = 6/112 (5%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--EKP-PV 185
           P   PP++ PP   P  Y  P    P + PP   PP + PP   PP   PP     P P+
Sbjct: 368 PPPPPPLFSPPPPTPYYYSSPPPPSPPHSPP---PPPHSPPPPSPPHSPPPPPHSPPPPI 424

Query: 186 Y---KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y    PP    PVY PP   PPVY PP   PP   PP  +PP   P  E  P
Sbjct: 425 YPYLSPPPPPHPVYSPP--PPPVYSPP---PPPSPPPCIEPPPPPPCAEYSP 471

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 49/122 (40%), Positives = 52/122 (42%), Gaps = 14/122 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEK---PPVY---KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 167
           + PP   PP   PP      PP+Y    PP    PVY PP   PPVY PP   PP   PP
Sbjct: 402 HSPPPPSPPHSPPPPPHSPPPPIYPYLSPPPPPHPVYSPP--PPPVYSPP---PPPSPPP 456

Query: 168 VEKPP------VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVE 323
             +PP       Y PP   P    P  YKPP   P    PPV  Y PP   PP   PP  
Sbjct: 457 CIEPPPPPPCAEYSPPPPSPSPPPPTQYKPPP-SPSPPPPPVHYYSPP---PPSQSPPPP 512

Query: 324 KP 329
            P
Sbjct: 513 AP 514

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 48/110 (43%), Positives = 52/110 (47%), Gaps = 3/110 (2%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVY 188
           PP    PVY PP   PPVY PP   PP   PP  +PP   P  E  PP   P    P  Y
Sbjct: 430 PPPPPHPVYSPP--PPPVYSPP---PPPSPPPCIEPPPPPPCAEYSPPPPSPSPPPPTQY 484

Query: 189 KPPAEKPPVYKPPV--YKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           KPP    P   PPV  Y PP   PP + PP   PP    PVY+ P+  PP
Sbjct: 485 KPPPSPSPP-PPPVHYYSPP---PPSQSPP---PPA---PVYEGPL--PP 522

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 48/115 (41%), Positives = 52/115 (45%), Gaps = 5/115 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPV--EKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           VY PP   PPVY PP     PP  +PP   P   Y PP   PP   PP   P  YKPP  
Sbjct: 437 VYSPP--PPPVYSPPPPPSPPPCIEPPPPPPCAEYSPP---PPSPSPP--PPTQYKPPPS 489

Query: 174 KPPVYKPPAEKPPV--YKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             P   PP   PPV  Y PP   PP   PP    PVY+ P+  PP+       PP
Sbjct: 490 PSP---PP---PPVHYYSPP---PPSQSPP-PPAPVYEGPL--PPITGVSYASPP 532

[107][TOP]
>UniRef100_C0S6D3 Putative uncharacterized protein n=1 Tax=Paracoccidioides
           brasiliensis Pb03 RepID=C0S6D3_PARBP
          Length = 1089

 Score =  103 bits (257), Expect = 6e-21
 Identities = 48/105 (45%), Positives = 48/105 (45%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P E  P   PP E PP   PP E PP   PP E PP   P  E P    PP E PP   P
Sbjct: 601 PAEYSPAEDPPTEDPPAEDPPAEGPPAEGPPAEGPPAEDPLAEGPTAEDPPAEDPPAEDP 660

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PAE PP   PP   P    PP E PP   PP E P    PP E P
Sbjct: 661 PAEDPPAEDPPAEDPAAENPPAEGPPAEDPPAEGPTAKDPPAEDP 705

 Score =  101 bits (251), Expect = 3e-20
 Identities = 47/106 (44%), Positives = 48/106 (45%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P E PP   PP E PP   PP E PP   PP E P    P  E PP   PP E PP   P
Sbjct: 606 PAEDPPTEDPPAEDPPAEGPPAEGPPAEGPPAEDPLAEGPTAEDPPAEDPPAEDPPAEDP 665

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PAE PP   P    PP   PP E PP   P  + PP   P  E  P
Sbjct: 666 PAEDPPAEDPAAENPPAEGPPAEDPPAEGPTAKDPPAEDPTAEDLP 711

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 52/122 (42%), Positives = 53/122 (43%), Gaps = 15/122 (12%)
 Frame = +3

Query: 12  PPVEKPPV-----------YKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 146
           PPVE  PV           Y P    P E PP   PP E PP   PP E PP   PP E 
Sbjct: 580 PPVEDNPVGASPVEDLSDEYLPAEYSPAEDPPTEDPPAEDPPAEGPPAEGPPAEGPPAED 639

Query: 147 PPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           P    P  E PP   PPAE PP   PP   PP   P  E PP   PP E PP   P  + 
Sbjct: 640 PLAEGPTAEDPPAEDPPAEDPPAEDPPAEDPPAEDPAAENPPAEGPPAEDPPAEGPTAKD 699

Query: 327 PP 332
           PP
Sbjct: 700 PP 701

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 48/108 (44%), Positives = 48/108 (44%), Gaps = 1/108 (0%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP E PP   PP E PP   PP E PP   P  E P    PP E PP   PP E PP   
Sbjct: 610 PPTEDPPAEDPPAEGPPAEGPPAEGPPAEDPLAEGPTAEDPPAEDPPAEDPPAEDPPAED 669

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKPP 332
           PPAE P    PP   PP   PP E P    PP E P     P  E  P
Sbjct: 670 PPAEDPAAENPPAEGPPAEDPPAEGPTAKDPPAEDPTAEDLPATESSP 717

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 44/106 (41%), Positives = 46/106 (43%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+        + PPV   PV   PV     E  P    P E PP   PP E PP   P
Sbjct: 566 PVEETTTGDSQADDPPVEDNPVGASPVEDLSDEYLPAEYSPAEDPPTEDPPAEDPPAEGP 625

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PAE PP   PP   P    P  E PP   PP E PP   PP E PP
Sbjct: 626 PAEGPPAEGPPAEDPLAEGPTAEDPPAEDPPAEDPPAEDPPAEDPP 671

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 52/169 (30%), Positives = 54/169 (31%), Gaps = 61/169 (36%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVY---------------------------------------- 68
            +PP E  P  +PP E    Y                                        
Sbjct: 513  EPPSEVTPEEEPPTEIQQTYDDSPADSASYEVAVEELIQEELAVEESLAEDAFPVEETTT 572

Query: 69   ------KPPVEKPPV-----------YKP----PVEKPPVYKPPVEKPPVYKPPVEKPPV 185
                   PPVE  PV           Y P    P E PP   PP E PP   PP E PP 
Sbjct: 573  GDSQADDPPVEDNPVGASPVEDLSDEYLPAEYSPAEDPPTEDPPAEDPPAEGPPAEGPPA 632

Query: 186  YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PPAE P    P    PP   PP E PP   PP E PP   P  E PP
Sbjct: 633  EGPPAEDPLAEGPTAEDPPAEDPPAEDPPAEDPPAEDPPAEDPAAENPP 681

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 27/66 (40%), Positives = 28/66 (42%), Gaps = 1/66 (1%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKPPVY 188
           PP E PP   PP E P    PP E PP   PP E P    PP E P     P  E  P  
Sbjct: 660 PPAEDPPAEDPPAEDPAAENPPAEGPPAEDPPAEGPTAKDPPAEDPTAEDLPATESSPTE 719

Query: 189 KPPAEK 206
              AE+
Sbjct: 720 DHSAEE 725

[108][TOP]
>UniRef100_Q8H9E0 Hydroxyproline-rich glycoprotein (Fragment) n=1 Tax=Solanum
           tuberosum RepID=Q8H9E0_SOLTU
          Length = 217

 Score =  103 bits (256), Expect = 8e-21
 Identities = 71/146 (48%), Positives = 72/146 (49%), Gaps = 37/146 (25%)
 Frame = +3

Query: 6   YKPPVEKPPVYK-----PPVEK-----PPVYK-----PPVEK-----PPVYKPPVEKPPV 125
           YK P   PPVYK     PPV K     PPVYK     PPV K     PPVYK     PPV
Sbjct: 58  YKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPV 117

Query: 126 YKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYK-----PPVYK-------PPVYKPPVEKP 269
           YK     PPVYK     PPVYK  +  PPVYK     PPVYK       PPVYK     P
Sbjct: 118 YKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPP 177

Query: 270 PVYKPPVEKPPVYK-----PPVEKPP 332
           PVYK     PPVYK     PPV K P
Sbjct: 178 PVYKYKSPPPPVYKYKSPPPPVHKSP 203

 Score =  102 bits (254), Expect = 1e-20
 Identities = 61/121 (50%), Positives = 62/121 (51%), Gaps = 12/121 (9%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           YK P   PPVYK     PPVYK   P   PPVYK     PPVYK     PPVYK     P
Sbjct: 36  YKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP 95

Query: 180 PVYKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PVYK  +  PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     P
Sbjct: 96  PVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPP 155

Query: 330 P 332
           P
Sbjct: 156 P 156

 Score =  101 bits (251), Expect = 3e-20
 Identities = 62/123 (50%), Positives = 63/123 (51%), Gaps = 14/123 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVE 173
           YK P   PPVYK     PPVYK   P   PPVYK     PPV  YK P   PPVYK    
Sbjct: 14  YKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSP 73

Query: 174 KPPVYKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
            PPVYK  +  PPVYK     PPVYK     PPVYK     PPVYK     PPVYK    
Sbjct: 74  PPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSP 133

Query: 324 KPP 332
            PP
Sbjct: 134 PPP 136

 Score =  100 bits (248), Expect = 7e-20
 Identities = 61/122 (50%), Positives = 62/122 (50%), Gaps = 12/122 (9%)
 Frame = +3

Query: 3   VYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           VYK     PPVYK   P   PPVYK     PPVYK     PPVYK     PPVYK     
Sbjct: 45  VYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 104

Query: 177 PPVYKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           PPVYK  +  PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     
Sbjct: 105 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPP 164

Query: 327 PP 332
           PP
Sbjct: 165 PP 166

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 63/126 (50%), Positives = 64/126 (50%), Gaps = 16/126 (12%)
 Frame = +3

Query: 3   VYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPV--YKP 164
           VYK     PPVYK   P   PPVYK     PPV  YK P   PPVYK     PPV  YK 
Sbjct: 1   VYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKYKSPPPPVYKYKS 60

Query: 165 PVEKPPVYKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKP 314
           P   PPVYK  +  PPVYK     PPVYK     PPVYK     PPVYK     PPVYK 
Sbjct: 61  PPPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKY 120

Query: 315 PVEKPP 332
               PP
Sbjct: 121 KSPPPP 126

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 55/110 (50%), Positives = 57/110 (51%), Gaps = 5/110 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK     PP
Sbjct: 97  VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 156

Query: 183 VYKPPAEKPPVYKPPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           VYK  +  PP   PPVYK     PPVYK     PPVYK     PPV+K P
Sbjct: 157 VYKYKSPPPP---PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSP 203

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 52/107 (48%), Positives = 54/107 (50%), Gaps = 2/107 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEK 176
           VYK     PPVYK     PPVYK     PPVYK     PPVYK     PPVYK   P   
Sbjct: 107 VYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPP 166

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           PPVYK  +  PPVYK     PPVYK     PPV+K P   P  Y  P
Sbjct: 167 PPVYKYKSPPPPVYKYKSPPPPVYKYKSPPPPVHKSPA--PYYYTSP 211

[109][TOP]
>UniRef100_B9GHP4 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GHP4_POPTR
          Length = 223

 Score =  103 bits (256), Expect = 8e-21
 Identities = 58/115 (50%), Positives = 60/115 (52%), Gaps = 8/115 (6%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKP--PVYKPPVEKPPVYKPPVEKP-----PVYKPPVEKPPVYKPPV 170
           PP  K P   PPV  P  P+YKPP   PPV  PP   P     PV  P    PPVYKPP 
Sbjct: 23  PPEVKSPTPAPPVVTPSTPLYKPPTPAPPVKTPPPAPPVNPPTPVKPPTTPAPPVYKPPS 82

Query: 171 EKPPVYKPPAEKPPVY-KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PPV  P   KPP    PPVYKPP   PPV  PP   PPV+ P    PPV KPP
Sbjct: 83  PAPPVNPPTPVKPPTTPAPPVYKPPSPAPPV-NPPTPVPPVKPPTAPAPPVYKPP 136

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/110 (52%), Positives = 60/110 (54%), Gaps = 4/110 (3%)
 Frame = +3

Query: 12  PPVEKP--PVYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPP 182
           PPV  P  P+YKPP   PPV  PP   PPV  P PV+ P    PPV KPP   PPV  P 
Sbjct: 33  PPVVTPSTPLYKPPTPAPPVKTPP-PAPPVNPPTPVKPPTTPAPPVYKPPSPAPPVNPPT 91

Query: 183 VYKPPAEK-PPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
             KPP    PPVYKPP   PPV  PP   PPV  P    PPVYKPP   P
Sbjct: 92  PVKPPTTPAPPVYKPPSPAPPV-NPPTPVPPVKPPTAPAPPVYKPPSPAP 140

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/114 (50%), Positives = 61/114 (53%), Gaps = 5/114 (4%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK- 176
           +YKPP   PPV  PP   PPV  P PV+ P    PPV KPP   PPV  P   KPP    
Sbjct: 42  LYKPPTPAPPVKTPP-PAPPVNPPTPVKPPTTPAPPVYKPPSPAPPVNPPTPVKPPTTPA 100

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP---PVYKPPVEKP 329
           PPVYKPP+  PPV  PP   PPV  P    PPVYKPP   P   P  KPP   P
Sbjct: 101 PPVYKPPSPAPPV-NPPTPVPPVKPPTAPAPPVYKPPSPAPTPVPPVKPPTTGP 153

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 42/86 (48%), Positives = 43/86 (50%), Gaps = 10/86 (11%)
 Frame = +3

Query: 3   VYKPPVEKPPV-----YKPPVEK-PPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPP 152
           VYKPP   PPV      KPP    PPVYKPP   PPV  P    PV+ P    PPV KPP
Sbjct: 77  VYKPPSPAPPVNPPTPVKPPTTPAPPVYKPPSPAPPVNPPTPVPPVKPPTAPAPPVYKPP 136

Query: 153 VYKPPVEKPPVYKPPAEKPPVYKPPV 230
               P   PPV KPP   P    PPV
Sbjct: 137 -SPAPTPVPPV-KPPTTGP--MPPPV 158

[110][TOP]
>UniRef100_Q5G5C1 Parcxpwnx04 n=1 Tax=Periplaneta americana RepID=Q5G5C1_PERAM
          Length = 238

 Score =  103 bits (256), Expect = 8e-21
 Identities = 49/89 (55%), Positives = 64/89 (71%), Gaps = 3/89 (3%)
 Frame = +3

Query: 48  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPP--AEKPPVY 218
           V +PPV  P     P Y P  + PPVY+PP+ +PPVY+PPV  P P+ + P   + PPVY
Sbjct: 56  VVQPPVILPQPTCQPPYCP--QPPPVYQPPIYQPPVYQPPVYLPQPICQQPYCPQPPPVY 113

Query: 219 KPPVYKPPVYKPPVEKPPVYKPPVEKPPV 305
           +PPVY+PPVY+PPV +PPVY+PPV +PPV
Sbjct: 114 QPPVYQPPVYQPPVYQPPVYQPPVYQPPV 142

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 50/112 (44%), Positives = 70/112 (62%), Gaps = 6/112 (5%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPV--EKPPVYKPPVEKPPV 185
           P ++ P+       P     P+ +  V +PPV  P P  +PP   + PPVY+PP+ +PPV
Sbjct: 32  PYQQCPIRYQQACGPQCINRPISQ--VVQPPVILPQPTCQPPYCPQPPPVYQPPIYQPPV 89

Query: 186 YKPPAEKP-PVYKPPV--YKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y+PP   P P+ + P     PPVY+PPV +PPVY+PPV +PPVY+PPV +PP
Sbjct: 90  YQPPVYLPQPICQQPYCPQPPPVYQPPVYQPPVYQPPVYQPPVYQPPVYQPP 141

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 41/89 (46%), Positives = 52/89 (58%), Gaps = 13/89 (14%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVY-------------KPPVEKPPVYKPPVEKPPVYKPPVEKPP 152
           PPV +PP+Y+PPV +PPVY              PPV +PPVY+PPV +PPVY+PPV +PP
Sbjct: 77  PPVYQPPIYQPPVYQPPVYLPQPICQQPYCPQPPPVYQPPVYQPPVYQPPVYQPPVYQPP 136

Query: 153 VYKPPVEKPPVYKPPAEKPPVYKPPVYKP 239
           VY+PPV    +  P    P       Y P
Sbjct: 137 VYQPPVSGCYINYPSPCPPQCLGACTYVP 165

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 39/87 (44%), Positives = 51/87 (58%), Gaps = 13/87 (14%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPV-------------EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 143
           VY+PP+ +PPVY+PPV             + PPVY+PPV +PPVY+PPV +PPVY+PPV 
Sbjct: 79  VYQPPIYQPPVYQPPVYLPQPICQQPYCPQPPPVYQPPVYQPPVYQPPVYQPPVYQPPVY 138

Query: 144 KPPVYKPPVEKPPVYKPPAEKPPVYKP 224
           +PPV    +  P    P       Y P
Sbjct: 139 QPPVSGCYINYPSPCPPQCLGACTYVP 165

[111][TOP]
>UniRef100_P11728 Early nodulin-75 (Fragment) n=1 Tax=Medicago sativa
           RepID=NO75_MEDSA
          Length = 97

 Score =  103 bits (256), Expect = 8e-21
 Identities = 55/101 (54%), Positives = 65/101 (64%), Gaps = 4/101 (3%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP- 182
           +P V  PP ++PP+E PP  Y+PP EKPP   P    PP Y+PP +KPP  K P E PP 
Sbjct: 1   RPHVHPPPEHQPPLEHPPPEYQPPHEKPPHVHP----PPEYQPPYQKPPHEKSPYEPPPQ 56

Query: 183 VYKPPAEKPPVYKPP-VYKPPVYKPPVE-KPPVYKPPVEKP 299
            Y+PP EKPP  KPP  Y+PP  KPP E  PP Y+PP EKP
Sbjct: 57  EYQPPHEKPPQVKPPSEYQPPHEKPPHEHPPPEYQPPHEKP 97

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 54/101 (53%), Positives = 64/101 (63%), Gaps = 4/101 (3%)
 Frame = +3

Query: 39  KPPVEKPPVYKPPVEKPPV-YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPP- 212
           +P V  PP ++PP+E PP  Y+PP EKPP   P    PP Y+PP +KPP  K P E PP 
Sbjct: 1   RPHVHPPPEHQPPLEHPPPEYQPPHEKPPHVHP----PPEYQPPYQKPPHEKSPYEPPPQ 56

Query: 213 VYKPPVYKPPVYKPPVE-KPPVYKPPVE-KPPVYKPPVEKP 329
            Y+PP  KPP  KPP E +PP  KPP E  PP Y+PP EKP
Sbjct: 57  EYQPPHEKPPQVKPPSEYQPPHEKPPHEHPPPEYQPPHEKP 97

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 48/90 (53%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPPVYKPPVEKP 179
           + PP  +PP  KPP V  PP Y+PP +KPP  K P E PP  Y+PP EKPP  KPP E  
Sbjct: 16  HPPPEYQPPHEKPPHVHPPPEYQPPYQKPPHEKSPYEPPPQEYQPPHEKPPQVKPPSE-- 73

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKP 269
             Y+PP EKPP   P    PP Y+PP EKP
Sbjct: 74  --YQPPHEKPPHEHP----PPEYQPPHEKP 97

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 46/87 (52%), Positives = 56/87 (64%), Gaps = 9/87 (10%)
 Frame = +3

Query: 99  KPPVEKPPVYKPPVEKPPV-YKPPVEKPP-VYKPPAEKPPVYKPP----VYKPP--VYKP 254
           +P V  PP ++PP+E PP  Y+PP EKPP V+ PP  +PP  KPP     Y+PP   Y+P
Sbjct: 1   RPHVHPPPEHQPPLEHPPPEYQPPHEKPPHVHPPPEYQPPYQKPPHEKSPYEPPPQEYQP 60

Query: 255 PVEKPPVYKPPVE-KPPVYKPPVEKPP 332
           P EKPP  KPP E +PP  KPP E PP
Sbjct: 61  PHEKPPQVKPPSEYQPPHEKPPHEHPP 87

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 40/71 (56%), Positives = 46/71 (64%), Gaps = 2/71 (2%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVE-K 176
           V+ PP  +PP  KPP EK P Y+PP   P  Y+PP EKPP  KPP E +PP  KPP E  
Sbjct: 31  VHPPPEYQPPYQKPPHEKSP-YEPP---PQEYQPPHEKPPQVKPPSEYQPPHEKPPHEHP 86

Query: 177 PPVYKPPAEKP 209
           PP Y+PP EKP
Sbjct: 87  PPEYQPPHEKP 97

[112][TOP]
>UniRef100_A5KBW4 Helicase, putative n=1 Tax=Plasmodium vivax RepID=A5KBW4_PLAVI
          Length = 1618

 Score =  102 bits (255), Expect = 1e-20
 Identities = 38/95 (40%), Positives = 63/95 (66%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            P ++PP  +PP ++PP  +PP ++PP  +PP ++PP  +PP ++PP  +PP ++PP  +P
Sbjct: 1307 PCDEPPTDEPPPDEPPPDEPPPDEPPTDEPPTDEPPTDEPPTDEPPTDEPPTDEPPTDEP 1366

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP 299
            P ++PP  +PP  +PP  +PP  +P    PP E+P
Sbjct: 1367 PTDEPPTNEPPTNEPPTNEPPTNEPLPDNPPPEEP 1401

 Score =  101 bits (252), Expect = 2e-20
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +3

Query: 45   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKP 224
            P ++PP  +PP ++PP  +PP ++PP  +PP ++PP  +PP ++PP  +PP ++PP  +P
Sbjct: 1307 PCDEPPTDEPPPDEPPPDEPPPDEPPTDEPPTDEPPTDEPPTDEPPTDEPPTDEPPTDEP 1366

Query: 225  PVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            P  +PP  +PP  +PP  +PP  +P    PP E+P
Sbjct: 1367 PTDEPPTNEPPTNEPPTNEPPTNEPLPDNPPPEEP 1401

 Score =  100 bits (248), Expect = 7e-20
 Identities = 37/95 (38%), Positives = 62/95 (65%)
 Frame = +3

Query: 30   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKP 209
            P  +PP ++PP  +PP ++PP  +PP ++PP  +PP ++PP  +PP ++PP  +PP ++P
Sbjct: 1307 PCDEPPTDEPPPDEPPPDEPPPDEPPTDEPPTDEPPTDEPPTDEPPTDEPPTDEPPTDEP 1366

Query: 210  PVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
            P  +PP  +PP  +PP  +PP  +P  + PP  +P
Sbjct: 1367 PTDEPPTNEPPTNEPPTNEPPTNEPLPDNPPPEEP 1401

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 36/92 (39%), Positives = 61/92 (66%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            +PP ++PP  +PP ++PP  +PP ++PP  +PP ++PP  +PP ++PP  +PP ++PP  
Sbjct: 1310 EPPTDEPPPDEPPPDEPPPDEPPTDEPPTDEPPTDEPPTDEPPTDEPPTDEPPTDEPPTD 1369

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKP 284
            +PP  +PP  +PP  +PP  +P  + PP  +P
Sbjct: 1370 EPPTNEPPTNEPPTNEPPTNEPLPDNPPPEEP 1401

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 36/91 (39%), Positives = 59/91 (64%)
 Frame = +3

Query: 60   PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKP 239
            P  +PP ++PP  +PP ++PP  +PP ++PP  +PP ++PP  +PP ++PP  +PP  +P
Sbjct: 1307 PCDEPPTDEPPPDEPPPDEPPPDEPPTDEPPTDEPPTDEPPTDEPPTDEPPTDEPPTDEP 1366

Query: 240  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P  +PP  +PP  +PP  +PP  +P  + PP
Sbjct: 1367 PTDEPPTNEPPTNEPPTNEPPTNEPLPDNPP 1397

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 25/68 (36%), Positives = 41/68 (60%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            +PP ++PP  +PP ++PP  +PP ++PP  +PP  +PP  +PP  +PP  +P  + PP  
Sbjct: 1340 EPPTDEPPTDEPPTDEPPTDEPPTDEPPTDEPPTNEPPTNEPPTNEPPTNEPLPDNPPPE 1399

Query: 189  KPPAEKPP 212
            +P     P
Sbjct: 1400 EPRGGDAP 1407

[113][TOP]
>UniRef100_Q39887 Proline-rich protein n=1 Tax=Glycine max RepID=Q39887_SOYBN
          Length = 185

 Score =  102 bits (254), Expect = 1e-20
 Identities = 67/145 (46%), Positives = 83/145 (57%), Gaps = 35/145 (24%)
 Frame = +1

Query: 1   RFTSPQLRNHQCT-----SPQ*RSHRCTSLQLRSHP-----CTSPQLRSHLFTNLRWRSH 150
           +F SPQL+NHQCT     S Q ++H   SLQ  SHP     C + QL++H FT+L++ +H
Sbjct: 15  QFISPQLKNHQCTNLQFTSLQLKNHLFISLQFISHPFTSLQCINLQLKNHRFTSLQFINH 74

Query: 151 -----QCTSPQLRNP-----QFTSPRRRSPQFTSPRFTSHRCTSPQLRSHQ--------- 273
                QC +PQL+N      QFTS +  S Q  S +FTSH+CTS QLRSHQ         
Sbjct: 75  LFTSLQCINPQLKNHPFISHQFTSHQCTSLQCISHQFTSHQCTSHQLRSHQYTNHPFISH 134

Query: 274 ------CTSPQLRSHLCTSPQLRSH 330
                 CTS QLRSH CTS Q  SH
Sbjct: 135 QFTSHQCTSHQLRSHQCTSLQCTSH 159

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 59/114 (51%), Positives = 68/114 (59%), Gaps = 5/114 (4%)
 Frame = +1

Query: 1   RFTSPQLRNH-----QCTSPQ*RSHRCTSLQLRSHPCTSPQLRSHLFTNLRWRSHQCTSP 165
           RFTS Q  NH     QC +PQ ++H   S Q  SH CTS Q  SH FT     SHQCTS 
Sbjct: 65  RFTSLQFINHLFTSLQCINPQLKNHPFISHQFTSHQCTSLQCISHQFT-----SHQCTSH 119

Query: 166 QLRNPQFTSPRRRSPQFTSPRFTSHRCTSPQLRSHQCTSPQLRSHLCTSPQLRS 327
           QLR+ Q+T+       F S +FTSH+CTS QLRSHQCTS Q  SH  T+ Q  S
Sbjct: 120 QLRSHQYTNH-----PFISHQFTSHQCTSHQLRSHQCTSLQCTSHQYTNHQFIS 168

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 53/125 (42%), Positives = 70/125 (56%), Gaps = 15/125 (12%)
 Frame = +1

Query: 1   RFTSPQLRNHQCTSPQ*RSHRCTSLQLRSHPCTSPQLRSHLFTNLRWRSHQCTSPQLRNP 180
           +FTS    + Q  SPQ ++H+CT+LQ      TS QL++HLF +L++ SH  TS Q  N 
Sbjct: 5   QFTSHLFTHRQFISPQLKNHQCTNLQF-----TSLQLKNHLFISLQFISHPFTSLQCINL 59

Query: 181 QFTSPRRRSPQFTSPRFTSHRCTSPQLRSH---------------QCTSPQLRSHLCTSP 315
           Q  + R  S QF +  FTS +C +PQL++H               QC S Q  SH CTS 
Sbjct: 60  QLKNHRFTSLQFINHLFTSLQCINPQLKNHPFISHQFTSHQCTSLQCISHQFTSHQCTSH 119

Query: 316 QLRSH 330
           QLRSH
Sbjct: 120 QLRSH 124

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 48/101 (47%), Positives = 61/101 (60%), Gaps = 10/101 (9%)
 Frame = +1

Query: 10  SPQLRNHQCTSPQ*RSHRCTSLQ-----LRSHPCTSPQLRSHLFTNL-----RWRSHQCT 159
           +PQL+NH   S Q  SH+CTSLQ       SH CTS QLRSH +TN      ++ SHQCT
Sbjct: 83  NPQLKNHPFISHQFTSHQCTSLQCISHQFTSHQCTSHQLRSHQYTNHPFISHQFTSHQCT 142

Query: 160 SPQLRNPQFTSPRRRSPQFTSPRFTSHRCTSPQLRSHQCTS 282
           S QLR+ Q TS +  S Q+T+ +F S +  +    SHQ TS
Sbjct: 143 SHQLRSHQCTSLQCTSHQYTNHQFISLQLRNLLFTSHQFTS 183

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 56/152 (36%), Positives = 66/152 (43%), Gaps = 55/152 (36%)
 Frame = +1

Query: 40  SPQ*RSHRCTSLQLRSHPCTSPQLRS---------------HLFTNLRWRSH-------- 150
           SPQ  SH  T  Q       SPQL++               HLF +L++ SH        
Sbjct: 3   SPQFTSHLFTHRQF-----ISPQLKNHQCTNLQFTSLQLKNHLFISLQFISHPFTSLQCI 57

Query: 151 ----------------------QCTSPQLRN-----PQFTSPRRRSPQFTSPRFTSHRCT 249
                                 QC +PQL+N      QFTS +  S Q  S +FTSH+CT
Sbjct: 58  NLQLKNHRFTSLQFINHLFTSLQCINPQLKNHPFISHQFTSHQCTSLQCISHQFTSHQCT 117

Query: 250 SPQLRSHQCT-----SPQLRSHLCTSPQLRSH 330
           S QLRSHQ T     S Q  SH CTS QLRSH
Sbjct: 118 SHQLRSHQYTNHPFISHQFTSHQCTSHQLRSH 149

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 42/77 (54%), Positives = 45/77 (58%), Gaps = 5/77 (6%)
 Frame = +1

Query: 7   TSPQLRNHQCT-----SPQ*RSHRCTSLQLRSHPCTSPQLRSHLFTNLRWRSHQCTSPQL 171
           TS QLR+HQ T     S Q  SH+CTS QLRSH CTS Q  SH +TN     HQ  S QL
Sbjct: 117 TSHQLRSHQYTNHPFISHQFTSHQCTSHQLRSHQCTSLQCTSHQYTN-----HQFISLQL 171

Query: 172 RNPQFTSPRRRSPQFTS 222
           RN  FT     S QFTS
Sbjct: 172 RNLLFT-----SHQFTS 183

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 29/53 (54%), Positives = 33/53 (62%)
 Frame = +1

Query: 4   FTSPQLRNHQCTSPQ*RSHRCTSLQLRSHPCTSPQLRSHLFTNLRWRSHQCTS 162
           F S Q  +HQCTS Q RSH+CTSLQ  SH  T+ Q  S    NL + SHQ TS
Sbjct: 131 FISHQFTSHQCTSHQLRSHQCTSLQCTSHQYTNHQFISLQLRNLLFTSHQFTS 183

[114][TOP]
>UniRef100_C5YGB7 Putative uncharacterized protein Sb06g016310 n=1 Tax=Sorghum
           bicolor RepID=C5YGB7_SORBI
          Length = 283

 Score =  102 bits (254), Expect = 1e-20
 Identities = 70/138 (50%), Positives = 71/138 (51%), Gaps = 29/138 (21%)
 Frame = +3

Query: 6   YKP-PVEKPPVYKPP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVY-- 158
           Y P P  K PVY PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPVY  
Sbjct: 94  YTPSPKPKSPVYPPPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPVYTP 149

Query: 159 --KPPVEKPPVYKPPAEKPPVY----KPPVYKPPVY----KPPVEK--PPVY----KPPV 290
             KPPV KPP  KP    PPVY    KPPV KPP +    KPP  K  PPVY    KPP 
Sbjct: 150 SPKPPVTKPPTPKP---TPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTPSPKPPK 206

Query: 291 EKPPVY----KPPVEKPP 332
             PP Y    KPP  KPP
Sbjct: 207 PSPPTYTPTPKPPATKPP 224

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 68/151 (45%), Positives = 68/151 (45%), Gaps = 43/151 (28%)
 Frame = +3

Query: 9   KPPVEKPPVY---KPPVEKPP---VY----KPPVEKPPVYKP------PVEKPPVYKPPV 140
           KPP  KPP Y   KPP  KPP   VY    KPPV KPP  KP      P  KPPV KPP 
Sbjct: 122 KPPATKPPTYPTPKPPATKPPTPPVYTPSPKPPVTKPPTPKPTPPVYTPNPKPPVTKPPT 181

Query: 141 EKPPVYKPPVEK--PPVY----KPPAEKPPVY----KPPVYKPPVYKP-----------P 257
             P   KPP  K  PPVY    KPP   PP Y    KPP  KPP   P           P
Sbjct: 182 HTPSP-KPPTSKPTPPVYTPSPKPPKPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPIP 240

Query: 258 VEKPPVYK------PPVEKPPVYKPPVEKPP 332
              PP YK      PP   PP Y PPV   P
Sbjct: 241 KPTPPTYKPAPKPTPPAPTPPTYTPPVSHTP 271

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 61/137 (44%), Positives = 62/137 (45%), Gaps = 31/137 (22%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKP--PVY----KPPVEKPPVY----KPPVEKP--PVY----KPPVEK 146
           P  KPPV KPP  KP  PVY    KPPV KPP +    KPP  KP  PVY    KPP   
Sbjct: 149 PSPKPPVTKPPTPKPTPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTPSPKPPKPS 208

Query: 147 PPVY----KPPVEKPPVYKP-----------PAEKPPVYKPPVYKPPVYKPPVEKPPVYK 281
           PP Y    KPP  KPP   P           P   PP YKP     P   PP   PP Y 
Sbjct: 209 PPTYTPTPKPPATKPPTSTPTHPKPTPHTPIPKPTPPTYKP----APKPTPPAPTPPTYT 264

Query: 282 PPVEKPPVYKPPVEKPP 332
           PPV   P   PP   PP
Sbjct: 265 PPVSHTPSSPPPPPPPP 281

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 62/135 (45%), Positives = 62/135 (45%), Gaps = 27/135 (20%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY-------KPPVEK---PPVYKP----------PVEKPPV 125
           Y  P  KPP   P  EKPP         KPP E    PP Y P          P   PP 
Sbjct: 34  YPTPTPKPPAKGPKPEKPPTKGHGHKPEKPPKEHKPTPPTYTPSPKPTPPPATPKPTPPT 93

Query: 126 YKP-PVEKPPVYKPP--VEKPPVY----KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKP 284
           Y P P  K PVY PP     PP Y    KPPA KPP Y  P  KPP  KPP   PPVY P
Sbjct: 94  YTPSPKPKSPVYPPPPKASTPPTYTPSPKPPATKPPTYPTP--KPPATKPPT--PPVYTP 149

Query: 285 PVEKPPVYKPPVEKP 329
              KPPV KPP  KP
Sbjct: 150 S-PKPPVTKPPTPKP 163

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/81 (43%), Positives = 36/81 (44%), Gaps = 11/81 (13%)
 Frame = +3

Query: 9   KPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKP------PVEKPPV 155
           KPP   PP Y    KPP  KPP   P   KP  + P P   PP YKP      P   PP 
Sbjct: 203 KPPKPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPIPKPTPPTYKPAPKPTPPAPTPPT 262

Query: 156 YKPPVEKPPVYKPPAEKPPVY 218
           Y PPV   P   PP   PP Y
Sbjct: 263 YTPPVSHTPS-SPPPPPPPPY 282

[115][TOP]
>UniRef100_P24152 Extensin n=1 Tax=Sorghum bicolor RepID=EXTN_SORBI
          Length = 283

 Score =  102 bits (254), Expect = 1e-20
 Identities = 70/138 (50%), Positives = 71/138 (51%), Gaps = 29/138 (21%)
 Frame = +3

Query: 6   YKP-PVEKPPVYKPP--VEKPPVY----KPPVEKPPVYKPPVEKPPVYKPPVEKPPVY-- 158
           Y P P  K PVY PP     PP Y    KPP  KPP Y  P  KPP  KPP   PPVY  
Sbjct: 94  YTPSPKPKSPVYPPPPKASTPPTYTPSPKPPATKPPTY--PTPKPPATKPPT--PPVYTP 149

Query: 159 --KPPVEKPPVYKPPAEKPPVY----KPPVYKPPVY----KPPVEK--PPVY----KPPV 290
             KPPV KPP  KP    PPVY    KPPV KPP +    KPP  K  PPVY    KPP 
Sbjct: 150 SPKPPVTKPPTPKP---TPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTPSPKPPK 206

Query: 291 EKPPVY----KPPVEKPP 332
             PP Y    KPP  KPP
Sbjct: 207 PSPPTYTPTPKPPATKPP 224

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 68/151 (45%), Positives = 68/151 (45%), Gaps = 43/151 (28%)
 Frame = +3

Query: 9   KPPVEKPPVY---KPPVEKPP---VY----KPPVEKPPVYKP------PVEKPPVYKPPV 140
           KPP  KPP Y   KPP  KPP   VY    KPPV KPP  KP      P  KPPV KPP 
Sbjct: 122 KPPATKPPTYPTPKPPATKPPTPPVYTPSPKPPVTKPPTPKPTPPVYTPNPKPPVTKPPT 181

Query: 141 EKPPVYKPPVEK--PPVY----KPPAEKPPVY----KPPVYKPPVYKP-----------P 257
             P   KPP  K  PPVY    KPP   PP Y    KPP  KPP   P           P
Sbjct: 182 HTPSP-KPPTSKPTPPVYTPSPKPPKPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPYP 240

Query: 258 VEKPPVYK------PPVEKPPVYKPPVEKPP 332
              PP YK      PP   PP Y PPV   P
Sbjct: 241 QAHPPTYKPAPKPSPPAPTPPTYTPPVSHTP 271

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 60/128 (46%), Positives = 61/128 (47%), Gaps = 18/128 (14%)
 Frame = +3

Query: 3   VYKPPVEKP--PVY----KPPVEKPPVY----KPPVEKP--PVYKP----PVEKPPVYKP 134
           V KPP  KP  PVY    KPPV KPP +    KPP  KP  PVY P    P   PP Y  
Sbjct: 155 VTKPPTPKPTPPVYTPNPKPPVTKPPTHTPSPKPPTSKPTPPVYTPSPKPPKPSPPTY-T 213

Query: 135 PVEKPPVYKPPVEKPPVYKPPAEKP-PVYKPPVYKP-PVYKPPVEKPPVYKPPVEKPPVY 308
           P  KPP  KPP   P   KP    P P   PP YKP P   PP   PP Y PPV   P  
Sbjct: 214 PTPKPPATKPPTSTPTHPKPTPHTPYPQAHPPTYKPAPKPSPPAPTPPTYTPPVSHTPSS 273

Query: 309 KPPVEKPP 332
            PP   PP
Sbjct: 274 PPPPPPPP 281

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 62/135 (45%), Positives = 62/135 (45%), Gaps = 27/135 (20%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY-------KPPVEK---PPVYKP----------PVEKPPV 125
           Y  P  KPP   P  EKPP         KPP E    PP Y P          P   PP 
Sbjct: 34  YPTPTPKPPAKGPKPEKPPTKGHGHKPEKPPKEHKPTPPTYTPSPKPTPPPATPKPTPPT 93

Query: 126 YKP-PVEKPPVYKPP--VEKPPVY----KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKP 284
           Y P P  K PVY PP     PP Y    KPPA KPP Y  P  KPP  KPP   PPVY P
Sbjct: 94  YTPSPKPKSPVYPPPPKASTPPTYTPSPKPPATKPPTYPTP--KPPATKPPT--PPVYTP 149

Query: 285 PVEKPPVYKPPVEKP 329
              KPPV KPP  KP
Sbjct: 150 S-PKPPVTKPPTPKP 163

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 35/81 (43%), Positives = 36/81 (44%), Gaps = 11/81 (13%)
 Frame = +3

Query: 9   KPPVEKPPVY----KPPVEKPPVYKPPVEKPPVYKP-PVEKPPVYKP------PVEKPPV 155
           KPP   PP Y    KPP  KPP   P   KP  + P P   PP YKP      P   PP 
Sbjct: 203 KPPKPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPYPQAHPPTYKPAPKPSPPAPTPPT 262

Query: 156 YKPPVEKPPVYKPPAEKPPVY 218
           Y PPV   P   PP   PP Y
Sbjct: 263 YTPPVSHTPS-SPPPPPPPPY 282

[116][TOP]
>UniRef100_A3VGH7 Putative uncharacterized protein n=1 Tax=Rhodobacterales bacterium
            HTCC2654 RepID=A3VGH7_9RHOB
          Length = 7434

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/107 (59%), Positives = 64/107 (59%)
 Frame = -2

Query: 331  GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  T
Sbjct: 7191 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7250

Query: 151  GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7251 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7297

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/107 (59%), Positives = 64/107 (59%)
 Frame = -2

Query: 331  GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  T
Sbjct: 7196 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7255

Query: 151  GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7256 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7302

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/107 (59%), Positives = 64/107 (59%)
 Frame = -2

Query: 331  GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  T
Sbjct: 7201 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7260

Query: 151  GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7261 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7307

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/107 (59%), Positives = 64/107 (59%)
 Frame = -2

Query: 331  GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  T
Sbjct: 7206 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7265

Query: 151  GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7266 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7312

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/107 (59%), Positives = 64/107 (59%)
 Frame = -2

Query: 331  GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  T
Sbjct: 7211 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7270

Query: 151  GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7271 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7317

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/107 (59%), Positives = 64/107 (59%)
 Frame = -2

Query: 331  GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  T
Sbjct: 7216 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7275

Query: 151  GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7276 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7322

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/107 (59%), Positives = 64/107 (59%)
 Frame = -2

Query: 331  GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  T
Sbjct: 7221 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7280

Query: 151  GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7281 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7327

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/107 (59%), Positives = 64/107 (59%)
 Frame = -2

Query: 331  GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  T
Sbjct: 7226 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7285

Query: 151  GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7286 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7332

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/107 (59%), Positives = 64/107 (59%)
 Frame = -2

Query: 331  GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  T
Sbjct: 7231 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7290

Query: 151  GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7291 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7337

 Score =  102 bits (253), Expect = 2e-20
 Identities = 64/107 (59%), Positives = 64/107 (59%)
 Frame = -2

Query: 331  GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  T
Sbjct: 7236 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7295

Query: 151  GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7296 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7342

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 63/106 (59%), Positives = 63/106 (59%)
 Frame = -2

Query: 328  GFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYTG 149
            G  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  TG
Sbjct: 7187 GGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTG 7246

Query: 148  GFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
            G  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7247 GGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7292

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 62/105 (59%), Positives = 62/105 (59%)
 Frame = -2

Query: 331  GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  T
Sbjct: 7241 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDT 7300

Query: 151  GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFST 17
            GG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  T
Sbjct: 7301 GGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGRDT 7345

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 59/105 (56%), Positives = 60/105 (57%)
 Frame = -2

Query: 325  FSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYTGG 146
            F+  G    G  TGG  TGG  TGG  TGG  TGG  TGG   GG  TGG  TGG  TGG
Sbjct: 7178 FNVFGPDGDGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7237

Query: 145  FSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
              TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG  TGG
Sbjct: 7238 GDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGGGDTGG 7282

[117][TOP]
>UniRef100_Q57UP2 Putative uncharacterized protein n=1 Tax=Trypanosoma brucei
           RepID=Q57UP2_9TRYP
          Length = 507

 Score =  102 bits (253), Expect = 2e-20
 Identities = 66/173 (38%), Positives = 82/173 (47%), Gaps = 65/173 (37%)
 Frame = +3

Query: 6   YKPPVEKP--PVYKPPVEKPP--VYKPPVEKPP--VYKPPVEKP--PVYKPPVEKPP--- 152
           YKPPV+KP   VY+PP EKP    Y+PP +KP    YKPP +KP    Y+PP +KP    
Sbjct: 227 YKPPVDKPVSGVYRPPTEKPTSGAYRPPTDKPATGAYKPPTDKPFSGAYRPPADKPSSGA 286

Query: 153 -----------------------------VYKPPVEKPP--VYKPPAEKPP--VYKPPVY 233
                                         Y+PP++KP    YKPP +KP    YKPP  
Sbjct: 287 YRPTAAKLGEVMAATTARDETSSEKPAAGAYRPPIDKPSSGAYKPPVDKPSSGAYKPPTD 346

Query: 234 KPPV--YKPPVEKPP-----------------VYKPPVEKPP--VYKPPVEKP 329
           K  +  Y+PP EKP                   Y+PP +KPP  VYKPPV+KP
Sbjct: 347 KSSLGAYEPPSEKPASVPAVPAESSAVKPSTGAYRPPTDKPPTGVYKPPVDKP 399

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 47/116 (40%), Positives = 62/116 (53%), Gaps = 21/116 (18%)
 Frame = +3

Query: 3   VYKPPVEKPP--VYKPPVEKPP---VYKPPVEKPPVYKP----PVEKPP--VYKPPVEK- 146
           VYKPPV+KP    Y+PP +KP     Y PP E+     P     VEKP    YKPP ++ 
Sbjct: 391 VYKPPVDKPSTGAYRPPTDKPSSGGAYVPPSERLATAAPGEQLSVEKPSAGTYKPPTDRV 450

Query: 147 -PPVYKPPVEKPP--VYKPPAEKPP--VYKPPVYKPP--VYKPPVEKP--PVYKPP 287
               YKPP ++P    YKPP +KP    Y+PP  +P    Y+PP E+     ++PP
Sbjct: 451 SSGSYKPPTDRPSAGAYKPPTDKPSSGAYRPPTDRPSSGAYRPPAERSFGSTFRPP 506

[118][TOP]
>UniRef100_Q09083 Hydroxyproline-rich glycoprotein n=1 Tax=Phaseolus vulgaris
           RepID=Q09083_PHAVU
          Length = 580

 Score =  101 bits (252), Expect = 2e-20
 Identities = 65/130 (50%), Positives = 66/130 (50%), Gaps = 23/130 (17%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVY 158
           YK     PPVYK     PPVYK     PPVYK     PPVYK     PPV K    PP Y
Sbjct: 307 YKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPY 366

Query: 159 KPPVEKPPVYKPPAEKPPVYK-----PPVYK----PPVYKPPVEKPPVYKPPVEKPPVYK 311
           K P   PP YK P+  PPVYK     PPVYK    PP YK P   PP YK P   PPVYK
Sbjct: 367 KYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYK 426

Query: 312 -----PPVEK 326
                PPV K
Sbjct: 427 YNSPPPPVYK 436

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 62/127 (48%), Positives = 63/127 (49%), Gaps = 18/127 (14%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVY 158
           YK P   PP YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVY
Sbjct: 366 YKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVY 425

Query: 159 KPPVEKPPVYKPPAEKPPVYK----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYK 311
           K     PPVYK  +  PPVYK    PP YK     PP YK     PPVYK     PPVYK
Sbjct: 426 KYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYK 485

Query: 312 PPVEKPP 332
                PP
Sbjct: 486 YKSPPPP 492

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 63/128 (49%), Positives = 64/128 (50%), Gaps = 18/128 (14%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPV 155
           VYK     PPVYK     PPVYK     PPV K    PP YK P   PP YK P   PPV
Sbjct: 326 VYKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPV 385

Query: 156 YK-----PPVEK----PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
           YK     PPV K    PP YK P+  PP YK P   PPVYK     PPVYK     PPVY
Sbjct: 386 YKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVYKYKSPPPPVY 445

Query: 309 KPPVEKPP 332
           K     PP
Sbjct: 446 KYKSPPPP 453

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 69/151 (45%), Positives = 70/151 (46%), Gaps = 42/151 (27%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVY 158
           YK P   PPVYK     PPVYK     PPV K    PP YK P   PP YK     PPVY
Sbjct: 415 YKYPSPPPPVYKYNSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVY 474

Query: 159 K-----PPVEK----PPVYKPPAEKPPVYK-----PPVYK--------------PPVYKP 254
           K     PPV K    PP YK P+  PP YK     PPVYK              PP YK 
Sbjct: 475 KYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKY 534

Query: 255 PVEKPPVYKPPVEKPPVYK-----PPVEKPP 332
           P   PPVYK     PPVYK     PPV  PP
Sbjct: 535 PSPPPPVYKYKSPPPPVYKYNSPPPPVHSPP 565

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 62/127 (48%), Positives = 63/127 (49%), Gaps = 18/127 (14%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPV 170
           YK P   PP YK     PPVYK     PPVYK     PPVYK     PPVYK     PPV
Sbjct: 297 YKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPVYKYNSPPPPVYKYKSPPPPV 356

Query: 171 EK----PPVYKPPAEKPPVYKPPVYKPPVYK-----PPVEK----PPVYKPPVEKPPVYK 311
            K    PP YK P+  PP YK P   PPVYK     PPV K    PP YK P   PP YK
Sbjct: 357 YKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYK 416

Query: 312 PPVEKPP 332
            P   PP
Sbjct: 417 YPSPPPP 423

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 58/118 (49%), Positives = 59/118 (50%), Gaps = 9/118 (7%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PPVYK     PP YK P   PP YK     PPVYK     PPVYK     PPV
Sbjct: 278 YKYSSPPPPVYKYK-SPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPV 336

Query: 186 YKPPAEKPPVYK-----PPVYK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK  +  PPVYK     PPVYK    PP YK P   PP YK P   PPVYK     PP
Sbjct: 337 YKYNSPPPPVYKYKSPPPPVYKYNSPPPPYKYPSPPPPPYKYPSPPPPVYKYKSPPPP 394

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 66/137 (48%), Positives = 67/137 (48%), Gaps = 28/137 (20%)
 Frame = +3

Query: 6   YKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 158
           YK P   PPVYK     PPV K    PP YK P   PP YK P   PPVYK     PPVY
Sbjct: 376 YKYPSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYPSPPPPVYKYNSPPPPVY 435

Query: 159 K-----PPVEK----PPVYKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYK 281
           K     PPV K    PP YK P+  PP YK     PPVYK     PPVYK     PP YK
Sbjct: 436 KYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYK-SPPPPYK 494

Query: 282 PPVEKPPVYKPPVEKPP 332
            P   PP YK     PP
Sbjct: 495 YPSPPPPPYKYSSPPPP 511

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 59/127 (46%), Positives = 61/127 (48%), Gaps = 18/127 (14%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYK-----PPVEK----PPVYKPPVEKPPVYKPPVEKPPVY 158
           YK P   PP YK     PPVYK     PPV K    PP YK P   PP YK     PPVY
Sbjct: 454 YKYPSPPPPPYKYSSPPPPVYKYKSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVY 513

Query: 159 K-----PPVEK----PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
           K     PPV K    PP YK P+  PPVYK     PPVYK     PPV+ PP   PP Y 
Sbjct: 514 KYKSPPPPVYKYKSPPPPYKYPSPPPPVYKYKSPPPPVYKYNSPPPPVHSPP---PPHYI 570

Query: 312 PPVEKPP 332
                PP
Sbjct: 571 YASPPPP 577

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 52/109 (47%), Positives = 54/109 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           + PP  K P YK     PPVYK     PP YK P   PP YK     PPVYK     PPV
Sbjct: 269 HSPPPPKNP-YKYSSPPPPVYKYK-SPPPPYKYPSPPPPPYKYSSPPPPVYKYKSPPPPV 326

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK  +  PPVYK     PPVYK     PPVYK     PP YK P   PP
Sbjct: 327 YKYKSPPPPVYKYNSPPPPVYKYKSPPPPVYKYN-SPPPPYKYPSPPPP 374

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 52/123 (42%), Positives = 57/123 (46%), Gaps = 14/123 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 221 HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 263

Query: 174 KPPVY---KPPAEKPPVYK---PPVYK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
            PP Y    PP + P  Y    PPVYK    PP YK P   PP YK     PPVYK    
Sbjct: 264 -PPYYYHSPPPPKNPYKYSSPPPPVYKYKSPPPPYKYPSPPPPPYKYSSPPPPVYKYKSP 322

Query: 324 KPP 332
            PP
Sbjct: 323 PPP 325

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 46/117 (39%), Positives = 51/117 (43%), Gaps = 15/117 (12%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEK---PPVYKPPVEKPPVYKPPVEK 176
           PP  KP  Y+ P   PP + PP   PP Y   PP  K   PP Y      PP + PP   
Sbjct: 36  PPPPKPYYYQSP--PPPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKHSPP--- 87

Query: 177 PPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
           PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 88  PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 135

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 33/72 (45%), Positives = 36/72 (50%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYK     PPVYK     PP YK P   PPVYK     PPVYK     PPV+ PP   PP
Sbjct: 512 VYKYKSPPPPVYKYK-SPPPPYKYPSPPPPVYKYKSPPPPVYKYNSPPPPVHSPP---PP 567

Query: 183 VYKPPAEKPPVY 218
            Y   +  PP +
Sbjct: 568 HYIYASPPPPYH 579

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/118 (39%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 77  HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 119

Query: 174 KPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 120 -PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 167

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/118 (39%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 93  HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 135

Query: 174 KPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 136 -PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 183

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/118 (39%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 109 HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 151

Query: 174 KPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 152 -PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 199

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/118 (39%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 125 HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 167

Query: 174 KPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 168 -PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 215

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/118 (39%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 141 HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 183

Query: 174 KPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 184 -PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 231

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/118 (39%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 157 HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 199

Query: 174 KPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 200 -PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 247

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 47/118 (39%), Positives = 53/118 (44%), Gaps = 14/118 (11%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVE 173
           + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP   PP + PP  
Sbjct: 173 HSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP-- 215

Query: 174 KPPVY----KPPAEKPPVYKPPVY----KPPVYKPPVEKPPVY--KPPVEKPPVYKPP 317
            PP Y     PP   PP   PP Y     PP + PP   PP Y   PP   PP + PP
Sbjct: 216 -PPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPP---PPYYYHSPP---PPKHSPP 263

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 51/135 (37%), Positives = 56/135 (41%), Gaps = 28/135 (20%)
 Frame = +3

Query: 12  PPVEKPP----VYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVY--KPP 167
           PP   PP     + PP   PP + PP   PP Y   PP   PP + PP   PP Y   PP
Sbjct: 177 PPKHSPPPPYYYHSPP---PPKHSPP---PPYYYHSPP---PPKHSPP---PPYYYHSPP 224

Query: 168 VEK---PPVYKPPAEKPPVYKPPVYKPPVY--KPPVEK---PPVY---KPPVEK------ 296
             K   PP Y   +  PP + PP   PP Y   PP  K   PP Y    PP  K      
Sbjct: 225 PPKHSPPPPYYYHSPPPPKHSPP---PPYYYHSPPPPKHSPPPPYYYHSPPPPKNPYKYS 281

Query: 297 ---PPVYKPPVEKPP 332
              PPVYK     PP
Sbjct: 282 SPPPPVYKYKSPPPP 296

[119][TOP]
>UniRef100_C0Z2Q6 AT5G14920 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2Q6_ARATH
          Length = 233

 Score =  101 bits (251), Expect = 3e-20
 Identities = 56/114 (49%), Positives = 62/114 (54%), Gaps = 6/114 (5%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKPP       KPP  KPPV  P +   PV KPPV  PP+  PPV+ PP YKPP    P 
Sbjct: 59  YKPPTLPTTPIKPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPVQ-PPTYKPPT---PT 113

Query: 186 YKPPAEKPPVYKPPV--YKPPVYKP--PVEKPPVYKPPVEKP--PVYKPPVEKP 329
            KPP+ +PP YKPP    KPP   P  P   PPV  PPV+ P  P  KPP   P
Sbjct: 114 VKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTAPPVKPPTPPP 167

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 58/116 (50%), Positives = 63/116 (54%), Gaps = 10/116 (8%)
 Frame = +3

Query: 15  PVEKPPV--YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           P  KPP   YKPP       KPP  KPPV  P +   PV KPPV  PP+  PPV+ PP Y
Sbjct: 50  PALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPVQ-PPTY 107

Query: 189 KPPAE--KPPVYKPPVYKP--PVYKPPVEKP--PVYKPPVEKPPVYKP--PVEKPP 332
           KPP    KPP  +PP YKP  P  KPP   P  P   PPV+ PPV  P  P  KPP
Sbjct: 108 KPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTAPPVKPP 163

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/108 (51%), Positives = 61/108 (56%), Gaps = 4/108 (3%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP  KPPV  P +   PV KPPV  PP+  PPV+ PP YKPP    P  KPP  +PP Y
Sbjct: 70  KPPTTKPPVKPPTIPVTPV-KPPVSTPPIKLPPVQ-PPTYKPPT---PTVKPPSVQPPTY 124

Query: 189 KPPAE--KPPVYKP--PVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 320
           KPP    KPP   P  P   PPV  PPV+ P    PPV KPP   PPV
Sbjct: 125 KPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTA--PPV-KPPT-PPPV 168

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/104 (44%), Positives = 50/104 (48%), Gaps = 7/104 (6%)
 Frame = +3

Query: 42  PPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVY 218
           P +  P P  KPP    P  KPP    P YKPP       KPP  KPPV      KPP  
Sbjct: 36  PTLPSPSPATKPP---SPALKPPT---PSYKPPTLPTTPIKPPTTKPPV------KPPTI 83

Query: 219 KPPVYKPPVYKPPVEKPPV----YKPPVE--KPPVYKPPVEKPP 332
                KPPV  PP++ PPV    YKPP    KPP  +PP  KPP
Sbjct: 84  PVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPP 127

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 46/96 (47%), Positives = 50/96 (52%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP++ PPV      +PP YKPP    P  KPP  +PP YKPP    P  KPP   P 
Sbjct: 92  VSTPPIKLPPV------QPPTYKPPT---PTVKPPSVQPPTYKPPT---PTVKPPTTSP- 138

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPV 290
             KPP   PPV  PPV  P    PPV KPP   PPV
Sbjct: 139 -VKPPT-TPPVQSPPVQPPTA--PPV-KPPT-PPPV 168

[120][TOP]
>UniRef100_Q39600 Extensin n=1 Tax=Catharanthus roseus RepID=Q39600_CATRO
          Length = 217

 Score =  100 bits (250), Expect = 4e-20
 Identities = 65/135 (48%), Positives = 71/135 (52%), Gaps = 25/135 (18%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYK-------PPVEKPP--VYKPPVEKPPVYKPPVEKPPV 155
           ++K P   P VYK P   PPVYK       PPV K P  +YK P   PP+YK P   PPV
Sbjct: 63  IHKSPPPPPYVYKSPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSP--PPPV 120

Query: 156 YK--PPVEKPPVYKPPAEKPPVYK---------PPVYKPPVYKPPVEK---PPVYK--PP 287
           YK  PP + P VYK P   PPVYK         P VYK P   P V K   PPVYK  PP
Sbjct: 121 YKSPPPPKNPYVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPPPPVYKSPPP 180

Query: 288 VEKPPVYKPPVEKPP 332
            +KP VYK P   PP
Sbjct: 181 PKKPYVYKSPPPPPP 195

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 54/109 (49%), Positives = 60/109 (55%), Gaps = 9/109 (8%)
 Frame = +3

Query: 12  PPVEKPPV-----YKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPV 170
           PPV  PP      YK P   PP++K P   P VYK P   PPV  YK P   PPV+K P 
Sbjct: 41  PPVHSPPPPPVYKYKSPPPPPPIHKSPPPPPYVYKSPPPPPPVYKYKSPPPPPPVHKYP- 99

Query: 171 EKPPVYKPPAEKPPVYKPPVYKPPVYK--PPVEKPPVYKPPVEKPPVYK 311
             P +YK P   PP+YK P   PPVYK  PP + P VYK P   PPVYK
Sbjct: 100 --PYIYKSPPPPPPIYKSP--PPPVYKSPPPPKNPYVYKSPPPPPPVYK 144

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 63/145 (43%), Positives = 69/145 (47%), Gaps = 35/145 (24%)
 Frame = +3

Query: 3   VYKPPVEKPPVYK-------PPVEKPP--VYKPPVEKPPVYKPPVEKPPVYK--PPVEKP 149
           VYK P   PPVYK       PPV K P  +YK P   PP+YK P   PPVYK  PP + P
Sbjct: 73  VYKSPPPPPPVYKYKSPPPPPPVHKYPPYIYKSPPPPPPIYKSP--PPPVYKSPPPPKNP 130

Query: 150 PVYKPPVEKPPVYK------------------PP----AEKPPVYK--PPVYKPPVYKPP 257
            VYK P   PPVYK                  PP    +  PPVYK  PP  KP VYK P
Sbjct: 131 YVYKSPPPPPPVYKYLHHLHQKKPYVYKSPPPPPFVHKSPPPPVYKSPPPPKKPYVYKSP 190

Query: 258 VEKPPVYKPPVEKPPVYKPPVEKPP 332
              PP++K P   PP Y      PP
Sbjct: 191 PPPPPIHKSP---PPPYHYYYSSPP 212

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 54/115 (46%), Positives = 60/115 (52%), Gaps = 13/115 (11%)
 Frame = +3

Query: 27  PPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--- 191
           PP Y      PPV+ PP   PPVYK   P   PP++K P   P VYK P   PPVYK   
Sbjct: 31  PPPYHYSSPPPPVHSPP--PPPVYKYKSPPPPPPIHKSPPPPPYVYKSPPPPPPVYKYKS 88

Query: 192 ----PPAEK--PPVYKPPVYKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPP 332
               PP  K  P +YK P   PP+YK P   PPVYK  PP + P VYK P   PP
Sbjct: 89  PPPPPPVHKYPPYIYKSPPPPPPIYKSP--PPPVYKSPPPPKNPYVYKSPPPPPP 141

[121][TOP]
>UniRef100_Q27409 Adhesive plaque matrix protein n=1 Tax=Mytilus galloprovincialis
           RepID=FP1_MYTGA
          Length = 751

 Score =  100 bits (250), Expect = 4e-20
 Identities = 53/120 (44%), Positives = 55/120 (45%), Gaps = 10/120 (8%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VYKP +  PP YKP    PP YKP    P  YK     P  YKP    PP YKP +  PP
Sbjct: 108 VYKPKMTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPTYKPKLTYPP 167

Query: 183 VYKPPAEKPPVYKP-PVYK---------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            YKP    PP YKP P Y          PP YK     P  YKP    P  YKP V  PP
Sbjct: 168 TYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTYPSTYKPKVSYPP 227

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 46/102 (45%), Positives = 47/102 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y      PPVYKP +  PP YKP    PP YKP    P  YK     P  YKP    PP 
Sbjct: 99  YNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPSSYKPKKTYPPT 158

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
           YKP    PP YKP    PP YKP    P  YK     PP YK
Sbjct: 159 YKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYK 200

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 51/119 (42%), Positives = 54/119 (45%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YKP +  PP YKP    PP YKP    P  YK     PP YK     P  
Sbjct: 149 YKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSS 208

Query: 186 YKPPAEKPPVYKPPVYKPPVYK-----PPVEK-----PPVYKPPVEKPPVYKPPVEKPP 332
           YKP    P  YKP V  PP YK     PP+ K     P  YKP    P  YKP +  PP
Sbjct: 209 YKPKKTYPSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTYPSTYKPKISYPP 267

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 49/116 (42%), Positives = 52/116 (44%), Gaps = 7/116 (6%)
 Frame = +3

Query: 6   YKPPVEKPPVYKP-------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 164
           Y P  +K   YKP           PPVYKP +  PP YKP    PP YKP    P  YK 
Sbjct: 82  YLPLAKKLSSYKPIKTTYNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYKPKPSYPATYKS 141

Query: 165 PVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
               P  YKP    PP YKP +  PP YKP    PP YKP    P  YK     PP
Sbjct: 142 KSSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPP 197

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 47/113 (41%), Positives = 49/113 (43%), Gaps = 4/113 (3%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPPVYKPPVE 173
           YK     PP YK     PP YK     PP YK     P   P  YK     PP YK    
Sbjct: 619 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKAKPSYPPTYKAKPS 678

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PP YKP    PP YK     P  YKP    PP YKP +  PP+YKP    PP
Sbjct: 679 YPPTYKPKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPIYKPKPSYPP 731

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 49/118 (41%), Positives = 52/118 (44%), Gaps = 10/118 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPVEK-----PPVYKPPVEKPPV 155
           YKP +  PP YKP    PP YKP    P  YK     PP  K     P  YKP    P  
Sbjct: 159 YKPKLTYPPTYKPKPSYPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTYPST 218

Query: 156 YKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP V  PP YK     PP+YK     P  YKP    P  YKP +  PP YK     P
Sbjct: 219 YKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTYPSTYKPKISYPPTYKAKPSYP 276

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 48/119 (40%), Positives = 51/119 (42%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YKP +  PP YK     PP+YK     PP YK      P YK     PP 
Sbjct: 349 YKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPT 408

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     P  YK     PP YK     PP YK  +  PP YK     PP YK     PP
Sbjct: 409 YKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPP 467

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 49/129 (37%), Positives = 52/129 (40%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YK     PP YKP    PP YKP +  PP YK     PP+
Sbjct: 319 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPI 378

Query: 186 YKPPAEKPPVYK---------------PPVYK-----PPVYKPPVEKPPVYKPPVEKPPV 305
           YK     PP YK               PP YK     P  YK     PP YK     PP 
Sbjct: 379 YKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPT 438

Query: 306 YKPPVEKPP 332
           YK  +  PP
Sbjct: 439 YKAKLSYPP 447

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/119 (40%), Positives = 51/119 (42%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YKP    PP YKP +  PP YK     PP+YK     PP YK      P 
Sbjct: 339 YKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPT 398

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YK     P  YK     PP YK     PP YK  +  PP YK     PP
Sbjct: 399 YKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPP 457

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 45/106 (42%), Positives = 48/106 (45%), Gaps = 4/106 (3%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           YK     PP YK     PP YK     P   P  YK     PP YK     PP YKP   
Sbjct: 629 YKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKAKPSYPPTYKAKPSYPPTYKPKPS 688

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
            PP YK  +  P  YKP    PP YKP +  PP+YKP    PP YK
Sbjct: 689 YPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYPPIYKPKPSYPPTYK 734

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 47/119 (39%), Positives = 50/119 (42%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YK     P  Y+     P  YK     PP YK     PP YK     P  
Sbjct: 259 YKPKISYPPTYKAKPSYPTSYRAKPSYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYPST 318

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YK     PP YK     PP YKP    PP YKP +  PP YK     PP
Sbjct: 319 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPP 377

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 43/102 (42%), Positives = 45/102 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YK     P  YK     PP YK     PP YK     PP 
Sbjct: 289 YKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPS 348

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
           YKP    PP YKP +  PP YK     PP+YK     PP YK
Sbjct: 349 YKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSYPPTYK 390

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 43/109 (39%), Positives = 46/109 (42%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y+     P  YK     PP YK     PP YK     P  YK     PP YK     PP 
Sbjct: 279 YRAKPSYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPT 338

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YKP    PP YKP +  PP YK     PP+YK     PP
Sbjct: 339 YKAKPSYPPSYKPKTTYPPSYKPKISYPPTYKAKPSYPPIYKAKPSYPP 387

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 47/119 (39%), Positives = 49/119 (41%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YK     PP YK     PP YK     PP YKP    PP YKP +  PP 
Sbjct: 309 YKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPSYKPKISYPPT 368

Query: 186 YKPPAEKPPVYK-----PPVYKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP+YK     PP YK      P YK     PP YK     P  YK     PP
Sbjct: 369 YKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTTYKAKPSYPP 427

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 44/109 (40%), Positives = 45/109 (41%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     P  YK     PP YK     PP YK     PP YKP    PP 
Sbjct: 299 YKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPPS 358

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YK     PP+YK     PP YK      P YK     PP
Sbjct: 359 YKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPP 407

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/130 (36%), Positives = 51/130 (39%), Gaps = 20/130 (15%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           +YK     P  YKP    P  YKP +  PP YK     P  Y+     P  YK     PP
Sbjct: 238 IYKTKASYPSSYKPKKTYPSTYKPKISYPPTYKAKPSYPTSYRAKPSYPSTYKAKPSYPP 297

Query: 183 VYKPPAEKPPVYK---------------PPVYK-----PPVYKPPVEKPPVYKPPVEKPP 302
            YK     PP YK               PP YK     PP YK     PP YKP    PP
Sbjct: 298 TYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPSYKPKTTYPP 357

Query: 303 VYKPPVEKPP 332
            YKP +  PP
Sbjct: 358 SYKPKISYPP 367

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 47/119 (39%), Positives = 48/119 (40%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YK     PP YK     PP YK     PP YK     P  
Sbjct: 499 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQT 558

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK  +  PP YK     PP YK     PP YK     PP YK     PP YK     PP
Sbjct: 559 YKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 617

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 47/119 (39%), Positives = 47/119 (39%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YK     PP YK     P  YK     PP YK     PP 
Sbjct: 519 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPT 578

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YK     PP YK     PP YK     PP YK     PP YK     PP
Sbjct: 579 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 637

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 46/119 (38%), Positives = 48/119 (40%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YK     PP+YK     PP YK      P YK     PP YK     P  
Sbjct: 359 YKPKISYPPTYKAKPSYPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTT 418

Query: 186 YKPPAEKPPVYK-----PPVYKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YK     PP YK      P YK     PP YK     PP YK     PP
Sbjct: 419 YKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 477

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 43/109 (39%), Positives = 43/109 (39%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     P  YK     PP YK     PP YK     PP YK     PP 
Sbjct: 539 YKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPT 598

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YK     PP YK     PP YK     PP YK     PP
Sbjct: 599 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 647

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 51/133 (38%), Positives = 51/133 (38%), Gaps = 24/133 (18%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YK     PP YK     PP YK     PP YK     PP 
Sbjct: 559 YKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPT 618

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYK---------PPVEK-----PPVYKPPVE 293
           YK     PP YK     PP YK     PP YK         P   K     PP YK    
Sbjct: 619 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPATYPSTYKAKPSYPPTYKAKPS 678

Query: 294 KPPVYKPPVEKPP 332
            PP YKP    PP
Sbjct: 679 YPPTYKPKPSYPP 691

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 42/109 (38%), Positives = 45/109 (41%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     P  YKP    P  YKP V  PP YK     PP+YK     P  
Sbjct: 189 YKSKSSYPPSYKTKKTYPSSYKPKKTYPSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSS 248

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    P  YKP +  PP YK     P  Y+     P  YK     PP
Sbjct: 249 YKPKKTYPSTYKPKISYPPTYKAKPSYPTSYRAKPSYPSTYKAKPSYPP 297

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/129 (36%), Positives = 48/129 (37%), Gaps = 20/129 (15%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YK  +  PP YK     PP YK     PP YK     PP 
Sbjct: 419 YKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPT 478

Query: 186 YKPPAEKPPVYK---------------PPVYK-----PPVYKPPVEKPPVYKPPVEKPPV 305
           YK     P  YK               PP YK     PP YK     PP YK     PP 
Sbjct: 479 YKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPT 538

Query: 306 YKPPVEKPP 332
           YK     PP
Sbjct: 539 YKAKPSYPP 547

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/119 (38%), Positives = 46/119 (38%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YK     PP YK     PP YK     P  YK     PP 
Sbjct: 509 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPT 568

Query: 186 YKPPAEKPPVYK-----PPVYKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YK     PP YK      P YK     PP YK     PP YK     PP
Sbjct: 569 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 627

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 42/108 (38%), Positives = 42/108 (38%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YK     PP YK     PP YK     PP YK     PP YK     PP 
Sbjct: 549 YKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPT 608

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YK     PP YK     PP YK     PP YK     PP YK     P
Sbjct: 609 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYP 656

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 42/109 (38%), Positives = 44/109 (40%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YKP    P  YKP V  PP YK     PP+YK     P  YKP    P  
Sbjct: 199 YKTKKTYPSSYKPKKTYPSTYKPKVSYPPTYKSKKSYPPIYKTKASYPSSYKPKKTYPST 258

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YK     P  Y+     P  YK     PP YK     PP
Sbjct: 259 YKPKISYPPTYKAKPSYPTSYRAKPSYPSTYKAKPSYPPTYKAKPSYPP 307

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 45/112 (40%), Positives = 47/112 (41%), Gaps = 4/112 (3%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPPVEKPPVYKPPVE 173
           YK     P  YKP    PP YKP +  PP YK         PP YKP    P  YK    
Sbjct: 139 YKSKSSYPSSYKPKKTYPPTYKPKLTYPPTYK----PKPSYPPTYKPKPSYPATYKSKSS 194

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            PP YK     P  YKP    P  YKP V  PP YK     PP+YK     P
Sbjct: 195 YPPSYKTKKTYPSSYKPKKTYPSTYKPKVSYPPTYKSKKSYPPIYKTKASYP 246

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 45/119 (37%), Positives = 45/119 (37%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK        YK     PP YK     PP YK     PP YK     PP YK     PP 
Sbjct: 489 YKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPT 548

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     P  YK     PP YK     PP YK     PP YK     PP YK     PP
Sbjct: 549 YKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 607

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 47/139 (33%), Positives = 48/139 (34%), Gaps = 30/139 (21%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     P  YK     PP YK     PP YK  +  PP YK     PP 
Sbjct: 399 YKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYKAKLSYPPTYKAKPSYPPT 458

Query: 186 YKPPAEKPPVYK-----PPVYK-------------------------PPVYKPPVEKPPV 275
           YK     PP YK     PP YK                         PP YK     PP 
Sbjct: 459 YKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPT 518

Query: 276 YKPPVEKPPVYKPPVEKPP 332
           YK     PP YK     PP
Sbjct: 519 YKAKPSYPPTYKAKPSYPP 537

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 42/112 (37%), Positives = 46/112 (41%), Gaps = 4/112 (3%)
 Frame = +3

Query: 6   YKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           Y P  +     P  YK     PP YK     P  YKP    P  YKP V  PP YK    
Sbjct: 175 YPPTYKPKPSYPATYKSKSSYPPSYKTKKTYPSSYKPKKTYPSTYKPKVSYPPTYKSKKS 234

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            PP+YK  A  P  YKP    P  YKP +  PP YK     P  Y+     P
Sbjct: 235 YPPIYKTKASYPSSYKPKKTYPSTYKPKISYPPTYKAKPSYPTSYRAKPSYP 286

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 44/119 (36%), Positives = 44/119 (36%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YK     PP YK     P  YK        YK     PP 
Sbjct: 449 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPT 508

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YK     PP YK     PP YK     PP YK     P  YK     PP
Sbjct: 509 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPP 567

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 44/119 (36%), Positives = 44/119 (36%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     P  YK        YK     PP YK     PP YK     PP 
Sbjct: 469 YKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPT 528

Query: 186 YKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YK     PP YK     P  YK     PP YK     PP YK     PP
Sbjct: 529 YKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPSYPP 587

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 43/118 (36%), Positives = 44/118 (37%), Gaps = 10/118 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK  +  PP YK     PP YK     PP YK     PP YK     P  YK        
Sbjct: 439 YKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSST 498

Query: 186 YKPPAEKPPVYK-----PPVYKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YK     PP YK     PP YK      P YK     PP YK     PP YK     P
Sbjct: 499 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYP 556

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 42/112 (37%), Positives = 44/112 (39%), Gaps = 4/112 (3%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVE-KP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           Y P  +  P Y P  + KP   P YK     PP YK     P  YK     PP YK    
Sbjct: 375 YPPIYKAKPSYPPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYKAKPS 434

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            PP YK     PP YK     PP YK     PP YK     PP YK     P
Sbjct: 435 YPPTYKAKLSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKTKPSYP 486

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 41/106 (38%), Positives = 43/106 (40%), Gaps = 4/106 (3%)
 Frame = +3

Query: 6   YKPPVE-KP---PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           Y P  + KP   P YK     PP YK     P  YK     PP YK     PP YK  + 
Sbjct: 385 YPPTYKAKPSYLPTYKAKPSYPPTYKAKPRYPTTYKAKPSYPPTYKAKPSYPPTYKAKLS 444

Query: 174 KPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
            PP YK     PP YK     PP YK     PP YK     P  YK
Sbjct: 445 YPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKTKPSYPRTYK 490

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 45/133 (33%), Positives = 47/133 (35%), Gaps = 24/133 (18%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPP--------------VYKPPVEKPPVYKPPVEKPPVYKPPVE 143
           Y P  +  P Y P  +  P               YK     PP YK     PP YK    
Sbjct: 465 YPPTYKAKPSYPPTYKTKPSYPRTYKAKPSYSSTYKAKPSYPPTYKAKPSYPPTYKAKPS 524

Query: 144 KPPVYKPPVEKPPVYKPPAEKPPVYK-----PPVYK-----PPVYKPPVEKPPVYKPPVE 293
            PP YK     PP YK     PP YK     P  YK     PP YK     PP YK    
Sbjct: 525 YPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPQTYKAKSSYPPTYKAKPSYPPTYKAKPS 584

Query: 294 KPPVYKPPVEKPP 332
            PP YK     PP
Sbjct: 585 YPPTYKAKPSYPP 597

[122][TOP]
>UniRef100_Q9FSG1 Putative extensin n=1 Tax=Nicotiana sylvestris RepID=Q9FSG1_NICSY
          Length = 311

 Score =  100 bits (249), Expect = 5e-20
 Identities = 69/140 (49%), Positives = 72/140 (51%), Gaps = 31/140 (22%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPVEKPPVYK------ 161
           YK P   PPVYK P   PPVYK     PPV  YK P   PPVYK P   PPVYK      
Sbjct: 112 YKSPPPPPPVYKSP--PPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPP 167

Query: 162 -PPVEK---PPVYKPPAEKPPVYK-------PPVYK---PPVY--KPPVEKPPVYKPPVE 293
            PPV K   PP+YK  +  PPVYK       PP+YK   PPVY  K P   PPVYK    
Sbjct: 168 PPPVHKSPPPPIYKYKSPPPPVYKYKSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSP 227

Query: 294 KPPVYK-------PPVEKPP 332
            PPVYK       PPV K P
Sbjct: 228 PPPVYKYKSPPPPPPVYKSP 247

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 67/134 (50%), Positives = 69/134 (51%), Gaps = 24/134 (17%)
 Frame = +3

Query: 3   VYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPV--YKPPVEKPPVYKPPV 170
           VYK     PPVYK   P   PPVYK P   PPVYK     PPV  YK P   PPVYK P 
Sbjct: 69  VYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPVYKYKSPPPPPPVYKSP- 125

Query: 171 EKPPVYKPPAEKPPVYK-------PPVYK---PPVYK-------PPVEK---PPVYKPPV 290
             PPVYK  +  PPVYK       PPVYK   PPVYK       PPV K   PP+YK   
Sbjct: 126 -PPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVHKSPPPPIYKYKS 184

Query: 291 EKPPVYKPPVEKPP 332
             PPVYK     PP
Sbjct: 185 PPPPVYKYKSPPPP 198

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 66/130 (50%), Positives = 68/130 (52%), Gaps = 21/130 (16%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKP 179
           YK P    P+Y+ P   PPVYK     PPVYK   P   PPVYK P   PPVYK     P
Sbjct: 52  YKSPPPPLPIYRSP--PPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPP 107

Query: 180 PVYK--PPAEKPPVYK---PPVYK-----PPV--YKPPVEKPPVYKPPVEKPPVYK---- 311
           PVYK   P   PPVYK   PPVYK     PPV  YK P   PPVYK P   PPVYK    
Sbjct: 108 PVYKYKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSP 165

Query: 312 ---PPVEKPP 332
              PPV K P
Sbjct: 166 PPPPPVHKSP 175

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 79/169 (46%), Positives = 83/169 (49%), Gaps = 59/169 (34%)
 Frame = +3

Query: 3   VYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYK-------PPVEK---PPVYK----- 131
           VYK     PPVYK   P   PPVYK P   PPVYK       PPV K   PP+YK     
Sbjct: 129 VYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPVYKYKSPPPPPPVHKSPPPPIYKYKSPP 186

Query: 132 PPVEK-------PPVYK---PPVEK-------PPVYKPPAEKPPVYK-------PPVYK- 236
           PPV K       PP+YK   PPV K       PPVYK  +  PPVYK       PPVYK 
Sbjct: 187 PPVYKYKSPPPPPPMYKSPPPPVYKHKSPPPPPPVYKYKSPPPPVYKYKSPPPPPPVYKS 246

Query: 237 --PPVYK-------PPVEK---PPV--YKPPVEKPPVYK---PPVEKPP 332
             PP+YK       PPV K   PPV  YK P   PPVYK   PPV K P
Sbjct: 247 PPPPIYKYKSPPPPPPVYKSPPPPVYKYKSPPPPPPVYKSPPPPVYKSP 295

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 53/112 (47%), Positives = 54/112 (48%), Gaps = 2/112 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           VYK     PPVYK   P   PPVYK P   PP+YK        YK P   PPVYK P   
Sbjct: 221 VYKYKSPPPPVYKYKSPPPPPPVYKSP--PPPIYK--------YKSPPPPPPVYKSP--P 268

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PPVYK        YK P   PPVYK P   PPVYK P   PP Y      PP
Sbjct: 269 PPVYK--------YKSPPPPPPVYKSP--PPPVYKSP---PPPYHYYYTSPP 307

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 52/110 (47%), Positives = 55/110 (50%), Gaps = 15/110 (13%)
 Frame = +3

Query: 42  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYK 221
           PP  K  VY  P   PPVYK        YK P    P+Y+ P   PPVYK  +  PPVYK
Sbjct: 34  PPPTKKYVYSSP--PPPVYK--------YKSPPPPLPIYRSP--PPPVYKYKSPPPPVYK 81

Query: 222 -------PPVYK---PPVYKPPVEKPPV--YKPPVEKPPVYK---PPVEK 326
                  PPVYK   PPVYK     PPV  YK P   PPVYK   PPV K
Sbjct: 82  YKSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPPPPVYKSPPPPVYK 131

[123][TOP]
>UniRef100_A5BQP2 Putative uncharacterized protein n=1 Tax=Vitis vinifera
           RepID=A5BQP2_VITVI
          Length = 1190

 Score =  100 bits (249), Expect = 5e-20
 Identities = 60/119 (50%), Positives = 75/119 (63%), Gaps = 10/119 (8%)
 Frame = +3

Query: 3   VYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPP 167
           VYK P+  P PVYK P+  P PVYK P+  P P+YK P+  P P+YK P+  P P+YK P
Sbjct: 286 VYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKP 345

Query: 168 VEKP-PVYKPPAEKP-PVYKPPVYKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP 329
           +  P P+YK P   P P+YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P
Sbjct: 346 LPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPP 404

 Score =  100 bits (249), Expect = 5e-20
 Identities = 60/119 (50%), Positives = 75/119 (63%), Gaps = 10/119 (8%)
 Frame = +3

Query: 3   VYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPP 167
           +YK P+  P P+YK P+  P P+YK P+  P PVYK P+  P PVYK P+  P PVYK P
Sbjct: 341 IYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKP 400

Query: 168 VEKP-PVYKPPAEKP-PVYKPPVYKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP 329
           +  P P+YK P   P P+YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P
Sbjct: 401 LPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPP 459

 Score =  100 bits (248), Expect = 7e-20
 Identities = 59/119 (49%), Positives = 75/119 (63%), Gaps = 10/119 (8%)
 Frame = +3

Query: 3   VYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPP 167
           +YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P P+YK P+  P P+YK P
Sbjct: 275 IYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKKP 334

Query: 168 VEKP-PVYKPPAEKP-PVYKPPVYKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP 329
           +  P P+YK P   P P+YK P+  P P+YK P+  P PVYK P+  P PVYK P+  P
Sbjct: 335 LPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPP 393

 Score =  100 bits (248), Expect = 7e-20
 Identities = 59/119 (49%), Positives = 75/119 (63%), Gaps = 10/119 (8%)
 Frame = +3

Query: 3   VYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPP 167
           VYK P+  P PVYK P+  P P+YK P+  P P+YK P+  P P+YK P+  P P+YK P
Sbjct: 297 VYKKPLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKP 356

Query: 168 VEKP-PVYKPPAEKP-PVYKPPVYKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP 329
           +  P P+YK P   P PVYK P+  P PVYK P+  P PVYK P+  P P+YK P+  P
Sbjct: 357 LPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKKPLPPP 415

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 58/119 (48%), Positives = 75/119 (63%), Gaps = 10/119 (8%)
 Frame = +3

Query: 3   VYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPP 167
           +YK P+  P P+YK P+  P P+YK P+  P P+YK P+  P P+YK P+  P PVYK P
Sbjct: 319 IYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKP 378

Query: 168 VEKP-PVYKPPAEKP-PVYKPPVYKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP 329
           +  P PVYK P   P PVYK P+  P P+YK P+  P P+YK P+  P PVYK P+  P
Sbjct: 379 LPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPP 437

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 60/115 (52%), Positives = 73/115 (63%), Gaps = 10/115 (8%)
 Frame = +3

Query: 3   VYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPP 167
           +YK P+  P P+YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P P+YK P
Sbjct: 352 IYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKKP 411

Query: 168 VEKP-PVYKPPAEKP-PVYKPPVYKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPP 317
           +  P P+YK P   P PVYK P+  P PVYK P+  P PVYK P+  P PVYK P
Sbjct: 412 LPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKP 466

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 58/118 (49%), Positives = 74/118 (62%), Gaps = 9/118 (7%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPV 170
           V+ PPV   P+YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P P+YK P+
Sbjct: 268 VFPPPV---PIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKKPL 324

Query: 171 EKP-PVYKPPAEKP-PVYKPPVYKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP 329
             P P+YK P   P P+YK P+  P P+YK P+  P P+YK P+  P PVYK P+  P
Sbjct: 325 PPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPP 382

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 57/121 (47%), Positives = 72/121 (59%), Gaps = 11/121 (9%)
 Frame = +3

Query: 3   VYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPP 167
           VYK P+  P P+YK P+  P P+YK P+  P PVYK P+  P PVYK P+  P PVYK P
Sbjct: 396 VYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKP 455

Query: 168 VEKP-PVYKPPA--EKPPVYKPPVYKPPVYKPPVEK-PPVYK--PPVEKPPVYKPPVEKP 329
           +  P PVYK P   E P +  PP+   P+YK P+    P+YK  PP+ KP    PP+ K 
Sbjct: 456 LPPPVPVYKKPCPPEIPKILPPPI---PIYKKPLPPFVPIYKPIPPISKPLPPFPPIYKK 512

Query: 330 P 332
           P
Sbjct: 513 P 513

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 56/121 (46%), Positives = 70/121 (57%), Gaps = 13/121 (10%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPP----VYKP---PVEKPPVYKPPVEKPPVYKPPVEKP-PVYK 161
           YKP    P +Y PP++ PP    VY P   P   P V+ PPV   P+YK P+  P PVYK
Sbjct: 235 YKP---MPKIYLPPIKFPPLPPKVYPPFTFPPLPPKVFPPPV---PIYKKPLPPPVPVYK 288

Query: 162 PPVEKP-PVYKPPAEKP-PVYKPPVYKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEK 326
            P+  P PVYK P   P PVYK P+  P P+YK P+  P P+YK P+  P P+YK P+  
Sbjct: 289 KPLPPPVPVYKKPLPPPVPVYKKPLPPPVPIYKKPLPPPVPIYKKPLPPPVPIYKKPLPP 348

Query: 327 P 329
           P
Sbjct: 349 P 349

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 56/120 (46%), Positives = 69/120 (57%), Gaps = 18/120 (15%)
 Frame = +3

Query: 3   VYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYKPPV--EKPPVYKP 164
           +YK P+  P PVYK P+  P PVYK P+  P PVYK P+  P PVYK P   E P +  P
Sbjct: 418 IYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPLPPPVPVYKKPCPPEIPKILPP 477

Query: 165 PV---EKP-----PVYKP--PAEKPPVYKPPVYKPPVYKPPVEKPPVYK-PPVEK-PPVY 308
           P+   +KP     P+YKP  P  KP    PP+YK P   PP+ + P+ K PPV K PP Y
Sbjct: 478 PIPIYKKPLPPFVPIYKPIPPISKPLPPFPPIYKKP--WPPIPQVPLPKFPPVHKFPPKY 535

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 50/114 (43%), Positives = 58/114 (50%), Gaps = 8/114 (7%)
 Frame = +3

Query: 12   PPVEKPPVYKP------PVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 170
            PPV KPP+  P      P+  P PVY  P+   PV   PV K P+  P VEKP    PPV
Sbjct: 957  PPVPKPPLPPPVPVSQEPLPPPSPVYNEPLPPSPV---PVLKKPI-PPIVEKP--LPPPV 1010

Query: 171  EKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKP 329
               P++K PA  PPV   PVYK P   PP    PVY  P+  P P +K P   P
Sbjct: 1011 ---PIFKKPALPPPV---PVYKKPPLPPPPPPVPVYGEPLPPPVPAFKKPYPPP 1058

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 51/123 (41%), Positives = 57/123 (46%), Gaps = 14/123 (11%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
            Y  P   PPV  PP   PPVYK   P   PP   P    P VY  P  +P  Y+P     
Sbjct: 845  YPAPEADPPVSHPP--PPPVYKQQIPPSVPPYTAP--SPPQVYDQPSPQPVYYEPHPPPV 900

Query: 180  PVYKPPAEKP-PVYKPPVYKP-PVYKPPVEKP-PVY-KPPVEK--PPV------YKPPVE 323
            P+Y  P   P  VY  P   P PVYK P+  P P+Y KPP+    PPV        PPV 
Sbjct: 901  PIYHKPLPPPVRVYGQPFPSPVPVYKKPLPPPVPIYKKPPLPSLPPPVPVHKKSLPPPVP 960

Query: 324  KPP 332
            KPP
Sbjct: 961  KPP 963

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 54/153 (35%), Positives = 69/153 (45%), Gaps = 43/153 (28%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKP------------PVYKPPVEKP-PVYKPP-- 137
            VY  P  +P  Y+P     P+Y  P+  P            PVYK P+  P P+YK P  
Sbjct: 882  VYDQPSPQPVYYEPHPPPVPIYHKPLPPPVRVYGQPFPSPVPVYKKPLPPPVPIYKKPPL 941

Query: 138  --VEKP-PVYK----PPVEKPPVYKP-PAEKPPVYKP-PVYKPPV-----------YKPP 257
              +  P PV+K    PPV KPP+  P P  + P+  P PVY  P+             P 
Sbjct: 942  PSLPPPVPVHKKSLPPPVPKPPLPPPVPVSQEPLPPPSPVYNEPLPPSPVPVLKKPIPPI 1001

Query: 258  VEKP-----PVYKPPVEKPPV---YKPPVEKPP 332
            VEKP     P++K P   PPV    KPP+  PP
Sbjct: 1002 VEKPLPPPVPIFKKPALPPPVPVYKKPPLPPPP 1034

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 52/138 (37%), Positives = 62/138 (44%), Gaps = 32/138 (23%)
 Frame = +3

Query: 12   PPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPP-- 167
            P VEKP     P++K P   PPV   PV K P   PP    PVY  P+  P P +K P  
Sbjct: 1000 PIVEKPLPPPVPIFKKPALPPPV---PVYKKPPLPPPPPPVPVYGEPLPPPVPAFKKPYP 1056

Query: 168  -----VEKP-----PVYKP------PAEKPPVYK--PPVYKP------PVYKPPVEKPPV 275
                 VEKP     P++KP      PA  P V    PP+Y P      P  KP V  PP 
Sbjct: 1057 PPLPIVEKPLPPPIPIHKPIPPISKPAPTPEVLPAPPPIYSPKPPILNPTPKPKVLPPPQ 1116

Query: 276  YKPPVEKPPVYKPPVEKP 329
              P  +KP     P++KP
Sbjct: 1117 PVPITKKPLPPPVPIQKP 1134

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 50/136 (36%), Positives = 66/136 (48%), Gaps = 26/136 (19%)
 Frame = +3

Query: 3    VYKPPVEKP-----PVYKPPVEKP-PVYKPPVEKP-PVYKPPVEKP-PVYK--PPVEKP- 149
            VYK P   P     PVY  P+  P P +K P   P P+ + P+  P P++K  PP+ KP 
Sbjct: 1024 VYKKPPLPPPPPPVPVYGEPLPPPVPAFKKPYPPPLPIVEKPLPPPIPIHKPIPPISKPA 1083

Query: 150  PVYKPPVEKPPVYKPPAEKPPVYKP---PVYKPPVYKPPVEKPPVYKP-PVEK------- 296
            P  +     PP+Y P   KPP+  P   P   PP    P+ K P+  P P++K       
Sbjct: 1084 PTPEVLPAPPPIYSP---KPPILNPTPKPKVLPPPQPVPITKKPLPPPVPIQKPVPAAQN 1140

Query: 297  -PPVYK---PPVEKPP 332
             PPVYK   PP+ K P
Sbjct: 1141 PPPVYKKPLPPIPKAP 1156

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 47/119 (39%), Positives = 53/119 (44%), Gaps = 18/119 (15%)
 Frame = +3

Query: 15   PVEKPPVYKPP---VEKPPVYKPPVEKPPVYKPPVEKPPVYKP--PVEKPPVYKPPVEKP 179
            P   P  Y PP   V  P  Y  P   PPV  PP   PPVYK   P   PP   P    P
Sbjct: 825  PKPLPKFYLPPFSPVPTPITYPAPEADPPVSHPP--PPPVYKQQIPPSVPPYTAP--SPP 880

Query: 180  PVYKPPAEKPPVYKP-----PVYKPP------VYKPPVEKP-PVYKPPVEKP-PVYKPP 317
             VY  P+ +P  Y+P     P+Y  P      VY  P   P PVYK P+  P P+YK P
Sbjct: 881  QVYDQPSPQPVYYEPHPPPVPIYHKPLPPPVRVYGQPFPSPVPVYKKPLPPPVPIYKKP 939

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 53/144 (36%), Positives = 69/144 (47%), Gaps = 41/144 (28%)
 Frame = +3

Query: 9    KPPVEKPP----VYKPPVEKP-PVYKPP-------VEKP-----PVYKP--PVEKP---- 119
            KPP+  PP    VY  P+  P P +K P       VEKP     P++KP  P+ KP    
Sbjct: 1027 KPPLPPPPPPVPVYGEPLPPPVPAFKKPYPPPLPIVEKPLPPPIPIHKPIPPISKPAPTP 1086

Query: 120  -------PVY--KPPVEKP---PVYKPPVEKPPVYKPPAEKP-PVYKP-PVYK--PPVYK 251
                   P+Y  KPP+  P   P   PP +  P+ K P   P P+ KP P  +  PPVYK
Sbjct: 1087 EVLPAPPPIYSPKPPILNPTPKPKVLPPPQPVPITKKPLPPPVPIQKPVPAAQNPPPVYK 1146

Query: 252  PPVEKPPVYKPPV--EKPPVYKPP 317
             P+  PP+ K P   + PP+ K P
Sbjct: 1147 KPL--PPIPKAPALPKLPPLPKTP 1168

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 42/102 (41%), Positives = 53/102 (51%), Gaps = 2/102 (1%)
 Frame = +3

Query: 30  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPPVYKPPAEK 206
           P YK P + P V  P +       PP  K  P YKP    P +Y PP++ PP+  PP   
Sbjct: 210 PYYKHP-QLPKVSWPKL-------PPYSKSHPWYKP---MPKIYLPPIKFPPL--PPKVY 256

Query: 207 PPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP-PVYKPPVEKP 329
           PP   PP+  P V+ PPV   P+YK P+  P PVYK P+  P
Sbjct: 257 PPFTFPPL-PPKVFPPPV---PIYKKPLPPPVPVYKKPLPPP 294

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 40/106 (37%), Positives = 47/106 (44%), Gaps = 6/106 (5%)
 Frame = +3

Query: 30   PVYK-PPVEKPPVYKPPVEKPPVYKPP---VEKPPVYKPPVEKPPVYKPPVEKPPVYKP- 194
            P YK PP+   P +  P+  P  Y PP   V  P  Y  P   PPV  PP   PPVYK  
Sbjct: 811  PFYKYPPLPTLPHWPKPL--PKFYLPPFSPVPTPITYPAPEADPPVSHPP--PPPVYKQQ 866

Query: 195  -PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
             P   PP   P    P VY  P  +P  Y+P     P+Y  P+  P
Sbjct: 867  IPPSVPPYTAPS--PPQVYDQPSPQPVYYEPHPPPVPIYHKPLPPP 910

[124][TOP]
>UniRef100_A8XU99 Putative uncharacterized protein (Fragment) n=1 Tax=Caenorhabditis
            briggsae RepID=A8XU99_CAEBR
          Length = 2024

 Score =  100 bits (249), Expect = 5e-20
 Identities = 55/110 (50%), Positives = 62/110 (56%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 709  VKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAP 768

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V + P E  PV   PV K PV   PVE  PV + PVE  PV  PPVE+ P
Sbjct: 769  VKEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKPVEAAPVEAPPVERKP 818

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 55/110 (50%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PVE  PV   PVE  PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 348 VEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAP 407

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P E  PV   PV K PV   PVE  PV K PVE  PV   PVE+ P
Sbjct: 408 VEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKP 457

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 55/110 (50%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 358 VEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAP 417

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P EK PV   PV   PV K PVE  PV   PVE+ PV   PVE+ P
Sbjct: 418 VEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKP 467

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/106 (50%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV + PVE  PV   PVEK PV   PVE  PV K 
Sbjct: 382 PVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKK 441

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 442 PVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 487

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/106 (50%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV + PVE  PV   PVEK PV   PVE  PV K PVE  PV   
Sbjct: 392 PVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAA 451

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV + PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 452 PVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAP 497

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/106 (50%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV K PVE  PV   PVEK PV   PVE  PV + PVE  PV + 
Sbjct: 407 PVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEK 466

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 467 PVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 512

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/106 (50%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV K PVE  PV   PVEK PV   PVE  PV + PVE  PV + PVE  PV   
Sbjct: 417 PVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAA 476

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 477 PVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 522

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 55/110 (50%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V K PVE  PV   PVEK PV   PVE  PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 423 VEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 482

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 483 VEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAP 532

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 54/106 (50%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV + PVE  PV   PVE  PV   PVE+ PV   PVE  PV + 
Sbjct: 342 PVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEK 401

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVEK PV   PVE  PV K PVE  P
Sbjct: 402 PVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAP 447

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 54/106 (50%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV   PVEK PV   
Sbjct: 372 PVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAA 431

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV K PV   PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 432 PVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 477

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 54/110 (49%), Positives = 62/110 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PV++ PV   PVE+ PV   PVE  PV K PVE  PV   PVEK P
Sbjct: 383 VEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKP 442

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E  PV + PV   PV + PVE  PV   PVE+ PV   PVE+ P
Sbjct: 443 VEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKP 492

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 54/110 (49%), Positives = 62/110 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PVE  PV   PVEK PV   PVE  PV K PVE  PV   PVE+ P
Sbjct: 398 VKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKP 457

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV   PV + PVE  PV + PVE  PV   PV++ P
Sbjct: 458 VEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKP 507

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 53/106 (50%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV K PVE  PV   
Sbjct: 377 PVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAA 436

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P EK PV   PV   PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 437 PVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 482

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 53/106 (50%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV++ PV   PVE+ PV   PVE  PV K PVE  PV   PVEK PV   PVE  PV + 
Sbjct: 397 PVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEK 456

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 457 PVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 502

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 54/110 (49%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVEK PV   PVE  PV K PVE  PV   PVE+ PV   PVE+ P
Sbjct: 408 VEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKP 467

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E  PV + PV   PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 468 VEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 517

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 53/106 (50%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVEK PV   PVE  PV K PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + 
Sbjct: 422 PVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEK 481

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PV++ PV   PVE  PV + PVE  P
Sbjct: 482 PVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAP 527

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 55/107 (51%), Positives = 61/107 (57%), Gaps = 1/107 (0%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVEK PV   PVE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   
Sbjct: 437 PVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAA 496

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE+ PV   PVE  PPV K PVE  P
Sbjct: 497 PVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAP 543

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 54/110 (49%), Positives = 61/110 (55%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 679  VEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAP 738

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V + P E  PV   PV + PV   PVE  PV + PVE  PV   PVEK P
Sbjct: 739  VEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKP 788

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 53/106 (50%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PVE  PV + PVE  PV + PVE  PV   PVE  PV   
Sbjct: 322 PVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAA 381

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV   PV + PVE  PV + PVE  PV   PVEK P
Sbjct: 382 PVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKP 427

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 54/110 (49%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE  PV + PVE  PV + PVE  PV   PVE  PV   PVE+ P
Sbjct: 328 VKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKP 387

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E  PV + PV   PV + PVE  PV   PVEK PV   PVE  P
Sbjct: 388 VEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAP 437

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 53/106 (50%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV   PVE+ PV   PVE+ PV   PVE  PV   PVE  PV + PVE  PV   
Sbjct: 337 PVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAA 396

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P ++ PV   PV + PV   PVE  PV K PVE  PV   PVEK P
Sbjct: 397 PVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKP 442

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 53/106 (50%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE+ PV   PVE  PV   PVE  PV + PVE  PV   PV++ PV   
Sbjct: 347 PVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAA 406

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV   PV K PVE  PV   PVEK PV   PVE  P
Sbjct: 407 PVEEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAP 452

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 53/106 (50%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV   PVE  PV + PVE  PV   PV++ PV   PVE+ PV   
Sbjct: 357 PVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAA 416

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV K PV   PV   PVEK PV   PVE  PV + PVE  P
Sbjct: 417 PVEAAPVEKKPVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAP 462

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 53/106 (50%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV   PVE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV K 
Sbjct: 367 PVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKK 426

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV K PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 427 PVEAAPVEAAPVEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAP 472

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 53/106 (50%), Positives = 59/106 (55%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 693  PVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAA 752

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV   PV   PV + PVE  PV   PVEK PV   PVE  P
Sbjct: 753  PVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAP 798

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 53/106 (50%), Positives = 59/106 (55%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 703  PVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDA 762

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV + PV   PV   PVEK PV   PVE  PV + PVE  P
Sbjct: 763  PVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKPVEAAP 808

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 52/106 (49%), Positives = 60/106 (56%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 708  PVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAA 767

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P ++ PV   PV   PV K PVE  PV   PVE+ PV   PVE PP
Sbjct: 768  PVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKPVEAAPVEAPP 813

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 52/106 (49%), Positives = 62/106 (58%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE+ PV   PVE+ PV + PVE  PV + PVE  PV + PVE  PV   
Sbjct: 854  PVEEKPVEAAPVEEKPVEDAPVEEKPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAA 913

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV   PV + PV   PVE  PV   PVE+ PV   PVE+ P
Sbjct: 914  PVEEKPVDAAPVEEKPVDADPVEGKPVEAAPVEEKPVEAAPVERKP 959

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 53/107 (49%), Positives = 60/107 (56%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPVEK PV   PVE  PV + PVE  PV   PVE+  V   PVE  PV + PVE  PV  
Sbjct: 532 PPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEA 591

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 592 APVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 638

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 52/106 (49%), Positives = 62/106 (58%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE+ PV   PVE+ PV   PVE+ PV + PVE  PV + PVE  PV + 
Sbjct: 844  PVEEKPVEAAPVEEKPVEAAPVEEKPVEDAPVEEKPVEEKPVEAAPVEEKPVEAAPVEEK 903

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV   PV + PV   PVE+ PV   PVE  PV   PVE+ P
Sbjct: 904  PVEAAPVEAAPVEEKPVDAAPVEEKPVDADPVEGKPVEAAPVEEKP 949

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/111 (49%), Positives = 62/111 (55%), Gaps = 1/111 (0%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V K PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 438 VEKKPVEDAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAP 497

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYK-PPVEKPPVYKPPVEKPP 332
           V   P ++ PV   PV   PV + PVE  PV   PPVEK PV   PVE  P
Sbjct: 498 VEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAP 548

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 54/107 (50%), Positives = 61/107 (57%), Gaps = 1/107 (0%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + 
Sbjct: 447 PVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEK 506

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE  PPV K PVE  PV   PVE+ P
Sbjct: 507 PVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKP 553

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 55/111 (49%), Positives = 62/111 (55%), Gaps = 1/111 (0%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 453 VEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 512

Query: 183 VYKPPAEKPPVYKPPVYK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV   PPV K PVE  PV   PVE+ PV   PVE  P
Sbjct: 513 VEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAP 563

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 53/110 (48%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 649 VKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAP 708

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P E  PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 709 VKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 758

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 53/110 (48%), Positives = 61/110 (55%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 694  VEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 753

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V + P E  PV   PV + PV   PVE  PV K PVE  PV   PVE+ P
Sbjct: 754  VEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAPVEAAPVEEKP 803

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 53/110 (48%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 579 VKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 638

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E  PV + PV   PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 639 VDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 688

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 52/106 (49%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + 
Sbjct: 593 PVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEK 652

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 653 PVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 698

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 53/110 (48%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 619 VEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAP 678

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P E  PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 679 VEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKP 728

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 52/110 (47%), Positives = 63/110 (57%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV + PVE  PV + PVE  PV + PVE+ PV   PVE+ PV   PVE+ P
Sbjct: 845  VEEKPVEAAPVEEKPVEAAPVEEKPVEDAPVEEKPVEEKPVEAAPVEEKPVEAAPVEEKP 904

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P E  PV + PV   PV + PV+  PV   PVE  PV + PVE  P
Sbjct: 905  VEAAPVEAAPVEEKPVDAAPVEEKPVDADPVEGKPVEAAPVEEKPVEAAP 954

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  PV + PVE  PV   
Sbjct: 312 PVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDK 371

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 372 PVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAP 417

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV++ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE  PV   PVE  PV + 
Sbjct: 327 PVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEK 386

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE+ PV   PVE  PV K PVE  P
Sbjct: 387 PVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAPVEKKPVEAAP 432

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 643 PVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDA 702

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 703 PVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 748

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 663 PVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAA 722

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 723 PVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAP 768

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 673 PVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAA 732

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 733 PVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAP 778

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 573 PVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAA 632

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 633 PVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAP 678

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 603 PVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAA 662

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 663 PVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAP 708

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 613 PVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAA 672

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 673 PVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAP 718

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 633 PVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAA 692

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 693 PVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAP 738

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 51/104 (49%), Positives = 59/104 (56%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   
Sbjct: 718  PVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAA 777

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
            P E  PV K PV   PV   PVE+ PV   PVE PPV + P E+
Sbjct: 778  PVEAAPVEKKPVEAAPVEAAPVEEKPVEAAPVEAPPVERKPDER 821

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 53/107 (49%), Positives = 61/107 (57%), Gaps = 1/107 (0%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV   PV++ PV   
Sbjct: 452 PVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAA 511

Query: 195 PAEKPPVYKPPVYKPPVYK-PPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PPVEK PV   PVE  PV + PVE  P
Sbjct: 512 PVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAP 558

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 50/106 (47%), Positives = 61/106 (57%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE  PV + PVE  PV + PVE  PV + PVE+ PV   PVE+ PV   
Sbjct: 839  PVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEDAPVEEKPVEEKPVEAAPVEEKPVEAA 898

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV   PV   PV + PV+  PV + PV+  PV   PVE  P
Sbjct: 899  PVEEKPVEAAPVEAAPVEEKPVDAAPVEEKPVDADPVEGKPVEAAP 944

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/106 (48%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   
Sbjct: 658 PVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAA 717

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 718 PVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAP 763

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/106 (48%), Positives = 59/106 (55%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 688  PVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAA 747

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV + PV   PV   PV++ PV   PVE  PV K PVE  P
Sbjct: 748  PVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEKKPVEAAP 793

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 50/106 (47%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV++ PV   PVE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + 
Sbjct: 578 PVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEK 637

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P +  PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 638 PVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 683

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/110 (46%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   PV++ P
Sbjct: 594 VEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKP 653

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E  PV + PV   PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 654 VEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAP 703

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/110 (46%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PV+  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 634 VEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 693

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P E  PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 694 VEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKP 743

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/110 (46%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 664 VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAP 723

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P E  PV   PV + PV   PVE  PV + PVE  PV   PV++ P
Sbjct: 724 VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKP 773

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   
Sbjct: 588 PVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAA 647

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P ++ PV   PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 648 PVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 693

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/108 (46%), Positives = 62/108 (57%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV + PVE  PV + PVE+ PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 855  VEEKPVEAAPVEEKPVEDAPVEEKPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 914

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
            V + P +  PV + PV   PV   PVE  PV + PVE  PV + P E+
Sbjct: 915  VEEKPVDAAPVEEKPVDADPVEGKPVEAAPVEEKPVEAAPVERKPEER 962

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 60/106 (56%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + 
Sbjct: 1844 PVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEK 1903

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV   PV + PV   PVE  PV + PV+  PV   PV++ P
Sbjct: 1904 PVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKP 1949

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/106 (48%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV   
Sbjct: 232 PVEEEPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAA 291

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV    V   PVE+ PV   PVE  PV + PVE  P
Sbjct: 292 PVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAP 337

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/110 (47%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE   
Sbjct: 248 VKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAL 307

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV   PV + PVE  PV   PVE  PV + PVE  P
Sbjct: 308 VEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAP 357

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/106 (48%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV + PVE  PV + PVE  PV   PVE+ PV    VE  PV + 
Sbjct: 257 PVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEK 316

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE  PV   PVE+ PV   PVE+ P
Sbjct: 317 PVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEP 362

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/106 (48%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE   V   PVE+ PV   
Sbjct: 262 PVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDA 321

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 322 PVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAP 367

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/110 (46%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PV++ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 313 VEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKP 372

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E  PV + PV   PV   PV++ PV   PVE+ PV   PVE  P
Sbjct: 373 VEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKPVEAAPVEAAP 422

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/111 (48%), Positives = 61/111 (54%), Gaps = 1/111 (0%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 463 VEEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 522

Query: 183 VYKPPAEK-PPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E  PPV K PV   PV   PVE+ PV   PVE  PV +  VE  P
Sbjct: 523 VEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAP 573

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/111 (48%), Positives = 61/111 (54%), Gaps = 1/111 (0%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           V + PVE  PV   PVE+ PV   PVE  PPV K PVE  PV   PVE+ PV   PVE  
Sbjct: 503 VKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAA 562

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PV +   E  PV   PV + PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 563 PVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAP 613

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/111 (48%), Positives = 61/111 (54%), Gaps = 1/111 (0%)
 Frame = +3

Query: 3   VYKPPVEKPPVYK-PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           V + PVE  PV   PPVEK PV   PVE  PV + PVE  PV   PVE+  V   PVE  
Sbjct: 518 VEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAA 577

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PV + P E  PV   PV + PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 578 PVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 628

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 648 PVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAA 707

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P ++ PV   PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 708 PVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 753

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  PV + PVE  PV   
Sbjct: 678 PVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAA 737

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV   PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 738 PVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAP 783

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/104 (48%), Positives = 60/104 (57%)
 Frame = +3

Query: 21   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
            E+ PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE+ PV + PVE  PV + P 
Sbjct: 836  EEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEDAPVEEKPVEEKPVEAAPVEEKPV 895

Query: 201  EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            E  PV + PV   PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 896  EAAPVEEKPVEAAPVEAAPVEEKPVDAAPVEEKPVDADPVEGKP 939

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/110 (47%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+  V   PVE  PV + PVE  PV   PVE+ PV   PVE+ P
Sbjct: 549 VEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKP 608

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E  PV + PV   PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 609 VEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAP 658

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/106 (48%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+  V   PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE  PV + 
Sbjct: 563 PVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEK 622

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 623 PVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKP 668

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 50/110 (45%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   PV++ PV   PVE  P
Sbjct: 604 VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAP 663

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P E  PV   PV + PV   PVE  PV + PVE  PV   PV++ P
Sbjct: 664 VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKP 713

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/110 (46%), Positives = 61/110 (55%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PV+  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ P
Sbjct: 1365 VEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKP 1424

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P E+ PV   PV +  V   PVE+ P    PVE+ PV   PVE PP
Sbjct: 1425 VEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPP 1474

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + 
Sbjct: 242 PVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEK 301

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E   V   PV + PV   PVE  PV + PVE  PV   PVE  P
Sbjct: 302 PVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAP 347

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE+ PV   PVE  PV + PVE   V   PVE+ PV   PVE  PV + 
Sbjct: 272 PVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEK 331

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV   PV + PVE  PV + PVE  PV   PVE  P
Sbjct: 332 PVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAP 377

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE   V   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 282 PVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDK 341

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV + PVE  PV   PVE  PV   PVE+ P
Sbjct: 342 PVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKP 387

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/110 (47%), Positives = 59/110 (53%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE   V   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  P
Sbjct: 298 VEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAP 357

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P E  PV   PV   PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 358 VEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAP 407

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 53/107 (49%), Positives = 59/107 (55%), Gaps = 1/107 (0%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYK-PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PVE  PV + PVE  PV   PPVEK PV   PVE  PV + PVE  PV   PVE+  V  
Sbjct: 512 PVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVED 571

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV + PV   PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 572 APVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 618

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 51/110 (46%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V K PVE  PV   PVE+ PV   PVE  PV +  VE  PV   PV++ PV   PVE  P
Sbjct: 534 VEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAP 593

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P E  PV + PV   PV   PVE+ PV   PVE  PV + PV+  P
Sbjct: 594 VEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAP 643

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PVE+  V   PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 543 PVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAA 602

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 603 PVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVDDAPVEAAP 648

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 49/106 (46%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE  PV   
Sbjct: 618 PVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAA 677

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV   PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 678 PVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAP 723

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 49/106 (46%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 628 PVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAA 687

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PV++ PV   PVE  PV + PVE  P
Sbjct: 688 PVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAP 733

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 51/110 (46%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PVE  PV + PVE  PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 263 VEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAP 322

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P ++ PV   PV   PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 323 VEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKP 372

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 51/106 (48%), Positives = 57/106 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE   V   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + 
Sbjct: 292 PVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEE 351

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE  PV   PVE+ PV   PVE  P
Sbjct: 352 PVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAP 397

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/107 (48%), Positives = 60/107 (56%), Gaps = 1/107 (0%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYK 191
           PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PPV K
Sbjct: 477 PVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEK 536

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV   PV + PV   PVE  PV +  VE  PV   PV++ P
Sbjct: 537 KPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKP 583

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/111 (47%), Positives = 61/111 (54%), Gaps = 1/111 (0%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKP 179
           V + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PPVEK 
Sbjct: 478 VEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKK 537

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PV   P E  PV + PV   PV   PVE+  V   PVE  PV + PVE  P
Sbjct: 538 PVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAP 588

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 53/111 (47%), Positives = 61/111 (54%), Gaps = 1/111 (0%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKPPVYKPPVEKP 179
           V + PVE  PV   PV++ PV   PVE  PV + PVE  PV   PPVEK PV   PVE  
Sbjct: 488 VEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAA 547

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PV + P E  PV   PV +  V   PVE  PV + PVE  PV   PVE+ P
Sbjct: 548 PVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKP 598

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/107 (48%), Positives = 60/107 (56%), Gaps = 1/107 (0%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PV++ PV   PVE  PV + PVE  PV   PPVEK PV   PVE  PV + PVE  PV  
Sbjct: 502 PVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEA 561

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+  V   PV   PV + PVE  PV   PVE+ PV   PVE+ P
Sbjct: 562 APVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKP 608

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 52/107 (48%), Positives = 60/107 (56%), Gaps = 1/107 (0%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PVE+ PV   PVE  PPV K PVE  PV   PVE+ PV   PVE  PV +  VE  PV  
Sbjct: 517 PVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEA 576

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P ++ PV   PV   PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 577 APVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 623

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/106 (46%), Positives = 59/106 (55%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  PV + 
Sbjct: 1374 PVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEK 1433

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV +  V   PV + P E  PV + PV+  PV  PP E+ P
Sbjct: 1434 PVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKP 1479

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/110 (44%), Positives = 61/110 (55%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV + PV+  PV   PV++ PV   PVE  PV + PV+  PV   PV++ P
Sbjct: 1845 VEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKP 1904

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P E  PV + PV   PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 1905 VEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAP 1954

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/106 (46%), Positives = 59/106 (55%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 1854 PVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAA 1913

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P ++ PV   PV   PV + PV+  PV   PV++ PV   PVE  P
Sbjct: 1914 PVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAP 1959

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/110 (44%), Positives = 61/110 (55%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PV+  PV   PV++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  P
Sbjct: 1855 VEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAP 1914

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V + P E  PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 1915 VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKP 1964

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/110 (46%), Positives = 59/110 (53%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PVE  PV   PVE+ PV    VE  PV + PVE  PV   PV++ P
Sbjct: 273 VEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKP 332

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E  PV   PV + PV   PVE+ PV   PVE  PV   PVE  P
Sbjct: 333 VEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAP 382

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/110 (46%), Positives = 59/110 (53%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV    VE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 283 VEEKPVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKP 342

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV + PV   PVE  PV   PVE  PV + PVE  P
Sbjct: 343 VEAAPVEEEPVEAAPVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAP 392

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/107 (48%), Positives = 59/107 (55%), Gaps = 1/107 (0%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYK 191
           PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PPV K PVE  PV  
Sbjct: 487 PVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEA 546

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV   PV   PV +  VE  PV   PV++ PV   PVE  P
Sbjct: 547 APVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAP 593

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/107 (48%), Positives = 59/107 (55%), Gaps = 1/107 (0%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-PPVYKPPVEKPPVYKPPVEKPPVYK 191
           PVE  PV + PVE  PV   PVE+ PV   PVE  PPV K PVE  PV   PVE+ PV  
Sbjct: 497 PVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEAAPPVEKKPVEAAPVEAAPVEEKPVEA 556

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV +  V   PV   PV++ PV   PVE  PV + PVE  P
Sbjct: 557 APVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAP 603

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/107 (48%), Positives = 59/107 (55%), Gaps = 1/107 (0%)
 Frame = +3

Query: 15  PVEK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PVE  PPV K PVE  PV   PVE+ PV   PVE  PV +  VE  PV   PV++ PV  
Sbjct: 527 PVEAAPPVEKKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKLVEDAPVEAAPVKEKPVEA 586

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV + PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 587 APVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 633

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 49/105 (46%), Positives = 58/105 (55%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           VE  PV + PVE  PV   PV++ PV   PVE  PV   PVE+ PV   PVE+ PV   P
Sbjct: 308 VEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAAPVEEEPVEAAP 367

Query: 198 AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            E  PV   PV   PV + PVE  PV   PV++ PV   PVE+ P
Sbjct: 368 VEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEEKP 412

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 49/103 (47%), Positives = 58/103 (56%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   
Sbjct: 1864 PVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAA 1923

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
            P E  PV + PV   PV   PV++ PV   PVE  PV + PVE
Sbjct: 1924 PVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVE 1966

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 49/106 (46%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PV++ PV   PVE  PV + PVE  PV + PVE  PV + 
Sbjct: 227 PVEAAPVEEEPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEK 286

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV    VE  PV + PVE  PV   PV++ P
Sbjct: 287 PVEAAPVEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKP 332

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/110 (45%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PV++ PV   PVE  PV + PVE  PV + PVE  PV + PVE  P
Sbjct: 233 VEEEPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAP 292

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV    V   PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 293 VEAAPVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKP 342

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 49/106 (46%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV++ PV   PVE  PV + PVE  PV + PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 247 PVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAA 306

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             E  PV + PV   PV   PV++ PV   PVE  PV   PVE+ P
Sbjct: 307 LVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEP 352

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 49/105 (46%), Positives = 58/105 (55%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           VE  PV   PV++ PV   PVE  PV + PVE  PV + PVE  PV   PVE+ PV   P
Sbjct: 569 VEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 628

Query: 198 AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            E  PV + PV   PV   PV++ PV   PVE  PV + PVE  P
Sbjct: 629 VEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAP 673

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/110 (45%), Positives = 60/110 (54%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV + PV+   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 1820 VEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAP 1879

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P E+ PV   PV   PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 1880 VEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAP 1929

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 51/110 (46%), Positives = 60/110 (54%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV + PVE  PV +  VE  PV    VE+ PV   PVE+ PV   PVE+ P
Sbjct: 1330 VEEEPVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKP 1389

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P E  PV + PV   PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 1390 VEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAP 1439

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 48/106 (45%), Positives = 59/106 (55%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV    VE  PV + PVE  PV + PV+  PV   PV++ PV   PVE  PV + 
Sbjct: 1829 PVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEK 1888

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P +  PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 1889 PVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 1934

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/106 (46%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV    VE  PV + PVE  PV   PV++ PV   PVE  PV   PVE+ PV   
Sbjct: 297 PVEEKPVEAALVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEDKPVEAAPVEEEPVEAA 356

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV   PV   PVE  PV + PVE  PV   PV++ P
Sbjct: 357 PVEEEPVEAAPVEDKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKP 402

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 53/126 (42%), Positives = 62/126 (49%), Gaps = 16/126 (12%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 724  VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEDAPVEAAPVKEKPVEAAPVEAAP 783

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPP----------------VEKPPVYKP 314
            V K P E  PV   PV + PV   PVE PPV + P                 E+ PV   
Sbjct: 784  VEKKPVEAAPVEAAPVEEKPVEAAPVEAPPVERKPDERKEADSEIKKIISVTEEKPVEAA 843

Query: 315  PVEKPP 332
            PVE+ P
Sbjct: 844  PVEEKP 849

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/110 (44%), Positives = 60/110 (54%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PV+   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 1830 VEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKP 1889

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P E  PV + PV   PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 1890 VDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 1939

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 50/106 (47%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE  PV + PVE  PV +  VE  PV    VE+ PV   PVE+ PV   
Sbjct: 1324 PVEAAPVEEEPVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAA 1383

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV   PV   PV + PVE  PV   PVE  PV + PVE  P
Sbjct: 1384 PVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAP 1429

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 49/106 (46%), Positives = 59/106 (55%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE+ PV   PVE+  V   PVE   V + PV+  PV + PVE  PV + 
Sbjct: 1329 PVEEEPVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEK 1388

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV   PV + PV   PVE  PV   PVE+ PV   PVE+ P
Sbjct: 1389 PVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKP 1434

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 49/106 (46%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE  PV   PVE+ PV    VE  PV + PVE  PV + PV+   V   
Sbjct: 1784 PVEAAPVEEKPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAA 1843

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 1844 PVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKP 1889

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/106 (45%), Positives = 59/106 (55%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PV++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE  PV   
Sbjct: 1869 PVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAA 1928

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV   PV   PV + PVE  PV   PVE+ PV    VE+ P
Sbjct: 1929 PVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKP 1974

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 49/108 (45%), Positives = 59/108 (54%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   PVE+ P
Sbjct: 1375 VEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKP 1434

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
            V   P E+  V   PV + P    PVE+ PV   PVE PP  + P E+
Sbjct: 1435 VEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKPEER 1482

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 50/110 (45%), Positives = 59/110 (53%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV   PVE+ PV    VE  PV + PVE  PV + PV+   V   PVE+ P
Sbjct: 1790 VEEKPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKP 1849

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P E+ PV   PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 1850 VEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 1899

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 49/106 (46%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV    VE  PV + PVE  PV + PV+   V   PVE+ PV   PVE+ PV   
Sbjct: 1804 PVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAA 1863

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV + PV   PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 1864 PVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAP 1909

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 48/106 (45%), Positives = 59/106 (55%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PV+  PV   PV++ PV   
Sbjct: 1819 PVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAA 1878

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV + PV   PV   PV++ PV   PVE  PV + PVE  P
Sbjct: 1879 PVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAP 1924

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 48/106 (45%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV +  VE  PV   PV++ PV   PVE  PV + PVE  PV + PVE  PV   
Sbjct: 558 PVEAAPVEEKLVEDAPVEAAPVKEKPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEAA 617

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV   PV + PV+  PV   PV++ PV   PVE  P
Sbjct: 618 PVEEKPVEAAPVEAAPVEEKPVDDAPVEAAPVKEKPVEAAPVEAAP 663

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 49/106 (46%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 1899 PVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAA 1958

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV    V + PV    VE  PV + PVE  PV + PVE  P
Sbjct: 1959 PVEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAP 2004

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 49/106 (46%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 1909 PVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVA 1968

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              E+ PV    V   PV + PVE  PV + PVE  PV   PV++ P
Sbjct: 1969 SVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKP 2014

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 50/110 (45%), Positives = 59/110 (53%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV    VE+ P
Sbjct: 1915 VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKP 1974

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V     E  PV + PV   PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 1975 VDAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 2024

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 47/105 (44%), Positives = 58/105 (55%)
 Frame = +3

Query: 18   VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
            VE  PV + PVE  PV + PV+  PV   PV++ PV   PVE  PV + PV+  PV   P
Sbjct: 1840 VEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 1899

Query: 198  AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             ++ PV   PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 1900 VKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 1944

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/105 (45%), Positives = 58/105 (55%)
 Frame = +3

Query: 18   VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
            VE  PV + PVE  PV + PV+   V   PVE+ PV   PVE+ PV   PVE  PV + P
Sbjct: 1815 VEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKP 1874

Query: 198  AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             E  PV   PV + PV   PVE  PV + PVE  PV   PV++ P
Sbjct: 1875 VEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKP 1919

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/107 (44%), Positives = 59/107 (55%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 1870 VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAP 1929

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
            V + P +  PV   PV + PV   PVE  PV + PVE   V + PV+
Sbjct: 1930 VEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKPVD 1976

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 48/106 (45%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE  PV + PVE   V   PVE+ PV   PVE+ PV    VE  PV + 
Sbjct: 1789 PVEEKPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEK 1848

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV + PV   PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 1849 PVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 1894

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 49/110 (44%), Positives = 59/110 (53%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PV+  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 1885 VEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 1944

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V + P E  PV   PV + PV    VE+ PV    VE  PV + PVE  P
Sbjct: 1945 VKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAP 1994

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/104 (46%), Positives = 58/104 (55%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE+  V   PVE   V + PV+  PV + PVE  PV + PVE  PV   
Sbjct: 1339 PVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAA 1398

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
            P E+ PV   PV   PV   PVE+ PV   PVE+ PV   PVE+
Sbjct: 1399 PVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEE 1442

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 50/116 (43%), Positives = 58/116 (50%), Gaps = 10/116 (8%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK------ 176
           PVE PPV + PVE  PV   PVE+ PV   P+EK P    PVE  PV  PPVE+      
Sbjct: 19  PVEVPPVEEKPVEAAPVEVAPVEQKPVETAPLEKKPAEAAPVEAAPVEAPPVEEKQDEAT 78

Query: 177 ----PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
                PV + P E   V   PV + PV   P E  PV + P E  PV + PVE  P
Sbjct: 79  LAEAAPVEEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEKPFEATPVEQKPVEDSP 134

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/106 (45%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE   V + PV+  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV   
Sbjct: 1359 PVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAA 1418

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV   PV + PV   PVE+  V   PVE+ P    PVE+ P
Sbjct: 1419 PVEEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKP 1464

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/106 (45%), Positives = 57/106 (53%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 1879 PVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAA 1938

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV + PV   PV   PVE+ PV    VE+ PV    VE  P
Sbjct: 1939 PVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAP 1984

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 48/110 (43%), Positives = 59/110 (53%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  P
Sbjct: 1900 VKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAP 1959

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V + P E   V + PV    V   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 1960 VEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 2009

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 47/106 (44%), Positives = 55/106 (51%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P E+ PV  PPVE+ PV   PVE  PV + PVE  P+ K P E  PV   PVE PPV + 
Sbjct: 14  PAEEKPVEVPPVEEKPVEAAPVEVAPVEQKPVETAPLEKKPAEAAPVEAAPVEAPPVEEK 73

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             E       PV + PV    VE  PV + PVE  P    PVE+ P
Sbjct: 74  QDEATLAEAAPVEEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEKP 119

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 49/110 (44%), Positives = 59/110 (53%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV +  VE  PV    VE+ PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 1340 VEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAP 1399

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V + P E  PV   PV   PV + PVE  PV + PVE  PV +  V+  P
Sbjct: 1400 VEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAP 1449

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/106 (45%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+  V   PVE   V + PV+  PV + PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 1349 PVEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAA 1408

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV   PV + PV   PVE+ PV   PVE+  V   PVE+ P
Sbjct: 1409 PVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKP 1454

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/106 (43%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PV++ PV   
Sbjct: 1894 PVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAA 1953

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV + PV    V + PV+   V   PVE+ PV   PVE+ P
Sbjct: 1954 PVEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKPVEAAPVEEKP 1999

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/106 (43%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PV++ PV   PVE  PV + PV+  PV   PV++ PV   PVE  PV + PVE   V + 
Sbjct: 1914 PVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVEEKPVEVASVEEK 1973

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P +   V   PV + PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 1974 PVDAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 2019

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/104 (45%), Positives = 57/104 (54%)
 Frame = +3

Query: 21   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
            E+ PV   PVE+ PV   PVE+ PV   PVE+  V   PVE   V + PV+  PV + P 
Sbjct: 1321 EEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPVDAAPVEENPV 1380

Query: 201  EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            E  PV + PV   PV   PVE+ PV   PVE  PV   PVE+ P
Sbjct: 1381 EAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKP 1424

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 47/110 (42%), Positives = 59/110 (53%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PV+  P
Sbjct: 1805 VEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVDAAP 1864

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P ++ PV   PV   PV + PV+  PV   PV++ PV   PVE  P
Sbjct: 1865 VEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVKEKPVEAAPVEAAP 1914

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 46/106 (43%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   
Sbjct: 1884 PVEEKPVDAAPVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAA 1943

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P ++ PV   PV   PV + PVE   V + PV+   V   PVE+ P
Sbjct: 1944 PVKEKPVEAAPVEAAPVEEKPVEVASVEEKPVDAAQVEAAPVEEKP 1989

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 49/117 (41%), Positives = 57/117 (48%), Gaps = 10/117 (8%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK---------- 161
           PPVE+ PV   PVE  PV + PVE  P+ K P E  PV   PVE PPV +          
Sbjct: 23  PPVEEKPVEAAPVEVAPVEQKPVETAPLEKKPAEAAPVEAAPVEAPPVEEKQDEATLAEA 82

Query: 162 PPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PVE+ PV     E  PV + PV   P    PVE+ P    PVE+ PV   P E  P
Sbjct: 83  APVEEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEKPFEATPVEQKPVEDSPAEVAP 139

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 48/110 (43%), Positives = 58/110 (52%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V +  VE  PV    VE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 1350 VEEKSVEAVPVEAALVEEKPVDAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 1409

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P E  PV + PV   PV + PVE  PV +  V+  PV + P E  P
Sbjct: 1410 VEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAP 1459

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 49/120 (40%), Positives = 58/120 (48%), Gaps = 10/120 (8%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK----------PP 152
           V + PVE  PV   PVE+ PV   P+EK P    PVE  PV  PPVE+           P
Sbjct: 25  VEEKPVEAAPVEVAPVEQKPVETAPLEKKPAEAAPVEAAPVEAPPVEEKQDEATLAEAAP 84

Query: 153 VYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + PVE   V   P ++ PV   P    PV + P E  PV + PVE  P    PVEK P
Sbjct: 85  VEEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEKPFEATPVEQKPVEDSPAEVAPVEKKP 144

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 46/110 (41%), Positives = 53/110 (48%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  P+ K P E  PV   PVE PPV +   E       PVE+ PV    VE  P
Sbjct: 40  VEQKPVETAPLEKKPAEAAPVEAAPVEAPPVEEKQDEATLAEAAPVEEKPVEAASVEAAP 99

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P E  P    PV + P    PVE+ PV   P E  PV K PVE  P
Sbjct: 100 VKEKPVEDTPAEVAPVEEKPFEATPVEQKPVEDSPAEVAPVEKKPVEAAP 149

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 44/103 (42%), Positives = 51/103 (49%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P+EK P    PVE  PV  PPVE+        E  PV + PVE   V   PV++ PV   
Sbjct: 49  PLEKKPAEAAPVEAAPVEAPPVEEKQDEATLAEAAPVEEKPVEAASVEAAPVKEKPVEDT 108

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           PAE  PV + P    PV + PVE  P    PVEK PV   P E
Sbjct: 109 PAEVAPVEEKPFEATPVEQKPVEDSPAEVAPVEKKPVEAAPAE 151

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 48/112 (42%), Positives = 60/112 (53%), Gaps = 3/112 (2%)
 Frame = +3

Query: 3    VYKPPVEKPPVY-KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
            V + PVE  PV  KP VE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PV+  
Sbjct: 865  VEEKPVEDAPVEEKP-VEEKPVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVDAA 923

Query: 180  PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKP 329
            PV + P +  PV   PV   PV + PVE  PV + P E+         +EKP
Sbjct: 924  PVEEKPVDADPVEGKPVEAAPVEEKPVEAAPVERKPEERKEADTVNKKIEKP 975

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/101 (43%), Positives = 51/101 (50%), Gaps = 5/101 (4%)
 Frame = +3

Query: 45  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKP 224
           PVE  P  + PVE PPV + PVE  PV   PVE+ PV   P+EK P    P E  PV  P
Sbjct: 9   PVEAAPAEEKPVEVPPVEEKPVEAAPVEVAPVEQKPVETAPLEKKPAEAAPVEAAPVEAP 68

Query: 225 PVYKPP-----VYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PV +           PVE+ PV    VE  PV + PVE  P
Sbjct: 69  PVEEKQDEATLAEAAPVEEKPVEAASVEAAPVKEKPVEDTP 109

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 41/94 (43%), Positives = 51/94 (54%)
 Frame = +3

Query: 51   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPV 230
            E+ PV   PVE+ PV   PVE  PV + PVE   V   PVE+ PV   P E+ PV    V
Sbjct: 1781 EEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQV 1840

Query: 231  YKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
               PV + PVE  PV + PV+  PV   PV++ P
Sbjct: 1841 EAAPVEEKPVEAAPVEEKPVDAAPVEAAPVKEKP 1874

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 42/106 (39%), Positives = 49/106 (46%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           K P E  PV   PVE PPV +   E       PVE+ PV    VE  PV + PVE  P  
Sbjct: 52  KKPAEAAPVEAAPVEAPPVEEKQDEATLAEAAPVEEKPVEAASVEAAPVKEKPVEDTPAE 111

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
             P E+ P    PV + PV   P E  PV K PVE  P     V++
Sbjct: 112 VAPVEEKPFEATPVEQKPVEDSPAEVAPVEKKPVEAAPAEAATVKE 157

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 45/109 (41%), Positives = 53/109 (48%), Gaps = 4/109 (3%)
 Frame = +3

Query: 18   VEKPPVYKPPVEKPPVYKP----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
            + + P      EKP    P    PVE  PV + PVE  PV +  VE  PV    VE+ PV
Sbjct: 1311 ISRIPQISVTEEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKSVEAVPVEAALVEEKPV 1370

Query: 186  YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
               P E+ PV   PV + PV   PVE  PV + PVE  PV   PVE  P
Sbjct: 1371 DAAPVEENPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAP 1419

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 41/104 (39%), Positives = 49/104 (47%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV  PPVE+        E  PV + PVE   V   PV++ PV   P E  PV + 
Sbjct: 59  PVEAAPVEAPPVEEKQDEATLAEAAPVEEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEK 118

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 326
           P E  PV + PV   P    PVEK PV   P E   V +   E+
Sbjct: 119 PFEATPVEQKPVEDSPAEVAPVEKKPVEAAPAEAATVKEKSEER 162

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 45/106 (42%), Positives = 53/106 (50%), Gaps = 3/106 (2%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYK 191
            PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE+  V   PVE KP    
Sbjct: 1399 PVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAA 1458

Query: 192  PPAEKPPVYKPPVYKPPVYKPPVEKPPVYK--PPVEKPPVYKPPVE 323
            P  EK PV   PV  PP  + P E+         +EKP +    VE
Sbjct: 1459 PVEEK-PVDAAPVETPPSERKPEERKEADSEIKKIEKPLLTDVEVE 1503

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 46/151 (30%), Positives = 56/151 (37%), Gaps = 50/151 (33%)
 Frame = +3

Query: 21   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP- 197
            E+ PV   PVE+ PV   PVE+  V   PVE+ P    PVE+ PV   PVE PP  + P 
Sbjct: 1211 EEKPVEAAPVEEKPVEAAPVEEKQVDAAPVEEKPGEAAPVEEKPVDAAPVETPPSERKPE 1270

Query: 198  -------------------------------------------------AEKPPVYKPPV 230
                                                              E+ PV   PV
Sbjct: 1271 ERKEADSEIKKIETPLLTDVEVXXXXLDLLMESSEFIEGNISRIPQISVTEEKPVEAAPV 1330

Query: 231  YKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
             + PV   PVE+ PV   PVE+  V   PVE
Sbjct: 1331 EEEPVEAAPVEQKPVEAAPVEEKSVEAVPVE 1361

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 30/64 (46%), Positives = 36/64 (56%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE   V + PVE  PV + PVE  PV   PVE+ PV    VE  PV + 
Sbjct: 1544 PVEAAPVERKPVEAALVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVDAAQVEAAPVAEK 1603

Query: 195  PAEK 206
            P E+
Sbjct: 1604 PEER 1607

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 31/71 (43%), Positives = 36/71 (50%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE   V   PV++ PV   P E  PV + P E  PV + PVE  P    PVEK P
Sbjct: 85  VEEKPVEAASVEAAPVKEKPVEDTPAEVAPVEEKPFEATPVEQKPVEDSPAEVAPVEKKP 144

Query: 183 VYKPPAEKPPV 215
           V   PAE   V
Sbjct: 145 VEAAPAEAATV 155

[125][TOP]
>UniRef100_P13983 Extensin n=1 Tax=Nicotiana tabacum RepID=EXTN_TOBAC
          Length = 620

 Score =  100 bits (249), Expect = 5e-20
 Identities = 52/108 (48%), Positives = 53/108 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP+  PP Y PP   PP Y PP   PP Y  P   PP Y PP   PP Y PP   PP 
Sbjct: 399 YSPPLPAPPTYSPP---PPTYSPP---PPTYAQPPPLPPTYSPP---PPAYSPP--PPPT 447

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           Y PP   PP Y PP   PP Y  P   PP Y PP   PP Y PP   P
Sbjct: 448 YSPP---PPTYSPP---PPAYAQPPPPPPTYSPP---PPAYSPPPPSP 486

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 50/109 (45%), Positives = 53/109 (48%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           + PP   PP Y+     PP Y PP+  PP Y PP   PP Y PP   PP Y  P   PP 
Sbjct: 382 FSPP---PPTYEQSPPPPPAYSPPLPAPPTYSPP---PPTYSPP---PPTYAQPPPLPPT 432

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y PP   PP Y PP   PP Y PP   PP Y PP   PP Y  P   PP
Sbjct: 433 YSPP---PPAYSPP--PPPTYSPP---PPTYSPP---PPAYAQPPPPPP 470

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/116 (43%), Positives = 54/116 (46%), Gaps = 11/116 (9%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----------PPVYKPPVEKP 149
           +Y PP   PPVY PP   PP Y PP   PP Y PP              PP Y+     P
Sbjct: 345 IYSPP---PPVYSPP--PPPSYSPP---PPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPP 396

Query: 150 PVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           P Y PP+  PP Y PP   PP Y PP   PP Y  P   PP Y PP   PP Y PP
Sbjct: 397 PAYSPPLPAPPTYSPP---PPTYSPP---PPTYAQPPPLPPTYSPP---PPAYSPP 443

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 47/102 (46%), Positives = 50/102 (49%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           P    PP + PP   PP Y+     PP Y PP+  PP Y PP   PP Y PP   PP Y 
Sbjct: 374 PSSPPPPSFSPP---PPTYEQSPPPPPAYSPPLPAPPTYSPP---PPTYSPP---PPTYA 424

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
            P   PP Y PP   PP Y PP   PP Y PP   PP Y PP
Sbjct: 425 QPPPLPPTYSPP---PPAYSPP--PPPTYSPP---PPTYSPP 458

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/116 (43%), Positives = 53/116 (45%), Gaps = 11/116 (9%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEK-----------PPVYKPPVEKPPVYKPPVEKP 149
           VY PP   PP Y PP   PP Y PP              PP Y+     PP Y PP+  P
Sbjct: 352 VYSPP--PPPSYSPP---PPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPAYSPPLPAP 406

Query: 150 PVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           P Y PP   PP Y PP   PP Y  P   PP Y PP   PP Y PP   PP Y PP
Sbjct: 407 PTYSPP---PPTYSPP---PPTYAQPPPLPPTYSPP---PPAYSPP--PPPTYSPP 451

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 49/110 (44%), Positives = 54/110 (49%), Gaps = 4/110 (3%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP----VEKPPVYKPPVEKPP 182
           P+   P+Y PP   PPVY PP   PP Y PP   PP Y PP       PP + PP   PP
Sbjct: 339 PLPSSPIYSPP---PPVYSPP--PPPSYSPP---PPTYLPPPPPSSPPPPSFSPP---PP 387

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            Y+     PP Y PP+  PP Y PP   PP Y PP   PP Y  P   PP
Sbjct: 388 TYEQSPPPPPAYSPPLPAPPTYSPP---PPTYSPP---PPTYAQPPPLPP 431

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/108 (45%), Positives = 52/108 (48%), Gaps = 4/108 (3%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP   PP Y  P   PP Y PP   PP Y PP   PP Y PP   PP Y PP   PP 
Sbjct: 416 YSPP---PPTYAQPPPLPPTYSPP---PPAYSPP--PPPTYSPP---PPTYSPP---PPA 461

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEK----PPVYKPP 317
           Y  P   PP Y PP   PP Y PP    P+Y PP  +    PP + PP
Sbjct: 462 YAQPPPPPPTYSPP---PPAYSPP-PPSPIYSPPPPQVQPLPPTFSPP 505

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 47/113 (41%), Positives = 52/113 (46%), Gaps = 4/113 (3%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y  P   PP Y PP   PP Y PP   PP Y PP   PP Y PP   PP Y  P   PP 
Sbjct: 423 YAQPPPLPPTYSPP---PPAYSPP--PPPTYSPP---PPTYSPP---PPAYAQPPPPPPT 471

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEK----PPVYKPPVEKPPVYKPPVEKPP 332
           Y PP   PP Y PP    P+Y PP  +    PP + PP  +     PP  + P
Sbjct: 472 YSPP---PPAYSPPP-PSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQP 520

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 48/115 (41%), Positives = 54/115 (46%), Gaps = 13/115 (11%)
 Frame = +3

Query: 12  PPVEKPPVYKPP---VEKPPVYKPPVEKPPVYKP----PV--EKPPVYKPPVEKPPVYKP 164
           PP    P + PP      PP Y PP   PP Y P    P+    PPVY PP   PP Y P
Sbjct: 309 PPPTPTPTFSPPPPAYSPPPTYSPP---PPTYLPLPSSPIYSPPPPVYSPP--PPPSYSP 363

Query: 165 PVEKPPVYKPP----AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           P   PP Y PP    +  PP + PP   PP Y+     PP Y PP+  PP Y PP
Sbjct: 364 P---PPTYLPPPPPSSPPPPSFSPP---PPTYEQSPPPPPAYSPPLPAPPTYSPP 412

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 49/122 (40%), Positives = 55/122 (45%), Gaps = 13/122 (10%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP   PP Y PP   PP Y PP   PP Y PP   PP Y  P   PP Y PP   PP 
Sbjct: 433 YSPP---PPAYSPP--PPPTYSPP---PPTYSPP---PPAYAQPPPPPPTYSPP---PPA 478

Query: 186 YKPPAEKPPVYKPPVYK----PPVYKPPVEK-----PPVYKPPVEKPPVY----KPPVEK 326
           Y PP   P +Y PP  +    PP + PP  +     PP ++ P    P Y     PP   
Sbjct: 479 YSPPPPSP-IYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQPPSPPTFS 537

Query: 327 PP 332
           PP
Sbjct: 538 PP 539

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 51/112 (45%), Positives = 54/112 (48%), Gaps = 8/112 (7%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           Y PP   PP Y PP   P +Y PP   PP Y   PP    P + PP   PP Y P    P
Sbjct: 282 YSPP---PPTYSPPPPSP-IYSPP---PPAYSPSPPPTPTPTFSPP---PPAYSP----P 327

Query: 180 PVYKPPAEKPPVYKP----PVYK--PPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           P Y PP   PP Y P    P+Y   PPVY PP   PP Y PP   PP Y PP
Sbjct: 328 PTYSPP---PPTYLPLPSSPIYSPPPPVYSPP--PPPSYSPP---PPTYLPP 371

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 47/122 (38%), Positives = 55/122 (45%), Gaps = 13/122 (10%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP   PP Y PP   PP Y PP   PP Y  P   PP Y PP   PP Y PP   P +
Sbjct: 440 YSPP--PPPTYSPP---PPTYSPP---PPAYAQPPPPPPTYSPP---PPAYSPPPPSP-I 487

Query: 186 YKPPAEK----PPVYKPPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPP----VEK 326
           Y PP  +    PP + PP  +     PP ++ P    P Y  P   PP + PP    +  
Sbjct: 488 YSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQP-PSPPTFSPPPPRQIHS 546

Query: 327 PP 332
           PP
Sbjct: 547 PP 548

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 51/129 (39%), Positives = 56/129 (43%), Gaps = 19/129 (14%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---- 164
           +Y PP   PP Y P  P    P + PP   PP Y PP    P Y PP   PP Y P    
Sbjct: 297 IYSPP---PPAYSPSPPPTPTPTFSPP---PPAYSPP----PTYSPP---PPTYLPLPSS 343

Query: 165 PV--EKPPVYKPPAEKPPVYKPPVYKPPVYKPP-----------VEKPPVYKPPVEKPPV 305
           P+    PPVY PP   PP Y PP   PP Y PP              PP Y+     PP 
Sbjct: 344 PIYSPPPPVYSPP--PPPSYSPP---PPTYLPPPPPSSPPPPSFSPPPPTYEQSPPPPPA 398

Query: 306 YKPPVEKPP 332
           Y PP+  PP
Sbjct: 399 YSPPLPAPP 407

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 44/109 (40%), Positives = 50/109 (45%), Gaps = 11/109 (10%)
 Frame = +3

Query: 24  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY--KPP 197
           +PP Y PP   PP Y    +  P Y PP   PP Y PP    P+Y PP   PP Y   PP
Sbjct: 261 QPPTYSPP---PPAYAQSPQPSPTYSPP---PPTYSPP-PPSPIYSPP---PPAYSPSPP 310

Query: 198 AEKPPVYKPP---VYKPPVYKP------PVEKPPVYKPPVEKPPVYKPP 317
               P + PP      PP Y P      P+   P+Y PP   PPVY PP
Sbjct: 311 PTPTPTFSPPPPAYSPPPTYSPPPPTYLPLPSSPIYSPP---PPVYSPP 356

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 42/114 (36%), Positives = 51/114 (44%), Gaps = 5/114 (4%)
 Frame = +3

Query: 6   YKPPVEK--PPVYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           + PP  +  PP ++P P+   P       +PP Y PP   PP Y    +  P Y PP   
Sbjct: 232 HAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTYSPP---PPAYAQSPQPSPTYSPP--- 285

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPP 332
           PP Y PP   P +Y PP   PP Y P  P    P + PP   PP Y PP    P
Sbjct: 286 PPTYSPPPPSP-IYSPP---PPAYSPSPPPTPTPTFSPP---PPAYSPPPTYSP 332

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 45/137 (32%), Positives = 55/137 (40%), Gaps = 30/137 (21%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPV-----------YKPPVEK--PPVYKP-PVE-- 143
           P V+ PP Y PP   PP +  P   PP            + PP  +  PP ++P P+   
Sbjct: 196 PQVQPPPTYSPP---PPTHVQPTPSPPSRGHQPQPPTHRHAPPTHRHAPPTHQPSPLRHL 252

Query: 144 --------KPPVYKPPVEKPPVYKPPAEKPPVYKPP--VYKPP----VYKPPVEKPPVYK 281
                   +PP Y PP   PP Y    +  P Y PP   Y PP    +Y PP   PP Y 
Sbjct: 253 PPSPRRQPQPPTYSPP---PPAYAQSPQPSPTYSPPPPTYSPPPPSPIYSPP---PPAYS 306

Query: 282 PPVEKPPVYKPPVEKPP 332
           P    PP   P    PP
Sbjct: 307 P--SPPPTPTPTFSPPP 321

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 44/146 (30%), Positives = 56/146 (38%), Gaps = 37/146 (25%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPPVE 173
           Y PP   PP Y  P   PP Y PP   PP Y PP   P +Y PP  +    PP + PP  
Sbjct: 455 YSPP---PPAYAQPPPPPPTYSPP---PPAYSPPPPSP-IYSPPPPQVQPLPPTFSPPPP 507

Query: 174 K-----PPVYKPPAEKPPVY--------------------KPPVYKP----PVYKPPVEK 266
           +     PP ++ P    P Y                     PP ++P    P Y  P   
Sbjct: 508 RRIHLPPPPHRQPRPPTPTYGQPPSPPTFSPPPPRQIHSPPPPHWQPRTPTPTYGQPPSP 567

Query: 267 PPVYKPPVEK----PPVYKPPVEKPP 332
           P    PP  +    PP ++ P  +PP
Sbjct: 568 PTFSAPPPRQIHSPPPPHRQP--RPP 591

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 43/143 (30%), Positives = 54/143 (37%), Gaps = 37/143 (25%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEK----PPVYKPPVEKPPVYKPP--VEKPPVYKPP------------ 137
           PP  + P   PP       PP Y  P    P+Y P   V+ PP Y PP            
Sbjct: 163 PPSHRRP--SPPSRHGHPPPPTYAQP-PPTPIYSPSPQVQPPPTYSPPPPTHVQPTPSPP 219

Query: 138 ----VEKPPVYK--PPVEK--PPVYKPP-----------AEKPPVYKPPVYKPPVYKPPV 260
                 +PP ++  PP  +  PP ++P              +PP Y PP   PP Y    
Sbjct: 220 SRGHQPQPPTHRHAPPTHRHAPPTHQPSPLRHLPPSPRRQPQPPTYSPP---PPAYAQSP 276

Query: 261 EKPPVYKPPVEKPPVYKPPVEKP 329
           +  P Y PP   PP Y PP   P
Sbjct: 277 QPSPTYSPP---PPTYSPPPPSP 296

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 38/135 (28%), Positives = 49/135 (36%), Gaps = 27/135 (20%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEK----PPVYKPPVEK-----PPVYKPPVEKPPVY----KPPVEK 146
           Y PP   P +Y PP  +    PP + PP  +     PP ++ P    P Y     PP   
Sbjct: 479 YSPPPPSP-IYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQPRPPTPTYGQPPSPPTFS 537

Query: 147 PPVYKPPVEKPPVYKPPAEKPPVY----KPPVYK----------PPVYKPPVEKPPVYKP 284
           PP  +     PP +  P    P Y     PP +           PP ++ P    P Y  
Sbjct: 538 PPPPRQIHSPPPPHWQPRTPTPTYGQPPSPPTFSAPPPRQIHSPPPPHRQPRPPTPTYGQ 597

Query: 285 PVEKPPVYKPPVEKP 329
           P   P  Y PP   P
Sbjct: 598 PPSPPTTYSPPSPPP 612

[126][TOP]
>UniRef100_Q40339 Early nodulin-12B n=1 Tax=Medicago sativa RepID=NO12B_MEDSA
          Length = 113

 Score =  100 bits (248), Expect = 7e-20
 Identities = 44/79 (55%), Positives = 59/79 (74%), Gaps = 1/79 (1%)
 Frame = +3

Query: 30  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKP 209
           P Y+PP  KPPV KP  ++PPV+KPP ++PPV KP  ++PPV+KPP + PPV KPP ++ 
Sbjct: 30  PAYRPPQTKPPVNKPSHKEPPVHKPPHKEPPVNKPRHKEPPVHKPPHKDPPVNKPPQKES 89

Query: 210 PVYKPPVYKPPVYK-PPVE 263
           PV+KPP  +PP +K PP E
Sbjct: 90  PVHKPPRKEPPTHKHPPAE 108

 Score =  100 bits (248), Expect = 7e-20
 Identities = 44/79 (55%), Positives = 59/79 (74%), Gaps = 1/79 (1%)
 Frame = +3

Query: 60  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKP 239
           P Y+PP  KPPV KP  ++PPV+KPP ++PPV KP  ++PPV+KPP + PPV KPP  + 
Sbjct: 30  PAYRPPQTKPPVNKPSHKEPPVHKPPHKEPPVNKPRHKEPPVHKPPHKDPPVNKPPQKES 89

Query: 240 PVYKPPVEKPPVYK-PPVE 293
           PV+KPP ++PP +K PP E
Sbjct: 90  PVHKPPRKEPPTHKHPPAE 108

 Score =  100 bits (248), Expect = 7e-20
 Identities = 44/79 (55%), Positives = 59/79 (74%), Gaps = 1/79 (1%)
 Frame = +3

Query: 90  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKP 269
           P Y+PP  KPPV KP  ++PPV+KPP ++PPV KP  ++PPV+KPP   PPV KPP ++ 
Sbjct: 30  PAYRPPQTKPPVNKPSHKEPPVHKPPHKEPPVNKPRHKEPPVHKPPHKDPPVNKPPQKES 89

Query: 270 PVYKPPVEKPPVYK-PPVE 323
           PV+KPP ++PP +K PP E
Sbjct: 90  PVHKPPRKEPPTHKHPPAE 108

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 41/74 (55%), Positives = 57/74 (77%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y+PP  KPPV KP  ++PPV+KPP ++PPV KP  ++PPV+KPP + PPV KPP ++ PV
Sbjct: 32  YRPPQTKPPVNKPSHKEPPVHKPPHKEPPVNKPRHKEPPVHKPPHKDPPVNKPPQKESPV 91

Query: 186 YKPPAEKPPVYKPP 227
           +KPP ++PP +K P
Sbjct: 92  HKPPRKEPPTHKHP 105

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 40/71 (56%), Positives = 54/71 (76%)
 Frame = +3

Query: 120 PVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP 299
           P Y+PP  KPPV KP  ++PPV+KPP ++PPV KP   +PPV+KPP + PPV KPP ++ 
Sbjct: 30  PAYRPPQTKPPVNKPSHKEPPVHKPPHKEPPVNKPRHKEPPVHKPPHKDPPVNKPPQKES 89

Query: 300 PVYKPPVEKPP 332
           PV+KPP ++PP
Sbjct: 90  PVHKPPRKEPP 100

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 40/71 (56%), Positives = 53/71 (74%), Gaps = 6/71 (8%)
 Frame = +3

Query: 9   KPPVEKP-----PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           KPPV KP     PV+KPP ++PPV KP  ++PPV+KPP + PPV KPP ++ PV+KPP +
Sbjct: 38  KPPVNKPSHKEPPVHKPPHKEPPVNKPRHKEPPVHKPPHKDPPVNKPPQKESPVHKPPRK 97

Query: 174 KPPVYK-PPAE 203
           +PP +K PPAE
Sbjct: 98  EPPTHKHPPAE 108

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 32/58 (55%), Positives = 45/58 (77%), Gaps = 1/58 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-PPVE 173
           V+KPP ++PPV KP  ++PPV+KPP + PPV KPP ++ PV+KPP ++PP +K PP E
Sbjct: 51  VHKPPHKEPPVNKPRHKEPPVHKPPHKDPPVNKPPQKESPVHKPPRKEPPTHKHPPAE 108

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 32/59 (54%), Positives = 37/59 (62%)
 Frame = +3

Query: 156 YKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y  P  +PP  KPP  KP   +PPV+KPP  +PPV KP   +PPV KPP   PPV KPP
Sbjct: 27  YLNPAYRPPQTKPPVNKPSHKEPPVHKPPHKEPPVNKPRHKEPPVHKPPHKDPPVNKPP 85

[127][TOP]
>UniRef100_C6TFZ1 Putative uncharacterized protein (Fragment) n=1 Tax=Glycine max
           RepID=C6TFZ1_SOYBN
          Length = 229

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 44/93 (47%), Positives = 52/93 (55%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP +  P   P     PV KPPV  PP+ KPPV  PP+  PPV  PP+  PPV  PP+ 
Sbjct: 31  KPPKKHKPGKTPKTPTVPVVKPPVTIPPIVKPPVTIPPIVNPPVTIPPIVNPPVTIPPIV 90

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPP 287
            PP   PPV  PP+ KPP + PP+  PP    P
Sbjct: 91  NPPVTVPPVVLPPIVKPPGFLPPILNPPSTPTP 123

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 44/93 (47%), Positives = 52/93 (55%)
 Frame = +3

Query: 39  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVY 218
           KPP +  P   P     PV KPPV  PP+ KPPV  PP+  PPV  PP+  PP   PP+ 
Sbjct: 31  KPPKKHKPGKTPKTPTVPVVKPPVTIPPIVKPPVTIPPIVNPPVTIPPIVNPPVTIPPIV 90

Query: 219 KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
            PPV  PPV  PP+ KPP + PP+  PP    P
Sbjct: 91  NPPVTVPPVVLPPIVKPPGFLPPILNPPSTPTP 123

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 43/88 (48%), Positives = 51/88 (57%)
 Frame = +3

Query: 69  KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVY 248
           KPP +  P   P     PV KPPV  PP+ KPPV  PP+  PP   PP+  PPV  PP+ 
Sbjct: 31  KPPKKHKPGKTPKTPTVPVVKPPVTIPPIVKPPVTIPPIVNPPVTIPPIVNPPVTIPPIV 90

Query: 249 KPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PPV  PPV  PP+ KPP + PP+  PP
Sbjct: 91  NPPVTVPPVVLPPIVKPPGFLPPILNPP 118

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 45/93 (48%), Positives = 51/93 (54%)
 Frame = +3

Query: 24  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAE 203
           KPP    P + P     PV KPPV  PP+ KPPV  PP+  PPV  PP+  PPV  PP  
Sbjct: 31  KPPKKHKPGKTPKTPTVPVVKPPVTIPPIVKPPVTIPPIVNPPVTIPPIVNPPVTIPPIV 90

Query: 204 KPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP 302
            PPV  PPV  PP+ KPP   PP+  PP    P
Sbjct: 91  NPPVTVPPVVLPPIVKPPGFLPPILNPPSTPTP 123

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 45/93 (48%), Positives = 51/93 (54%)
 Frame = +3

Query: 54  KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVY 233
           KPP    P + P     PV KPPV  PP+ KPPV  PP+  PPV  PP   PPV  PP+ 
Sbjct: 31  KPPKKHKPGKTPKTPTVPVVKPPVTIPPIVKPPVTIPPIVNPPVTIPPIVNPPVTIPPIV 90

Query: 234 KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PPV  PPV  PP+ KPP   PP+  PP    P
Sbjct: 91  NPPVTVPPVVLPPIVKPPGFLPPILNPPSTPTP 123

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 39/75 (52%), Positives = 45/75 (60%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V KPPV  PP+ KPPV  PP+  PPV  PP+  PPV  PP+  PPV  PPV  PP+ KPP
Sbjct: 49  VVKPPVTIPPIVKPPVTIPPIVNPPVTIPPIVNPPVTIPPIVNPPVTVPPVVLPPIVKPP 108

Query: 183 VYKPPAEKPPVYKPP 227
            + PP   PP    P
Sbjct: 109 GFLPPILNPPSTPTP 123

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 32/66 (48%), Positives = 40/66 (60%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           + KPPV  PP+  PPV  PP+  PPV  PP+  PPV  PPV  PP+ KPP + PP+  PP
Sbjct: 59  IVKPPVTIPPIVNPPVTIPPIVNPPVTIPPIVNPPVTVPPVVLPPIVKPPGFLPPILNPP 118

Query: 183 VYKPPA 200
               P+
Sbjct: 119 STPTPS 124

[128][TOP]
>UniRef100_Q25460 Adhesive plaque matrix protein (Fragment) n=1 Tax=Mytilus edulis
           RepID=FP1_MYTED
          Length = 875

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 47/102 (46%), Positives = 50/102 (49%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y      PPVYKP +  PP YKP    PP YK      P YKP +  PP YK     P  
Sbjct: 65  YNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYK----SKPTYKPKITYPPTYKAKPSYPSS 120

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
           YKP    PP YKP +  PP YKP    PP YKP    PP YK
Sbjct: 121 YKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPPSYK 162

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 50/116 (43%), Positives = 53/116 (45%), Gaps = 6/116 (5%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYK------PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 164
           VYKP +  PP YKP    PP YK      P +  PP YK     P  YKP    PP YKP
Sbjct: 74  VYKPKMTYPPTYKPKPSYPPTYKSKPTYKPKITYPPTYKAKPSYPSSYKPKKTYPPTYKP 133

Query: 165 PVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP YKP    PP YKP    PP YK     P  YK     PP YK     PP
Sbjct: 134 KLTYPPTYKPKPSYPPTYKPKPSYPPSYKTKKTYPSSYKAKPSYPPTYKAKPSYPP 189

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 50/116 (43%), Positives = 54/116 (46%), Gaps = 7/116 (6%)
 Frame = +3

Query: 6   YKPPVEKPPVYKP-------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 164
           Y P  +K   YKP           PPVYKP +  PP YKP    PP YK      P YKP
Sbjct: 48  YLPLAKKLSSYKPIKTTYNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYK----SKPTYKP 103

Query: 165 PVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            +  PP YK     P  YKP    PP YKP +  PP YKP    PP YKP    PP
Sbjct: 104 KITYPPTYKAKPSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPP 159

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 46/109 (42%), Positives = 49/109 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y P  +  P YKP +  PP YK     P  YKP    PP YKP +  PP YKP    PP 
Sbjct: 91  YPPTYKSKPTYKPKITYPPTYKAKPSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPT 150

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YK     P  YK     PP YK     PP YK     PP
Sbjct: 151 YKPKPSYPPSYKTKKTYPSSYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 199

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 45/108 (41%), Positives = 48/108 (44%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
            YK     PP YK     PP YKP    PP YK     P  YKP    PP YKP +  PP 
Sbjct: 749  YKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSIYPSSYKPKKTYPPTYKPKLTYPPT 808

Query: 186  YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            YKP    PP YKP +  P  YK     PP YK     PP Y   +  P
Sbjct: 809  YKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTSYPPTYNKKISYP 856

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 45/102 (44%), Positives = 47/102 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +  PP YK     P  YKP    PP YKP +  PP YKP    PP YKP    PP 
Sbjct: 101 YKPKITYPPTYKAKPSYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPPS 160

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
           YK     P  YK     PP YK     PP YK     PP YK
Sbjct: 161 YKTKKTYPSSYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 202

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 46/109 (42%), Positives = 47/109 (43%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     P  YKP    PP YKP +   P YKP    PP YKP    PP 
Sbjct: 475 YKAKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPT 534

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YK     P  YK     PP YK     PP YK     PP
Sbjct: 535 YKPKISYPPTYKAKPSYPATYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 583

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 44/103 (42%), Positives = 47/103 (45%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
            YKP    PP YK     P  YKP    PP YKP +  PP YKP    PP YKP +  P  
Sbjct: 769  YKPKPSYPPTYKSKSIYPSSYKPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPKITYPST 828

Query: 186  YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
            YK     PP YK     PP Y   +  P  YK     PP YKP
Sbjct: 829  YKLKPSYPPTYKSKTSYPPTYNKKISYPSSYKAKTSYPPAYKP 871

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 44/102 (43%), Positives = 46/102 (45%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YKP    PP YKP +   P YKP    PP YKP    PP YKP +  PP 
Sbjct: 485 YKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPT 544

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
           YK     P  YK     PP YK     PP YK     PP YK
Sbjct: 545 YKAKPSYPATYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYK 586

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 49/125 (39%), Positives = 51/125 (40%), Gaps = 16/125 (12%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP +   P YKP    PP YKP    PP YKP +  PP YK     P  YK     PP 
Sbjct: 505 YKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPSYPATYKAKPSYPPT 564

Query: 186 YKPPAEKPPVYK-----PPVYK-----------PPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           YK     PP YK     PP YK           P  YK     PP YK     PP YK  
Sbjct: 565 YKAKPSYPPTYKAKPSYPPTYKAKPSYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAK 624

Query: 318 VEKPP 332
              PP
Sbjct: 625 PSYPP 629

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 45/109 (41%), Positives = 47/109 (43%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YK     PP YK     P  YKP    PP YKP +   P YKP    PP 
Sbjct: 465 YKAKPSYPASYKAKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPPS 524

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP +  PP YK     P  YK     PP YK     PP
Sbjct: 525 YKPKTTYPPTYKPKISYPPTYKAKPSYPATYKAKPSYPPTYKAKPSYPP 573

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 45/109 (41%), Positives = 47/109 (43%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
            Y    +  P YK     PP YK     PP YKP    PP YK     P  YKP    PP 
Sbjct: 739  YPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSIYPSSYKPKKTYPPT 798

Query: 186  YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            YKP    PP YKP    PP YKP +  P  YK     PP YK     PP
Sbjct: 799  YKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPPTYKSKTSYPP 847

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 44/108 (40%), Positives = 48/108 (44%)
 Frame = +3

Query: 9    KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
            KP  +  P Y    +  P YK     PP YK     PP YKP    PP YK     P  Y
Sbjct: 730  KPTYKAKPTYPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSIYPSSY 789

Query: 189  KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            KP    PP YKP +  PP YKP    PP YKP +  P  YK     PP
Sbjct: 790  KPKKTYPPTYKPKLTYPPTYKPKPSYPPSYKPKITYPSTYKLKPSYPP 837

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 47/108 (43%), Positives = 48/108 (44%), Gaps = 6/108 (5%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YKP    PP YKP +  PP YKP    PP YKP    PP YK     P  YK     PP 
Sbjct: 121 YKPKKTYPPTYKPKLTYPPTYKPKPSYPPTYKPKPSYPPSYKTKKTYPSSYKAKPSYPPT 180

Query: 186 YKPPAEKPPVYK-----PPVYKP-PVYKPPVEKPPVYKPPVEKPPVYK 311
           YK     PP YK     PP YK  P YK     P  YK     PP YK
Sbjct: 181 YKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYK 228

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/109 (39%), Positives = 47/109 (43%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y P  +  P Y P  +  P YK     P  YK     P  YK     PP YK     P  
Sbjct: 435 YPPSYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPASYKAKPSYPPTYKSKSSYPSS 494

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP +   P YKP    PP YKP    PP YKP +  PP
Sbjct: 495 YKPKKTYPPTYKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPP 543

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/109 (40%), Positives = 46/109 (42%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     P  YK     P  YK     PP YK     P  YKP    PP YKP +   P 
Sbjct: 455 YKAKPTYPSTYKAKPSYPASYKAKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPT 514

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YKP    PP YKP    PP YKP +  PP YK     P  YK     PP
Sbjct: 515 YKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPSYPATYKAKPSYPP 563

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 43/108 (39%), Positives = 45/108 (41%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y P  +  P YK     P  YK     P  YK     PP YK     P  YKP    PP 
Sbjct: 445 YPPTYKAKPTYKAKPTYPSTYKAKPSYPASYKAKPSYPPTYKSKSSYPSSYKPKKTYPPT 504

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           YKP     P YKP    PP YKP    PP YKP +  PP YK     P
Sbjct: 505 YKPKLTYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPSYP 552

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 46/115 (40%), Positives = 47/115 (40%), Gaps = 6/115 (5%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YK     PP YK     P  YK     PP YKP +  PP 
Sbjct: 601 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKPKISYPPT 660

Query: 186 YKPPAEKPPVYK-----PPVYKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YK     PP YK  P YK     P  YK     PP YK     PP
Sbjct: 661 YKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTNPSTYKAKPSYPPTYKAKPSYPP 715

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 53/155 (34%), Positives = 55/155 (35%), Gaps = 46/155 (29%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK-----PPV 170
           YKP    PP YKP +  PP YK     P  YK     PP YK     PP YK     PP 
Sbjct: 525 YKPKTTYPPTYKPKISYPPTYKAKPSYPATYKAKPSYPPTYKAKPSYPPTYKAKPSYPPT 584

Query: 171 EK---------------------PPVYKPPAEKPPVYK-----PPVYK------------ 236
            K                     PP YK     PP YK     PP YK            
Sbjct: 585 YKAKPSYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAK 644

Query: 237 ---PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              PP YKP +  PP YK     PP YK     PP
Sbjct: 645 PSYPPTYKPKISYPPTYKAKPSYPPTYKAKPSYPP 679

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 46/115 (40%), Positives = 47/115 (40%), Gaps = 6/115 (5%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK     PP YK     PP YK     P  YK     PP YKP +  PP YK     PP 
Sbjct: 611 YKAKPSYPPTYKAKPSYPPTYKAKPTYPSTYKAKPSYPPTYKPKISYPPTYKAKPSYPPT 670

Query: 186 YKPPAEKPPVYKP-PVYK-----PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YK  P YK     P  YK     PP YK     PP YK     PP
Sbjct: 671 YKAKPSYPPTYKAKPTYKAKPTNPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 725

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 40/102 (39%), Positives = 42/102 (41%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y P  +  P YK     P  YK     PP YK     PP YK     PP YK     P  
Sbjct: 581 YPPTYKAKPSYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYPST 640

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
           YK     PP YKP +  PP YK     PP YK     PP YK
Sbjct: 641 YKAKPSYPPTYKPKISYPPTYKAKPSYPPTYKAKPSYPPTYK 682

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 47/119 (39%), Positives = 51/119 (42%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEK----PPVYKPPVEKPPVYKPPVEKPPVYKPPVE 173
           YKP    PP YKP +     YKP  +     PP YKP    PP YKP +  PP YK    
Sbjct: 495 YKPKKTYPPTYKPKL----TYKPTYKPKPSYPPSYKPKTTYPPTYKPKISYPPTYKAKPS 550

Query: 174 KPPVYKPPAEKPPVYK-----PPVYK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P  YK     PP YK     PP YK  P Y P  +  P YK     P  YK     PP
Sbjct: 551 YPATYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYKAKPTYPSTYKAKPSYPP 609

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 43/107 (40%), Positives = 44/107 (41%), Gaps = 6/107 (5%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KP  +  P YK     PP YK     PP YK     PP YK     PP YK     PP Y
Sbjct: 272 KPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTY 331

Query: 189 KPPAEKPPVYKP-PVYK-----PPVYKPPVEKPPVYKPPVEKPPVYK 311
           K     PP YK  P YK     P  YK     PP YK     PP YK
Sbjct: 332 KAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYK 378

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 48/121 (39%), Positives = 48/121 (39%), Gaps = 12/121 (9%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP-PVEK-- 176
           YK     PP YK     PP YK     PP YK     PP YK     PP YK  P  K  
Sbjct: 291 YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAK 350

Query: 177 ---PPVYKPPAEKPPVYK-----PPVYK-PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
              P  YK     PP YK     PP YK  P YK     PP YK     PP YK     P
Sbjct: 351 PTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYP 410

Query: 330 P 332
           P
Sbjct: 411 P 411

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 45/117 (38%), Positives = 47/117 (40%), Gaps = 8/117 (6%)
 Frame = +3

Query: 6   YKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           Y P  +  P YK  P  +  P YK     PP YK     PP YK     PP YK     P
Sbjct: 259 YPPTYKAKPTYKAKPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPSYP 318

Query: 180 PVYKPPAEKPPVYK-----PPVYKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P YK     PP YK     PP YK  P YK     P  YK     PP YK     PP
Sbjct: 319 PTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPP 375

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 50/141 (35%), Positives = 51/141 (36%), Gaps = 32/141 (22%)
 Frame = +3

Query: 6    YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
            YK     PP YKP +  PP YK     PP YK     PP YK      P YK     P  
Sbjct: 641  YKAKPSYPPTYKPKISYPPTYKAKPSYPPTYKAKPSYPPTYKAK----PTYKAKPTNPST 696

Query: 186  YKPPAEKPPVYK-----PPVYK-----PPVYK-PPVEK---------------------P 269
            YK     PP YK     PP YK     PP YK  P  K                     P
Sbjct: 697  YKAKPSYPPTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPTYKAKPTYP 756

Query: 270  PVYKPPVEKPPVYKPPVEKPP 332
            P YK     PP YKP    PP
Sbjct: 757  PTYKAKPSYPPTYKPKPSYPP 777

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 38/108 (35%), Positives = 43/108 (39%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KP  +  P Y    +  P Y P  +  P Y P  +  P YK     P  YK     P  Y
Sbjct: 416 KPTYKAKPTYPSTYKAKPSYPPSYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPASY 475

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           K     PP YK     P  YKP    PP YKP +   P YKP    PP
Sbjct: 476 KAKPSYPPTYKSKSSYPSSYKPKKTYPPTYKPKLTYKPTYKPKPSYPP 523

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 43/119 (36%), Positives = 46/119 (38%), Gaps = 10/119 (8%)
 Frame = +3

Query: 6   YKPPVEKPPVYK--PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           YK     PP YK  P  +  P Y    +  P Y P  +  P YK     PP YK     P
Sbjct: 191 YKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKPSYP 250

Query: 180 PVYKPPAEKPPVYK-PPVYK-------PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P YK     PP YK  P YK        P YK     PP YK     PP YK     PP
Sbjct: 251 PTYKAKPSYPPTYKAKPTYKAKPTYKAKPTYKAKPSYPPTYKAKPSYPPTYKAKPSYPP 309

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/115 (37%), Positives = 44/115 (38%), Gaps = 6/115 (5%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y P  +  P YK     P  YK     PP YK     PP YK      P YK     PP 
Sbjct: 337 YPPTYKAKPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAK----PTYKAKPSYPPT 392

Query: 186 YKPPAEKPPVYK-----PPVYKP-PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           YK     PP YK     PP YK  P YK     P  YK     PP YK     PP
Sbjct: 393 YKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPSYKAKPSYPP 447

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 39/107 (36%), Positives = 43/107 (40%), Gaps = 6/107 (5%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KP  +  P Y    +  P Y P  +  P Y P  +  P YK     PP YK     PP Y
Sbjct: 344 KPTYKAKPTYPSTYKAKPSYPPTYKAKPSYPPTYKAKPTYKAKPSYPPTYKAKPSYPPTY 403

Query: 189 KPPAEKPPVYK-PPVYK-----PPVYKPPVEKPPVYKPPVEKPPVYK 311
           K     PP YK  P YK     P  YK     PP YK     PP YK
Sbjct: 404 KAKPSYPPTYKAKPTYKAKPTYPSTYKAKPSYPPSYKAKPSYPPTYK 450

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 42/110 (38%), Positives = 50/110 (45%), Gaps = 19/110 (17%)
 Frame = +3

Query: 60  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV------YKPPAEKPPVYK 221
           PVYKP       Y  P  KPP Y+P ++K   Y+P    PP       Y P A+K   YK
Sbjct: 5   PVYKPVKTS---YSAPY-KPPTYQP-LKKKVDYRPTKSYPPTYGSKTNYLPLAKKLSSYK 59

Query: 222 ------------PPVYKPPVYKPPVEKP-PVYKPPVEKPPVYKPPVEKPP 332
                       PPVYKP +  PP  KP P Y P  +  P YKP +  PP
Sbjct: 60  PIKTTYNAKTNYPPVYKPKMTYPPTYKPKPSYPPTYKSKPTYKPKITYPP 109

[129][TOP]
>UniRef100_Q9XIL9 Putative uncharacterized protein At2g15880 n=1 Tax=Arabidopsis
           thaliana RepID=Q9XIL9_ARATH
          Length = 727

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 60/113 (53%), Positives = 68/113 (60%), Gaps = 3/113 (2%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PP
Sbjct: 577 VHSPP---PPVYSPP--PPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP-PPPP 621

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPP 332
           V+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPVY    PPV+ PP
Sbjct: 622 VHSPP---PPVFSPP---PPVHSPP---PPVYSPP---PPVYSPPPPPVKSPP 662

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 60/112 (53%), Positives = 67/112 (59%), Gaps = 2/112 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY PP   PPVY PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PP
Sbjct: 515 VYSPP-PPPPVYSPP-PPPPVYSPP-PPPPVHSPP---PPVHSPP---PPVHSPP---PP 562

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPP 332
           V+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+   PPV  PP
Sbjct: 563 VHSPP---PPVHSPP---PPVHSPP---PPVYSPP--PPPVHSPPPPVHSPP 603

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 59/113 (52%), Positives = 66/113 (58%), Gaps = 4/113 (3%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PP
Sbjct: 584 VYSPP--PPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP-PPPPVHSPP---PP 628

Query: 183 VYKPP----AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           V+ PP    +  PPVY PP   PPVY PP   PPV  PP   PPVY PP+  P
Sbjct: 629 VFSPPPPVHSPPPPVYSPP---PPVYSPP--PPPVKSPP--PPPVYSPPLLPP 674

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 59/113 (52%), Positives = 67/113 (59%), Gaps = 3/113 (2%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           ++ PP   PPVY PP   PPVY PP   PPVY PP   PPV+ PP   PPV+ PP   PP
Sbjct: 507 IHSPP--PPPVYSPP-PPPPVYSPP-PPPPVYSPP-PPPPVHSPP---PPVHSPP---PP 555

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPP 332
           V+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY    PPV  PP
Sbjct: 556 VHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPPPPPVHSPP 596

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 56/109 (51%), Positives = 64/109 (58%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PP
Sbjct: 599 VHSPP---PPVHSPP---PPVYSPP-PPPPVHSPP---PPVFSPP---PPVHSPP---PP 642

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           VY PP   PPVY PP   PPV  PP   PPVY PP+  P +  PP + P
Sbjct: 643 VYSPP---PPVYSPP--PPPVKSPP--PPPVYSPPLLPPKMSSPPTQTP 684

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 59/112 (52%), Positives = 67/112 (59%), Gaps = 2/112 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PP
Sbjct: 524 VYSPP-PPPPVYSPP-PPPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PP 569

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPP 332
           V+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+   PPV  PP
Sbjct: 570 VHSPP---PPVHSPP---PPVYSPP--PPPVHSPP---PPVHSPPPPVHSPP 610

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 58/112 (51%), Positives = 67/112 (59%), Gaps = 2/112 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPV+ PP   PP
Sbjct: 556 VHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVYSPP--PPPVHSPP---PP 598

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPP 332
           V+ PP   PPV+ PP   PPVY PP   PPV+ PP   PPV+   PPV  PP
Sbjct: 599 VHSPP---PPVHSPP---PPVYSPP-PPPPVHSPP---PPVFSPPPPVHSPP 640

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 56/109 (51%), Positives = 65/109 (59%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+ PP   PP
Sbjct: 542 VHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PPVHSPP---PP 583

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           VY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   P
Sbjct: 584 VYSPP--PPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPPPPPP 621

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 55/109 (50%), Positives = 62/109 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+ PP   PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PP
Sbjct: 606 VHSPP---PPVYSPP-PPPPVHSPP---PPVFSPP---PPVHSPP---PPVYSPP---PP 649

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           VY PP   PPV  PP   PPVY PP+  P +  PP + P V  PP   P
Sbjct: 650 VYSPPP--PPVKSPP--PPPVYSPPLLPPKMSSPPTQTP-VNSPPPRTP 693

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 54/110 (49%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           VY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PPVY PP   PP
Sbjct: 613 VYSPP-PPPPVHSPP---PPVFSPP---PPVHSPP---PPVYSPP---PPVYSPP--PPP 657

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V  PP   PPVY PP+  P +  PP + P V  PP   P      VE PP
Sbjct: 658 VKSPPP--PPVYSPPLLPPKMSSPPTQTP-VNSPPPRTP---SQTVEAPP 701

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 52/117 (44%), Positives = 61/117 (52%), Gaps = 9/117 (7%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-------PPVYKPPVEKPPVYKPP 167
           +PP E P    P  + P  ++     PPV+ PP          PPVY PP   PPVY PP
Sbjct: 470 QPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPP-PPPPVYSPP 528

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPP 332
              PPVY PP   PPV+ PP   PPV+ PP   PPV+ PP   PPV+   PPV  PP
Sbjct: 529 -PPPPVYSPP-PPPPVHSPP---PPVHSPP---PPVHSPP---PPVHSPPPPVHSPP 574

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 46/110 (41%), Positives = 54/110 (49%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+ PP   PPV+ PP   PPVY PP   PPVY PP   PPV  PP   PPVY PP+  P 
Sbjct: 629 VFSPP---PPVHSPP---PPVYSPP---PPVYSPP--PPPVKSPP--PPPVYSPPLLPPK 675

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           +  PP +  PV  PP   P      VE PP  +  +  P +       PP
Sbjct: 676 MSSPPTQ-TPVNSPP---PRTPSQTVEAPPPSEEFIIPPFIGHQYASPPP 721

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 45/116 (38%), Positives = 55/116 (47%), Gaps = 10/116 (8%)
 Frame = +3

Query: 12  PPVEKPP---VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           PP ++P    V+ PP    P   PPV   P    PV KP   +PP E P    P  + P 
Sbjct: 434 PPPQQPHHHVVHSPPPASSPPTSPPVHSTP---SPVHKP---QPPKESPQPNDPYDQSPV 487

Query: 183 VYKPPAEKPPVYKPP----VYK---PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            ++     PPV+ PP    ++    PPVY PP   PPVY PP   PPVY PP   P
Sbjct: 488 KFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPP-PPPPVYSPP-PPPPVYSPPPPPP 541

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 39/103 (37%), Positives = 47/103 (45%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+ PP   PPVY PP   PPVY PP   PPV  PP   PPVY PP+  P +  PP + P 
Sbjct: 636 VHSPP---PPVYSPP---PPVYSPP--PPPVKSPP--PPPVYSPPLLPPKMSSPPTQTPV 685

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK 311
              PP       + P        PP        PP   PP+++
Sbjct: 686 NSPPPRTPSQTVEAPPPSEEFIIPPFIGHQYASPP---PPMFQ 725

[130][TOP]
>UniRef100_Q9SET1 Cell wall-plasma membrane linker protein homolog n=1
           Tax=Arabidopsis thaliana RepID=Q9SET1_ARATH
          Length = 306

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 54/131 (41%), Positives = 56/131 (42%), Gaps = 23/131 (17%)
 Frame = +3

Query: 9   KPPVEKPPVYKPP------------VEKPPVYKPP--VEKPPVYKP---------PVEKP 119
           KPP+ KPP   PP              KP   KPP    KPP +KP         P   P
Sbjct: 85  KPPIVKPPTKPPPSTPKPPTKPSPSTPKPSTTKPPPSTPKPPHHKPSPTPCPPPTPTPTP 144

Query: 120 PVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKP 299
           PV  PP    PV  PP   PPV  P    PPV  PP   PPV  PP   PPV  PP   P
Sbjct: 145 PVVTPPTPTHPVITPPTPTPPVVTPATPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTP 204

Query: 300 PVYKPPVEKPP 332
           PV  PP   PP
Sbjct: 205 PVVTPPTPTPP 215

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 58/145 (40%), Positives = 62/145 (42%), Gaps = 37/145 (25%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP---------PVEKPPVYKPPVEKPP-VY 158
           KPP  KPP  KPP  KPP  KPP  KPP  KP         P  KPP+ KPP + PP   
Sbjct: 45  KPP--KPPAVKPP--KPPAVKPPTPKPPTVKPHPKPPTKPHPHPKPPIVKPPTKPPPSTP 100

Query: 159 KPPVE------------------KPPVYKP---------PAEKPPVYKPPVYKPPVYKPP 257
           KPP +                  KPP +KP         P   PPV  PP    PV  PP
Sbjct: 101 KPPTKPSPSTPKPSTTKPPPSTPKPPHHKPSPTPCPPPTPTPTPPVVTPPTPTHPVITPP 160

Query: 258 VEKPPVYKPPVEKPPVYKPPVEKPP 332
              PPV  P    PPV  PP   PP
Sbjct: 161 TPTPPVVTPATPTPPVITPPTPTPP 185

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/111 (43%), Positives = 49/111 (44%), Gaps = 9/111 (8%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKP---------PVEKPPVYKPPVEKPPVYKPPVEKPPVYK 161
           KP   KPP   P   KPP +KP         P   PPV  PP    PV  PP   PPV  
Sbjct: 112 KPSTTKPP---PSTPKPPHHKPSPTPCPPPTPTPTPPVVTPPTPTHPVITPPTPTPPVVT 168

Query: 162 PPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKP 314
           P    PPV  PP   PPV  PP   PPV  PP   PPV  PP   PP   P
Sbjct: 169 PATPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIP 219

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 60/133 (45%), Positives = 65/133 (48%), Gaps = 24/133 (18%)
 Frame = +3

Query: 6   YKPPVE--KPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP---PVYKP-PVEKPPVYKPP 167
           +KPP    KPP  KPP  KPP  KPP  KPP  KPP  KP   P  KP P  KPP+ KPP
Sbjct: 37  HKPPKHPVKPP--KPPAVKPP--KPPAVKPPTPKPPTVKPHPKPPTKPHPHPKPPIVKPP 92

Query: 168 VEKPP-VYKPPAE------KPPVYKPP--VYKPPVYKP---------PVEKPPVYKPPVE 293
            + PP   KPP +      KP   KPP    KPP +KP         P   PPV  PP  
Sbjct: 93  TKPPPSTPKPPTKPSPSTPKPSTTKPPPSTPKPPHHKPSPTPCPPPTPTPTPPVVTPPTP 152

Query: 294 KPPVYKPPVEKPP 332
             PV  PP   PP
Sbjct: 153 THPVITPPTPTPP 165

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 55/110 (50%), Positives = 58/110 (52%), Gaps = 4/110 (3%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP   P  +KPP  K PV KPP  KPP  KPP  KPP  KPP  KPP  KP   KPP   
Sbjct: 29  PPKPSPAPHKPP--KHPV-KPP--KPPAVKPP--KPPAVKPPTPKPPTVKPH-PKPPTKP 80

Query: 192 PPAEKPPVYKPPVYKPP-VYKPPVE-KPPVYKPPVEKPP--VYKPPVEKP 329
            P  KPP+ KPP   PP   KPP +  P   KP   KPP    KPP  KP
Sbjct: 81  HPHPKPPIVKPPTKPPPSTPKPPTKPSPSTPKPSTTKPPPSTPKPPHHKP 130

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 34/74 (45%), Positives = 34/74 (45%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V  PP    PV  PP   PPV  P    PPV  PP   PPV  PP   PPV  PP   PP
Sbjct: 146 VVTPPTPTHPVITPPTPTPPVVTPATPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPP 205

Query: 183 VYKPPAEKPPVYKP 224
           V  PP   PP   P
Sbjct: 206 VVTPPTPTPPTPIP 219

[131][TOP]
>UniRef100_UPI0000DA3CA7 PREDICTED: hypothetical protein n=1 Tax=Rattus norvegicus
           RepID=UPI0000DA3CA7
          Length = 165

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 44/108 (40%), Positives = 74/108 (68%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           GG  +GG+ +GG S+G + + G  +GGL +GG+ +GG+  GG S+GG+ +GG  +G + +
Sbjct: 29  GGVGSGGMASGGLSSGVMGSRGMGSGGLGSGGMGSGGVGNGGLSSGGMGSGGMGSGDMGS 88

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL 8
           G   +GG+ + G ++GGL +GG  +GG+ +GG S+G + +GG  +GGL
Sbjct: 89  GDMDSGGMGSEGMASGGLSSGGMDSGGMGSGGLSSGDMSSGGLGSGGL 136

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 44/107 (41%), Positives = 72/107 (67%)
 Frame = -2

Query: 328 GFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYTG 149
           G  +GG+ +GG ++GGL +G   + G+ +GGL +GG+ +GG   GGL +GG  +GG+ +G
Sbjct: 25  GVGSGGVGSGGMASGGLSSGVMGSRGMGSGGLGSGGMGSGGVGNGGLSSGGMGSGGMGSG 84

Query: 148 GFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL 8
              +G + +GG  + G+ +GG S+GG+ +GG  +GGL +G  S+GGL
Sbjct: 85  DMGSGDMDSGGMGSEGMASGGLSSGGMDSGGMGSGGLSSGDMSSGGL 131

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 43/108 (39%), Positives = 72/108 (66%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           GG ++GGL +G   + G+ +GG  +GG+ +GG+  GGL +GG  +GG+ +G   +G + +
Sbjct: 34  GGMASGGLSSGVMGSRGMGSGGLGSGGMGSGGVGNGGLSSGGMGSGGMGSGDMGSGDMDS 93

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL 8
           GG  + G+ +GG S+GG+ +GG  +GGL +G  S+GGL +GG  +G +
Sbjct: 94  GGMGSEGMASGGLSSGGMDSGGMGSGGLSSGDMSSGGLGSGGLGSGDM 141

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 40/108 (37%), Positives = 70/108 (64%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   + G+ + G  +GG+ +GG ++GGL +G + + G+ +GG  +GG+ +GG   GGL +
Sbjct: 14  GVMGSRGMGSRGVGSGGVGSGGMASGGLSSGVMGSRGMGSGGLGSGGMGSGGVGNGGLSS 73

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL 8
           GG  +GG+ +G   +G + +GG  + G+ +GG S+GG+ +GG  +GGL
Sbjct: 74  GGMGSGGMGSGDMGSGDMDSGGMGSEGMASGGLSSGGMDSGGMGSGGL 121

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 39/108 (36%), Positives = 69/108 (63%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   +G + + G  + G+ +GG  +GG+ +GGL +G + + G  +GGL +GG  +GG+  
Sbjct: 9   GVMGSGVMGSRGMGSRGVGSGGVGSGGMASGGLSSGVMGSRGMGSGGLGSGGMGSGGVGN 68

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL 8
           GG S+GG+ +GG  +G + +G   +GG+ + G ++GGL +GG  +GG+
Sbjct: 69  GGLSSGGMGSGGMGSGDMGSGDMDSGGMGSEGMASGGLSSGGMDSGGM 116

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 37/108 (34%), Positives = 67/108 (62%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   +G + +G   + G+ + G  +GG+ +GG+ +GGL +G   + G+ +GG  +GG+ +
Sbjct: 4   GVMDSGVMGSGVMGSRGMGSRGVGSGGVGSGGMASGGLSSGVMGSRGMGSGGLGSGGMGS 63

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL 8
           GG   GGL +GG  +GG+ +G   +G + +GG  + G+ +GG S+GG+
Sbjct: 64  GGVGNGGLSSGGMGSGGMGSGDMGSGDMDSGGMGSEGMASGGLSSGGM 111

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 36/104 (34%), Positives = 67/104 (64%)
 Frame = -2

Query: 319 TGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYTGGFS 140
           +G + +G   +G + + G  + G+ +GG+ +GG+ +GG S+G + + G  +GGL +GG  
Sbjct: 3   SGVMDSGVMGSGVMGSRGMGSRGVGSGGVGSGGMASGGLSSGVMGSRGMGSGGLGSGGMG 62

Query: 139 TGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL 8
           +GG+  GG S+GG+ +GG  +G + +G   +GG+ + G ++GGL
Sbjct: 63  SGGVGNGGLSSGGMGSGGMGSGDMGSGDMDSGGMGSEGMASGGL 106

[132][TOP]
>UniRef100_B9S3J8 Repetitive proline-rich cell wall protein 2, putative n=1
           Tax=Ricinus communis RepID=B9S3J8_RICCO
          Length = 299

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 61/118 (51%), Positives = 69/118 (58%), Gaps = 9/118 (7%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP-VYKPPVEKPP 182
           Y  P  KPP   PP  K P   PP  KPP +  P ++PP  KPP  KPP V KPP+ KPP
Sbjct: 30  YPTPPSKPPPGHPP--KYPPRHPPKVKPPFHPKPPKQPPHVKPPHPKPPHVPKPPIVKPP 87

Query: 183 -VYKPPAEKPP-VYKPPVYKPP--VYKPPVEKPP--VYKPPVEKPP--VYKPPVEKPP 332
            + KPP  +PP + KPPV  PP  V KPPV  PP  V KPPV  PP  V KPP+  PP
Sbjct: 88  TIPKPPIVRPPYIPKPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFVPKPPIVYPP 145

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 61/123 (49%), Positives = 71/123 (57%), Gaps = 13/123 (10%)
 Frame = +3

Query: 3   VYKPP-VEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP--VEKPPVY 158
           + KPP + KPP+ +PP + KPPV  PP  V KPPV  PP  V KPPV  PP  V KPP+ 
Sbjct: 83  IVKPPTIPKPPIVRPPYIPKPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFVPKPPIV 142

Query: 159 KPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVE 323
            PP   PPV  PP+  P + KPPV  PP+ KPP       KPPV  PP  KPP  + P  
Sbjct: 143 YPP--NPPV-TPPSSPPYIPKPPVVTPPI-KPPTPPTLPPKPPVITPPT-KPPTPETPCP 197

Query: 324 KPP 332
            PP
Sbjct: 198 PPP 200

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 59/126 (46%), Positives = 69/126 (54%), Gaps = 19/126 (15%)
 Frame = +3

Query: 9   KPPVEKPP-VYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPP--V 170
           KPP  KPP V KPP+ KPP     + KPP+ +PP + KPPV  PP  V KPPV  PP  V
Sbjct: 69  KPPHPKPPHVPKPPIVKPPT----IPKPPIVRPPYIPKPPVVNPPPFVPKPPVVNPPPFV 124

Query: 171 EKPPVYKPP--AEKPPVYKP--PVYKPPVYKPPVEKPPVYKPPVE---------KPPVYK 311
            KPPV  PP    KPP+  P  P   PP   P + KPPV  PP++         KPPV  
Sbjct: 125 PKPPVVNPPPFVPKPPIVYPPNPPVTPPSSPPYIPKPPVVTPPIKPPTPPTLPPKPPVIT 184

Query: 312 PPVEKP 329
           PP + P
Sbjct: 185 PPTKPP 190

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 64/138 (46%), Positives = 72/138 (52%), Gaps = 30/138 (21%)
 Frame = +3

Query: 9   KPP-VEKPPVYKPP-VEKPPVYKPP-VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP 167
           KPP V KPP+ KPP + KPP+ +PP + KPPV  PP  V KPPV  PP  V KPPV  PP
Sbjct: 74  KPPHVPKPPIVKPPTIPKPPIVRPPYIPKPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPP 133

Query: 168 --VEKPPVYKPP------------AEKPPVYKPPVY---------KPPVYKPPVEKPPVY 278
             V KPP+  PP              KPPV  PP+          KPPV  PP  KPP  
Sbjct: 134 PFVPKPPIVYPPNPPVTPPSSPPYIPKPPVVTPPIKPPTPPTLPPKPPVITPPT-KPPTP 192

Query: 279 KPPVEKPPVYKPPVEKPP 332
           + P   PP   PPV  PP
Sbjct: 193 ETPCPPPP--PPPVPCPP 208

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 56/127 (44%), Positives = 65/127 (51%), Gaps = 19/127 (14%)
 Frame = +3

Query: 3   VYKPP-VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP--VEKPPVYKPP-------- 137
           + +PP + KPPV  PP  V KPPV  PP  V KPPV  PP  V KPP+  PP        
Sbjct: 94  IVRPPYIPKPPVVNPPPFVPKPPVVNPPPFVPKPPVVNPPPFVPKPPIVYPPNPPVTPPS 153

Query: 138 ----VEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPV 305
               + KPPV  PP+ KPP       KPPV  PP  KPP  + P   PP   PPV  PP 
Sbjct: 154 SPPYIPKPPVVTPPI-KPPTPPTLPPKPPVITPPT-KPPTPETPCPPPP--PPPVPCPP- 208

Query: 306 YKPPVEK 326
             PP ++
Sbjct: 209 -PPPKQE 214

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 41/92 (44%), Positives = 45/92 (48%), Gaps = 1/92 (1%)
 Frame = +3

Query: 3   VYKP-PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 179
           VY P P   PP   P + KPPV  PP+ KPP   PP   P   KPPV  PP  KPP  + 
Sbjct: 142 VYPPNPPVTPPSSPPYIPKPPVVTPPI-KPPT--PPTLPP---KPPVITPPT-KPPTPET 194

Query: 180 PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPV 275
           P   PP   PPV  PP   PP   P  E  P+
Sbjct: 195 PC--PPPPPPPVPCPP---PP---PKQETCPI 218

[133][TOP]
>UniRef100_A7RX60 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis
           RepID=A7RX60_NEMVE
          Length = 533

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 53/106 (50%), Positives = 60/106 (56%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG  STG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 52  GALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFT 111

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG   TG  +TG  STGG +TG  STG
Sbjct: 112 GALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTG 157

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 53/106 (50%), Positives = 60/106 (56%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG  STG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 62  GALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFT 121

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG   TG  +TG  STGG +TG  STG  +TG  STG
Sbjct: 122 GALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTG 167

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 53/106 (50%), Positives = 60/106 (56%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STGG +TG  STG  +TG  STG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 142 GALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYFT 201

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG  STG  +TG  STG  +TG  STG  +TG  STG
Sbjct: 202 GALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTG 247

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG  STG  +TG L TG   TG    G   TG   TGG +T
Sbjct: 292 GALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFT 351

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STGG  TG  STG  +TG  STG  +TG   TG  +TG  STG
Sbjct: 352 GALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTG 397

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG  STG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 72  GALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFT 131

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG  STGG +TG  STG  +TG  STG  +TG   TG
Sbjct: 132 GALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTG 177

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG  STG  +TG L TG   TG  S G   TG   TG  +T
Sbjct: 82  GALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFT 141

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STGG  TG  STG  +TG  STG  +TG   TG  +TG  STG
Sbjct: 142 GALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTG 187

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG  STG  +TG L TG   TG    G   TG  STGG +T
Sbjct: 92  GALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFT 151

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG   TG  +TG  STG  +TG  STG
Sbjct: 152 GALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTG 197

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG  STG  +TG L TG   TG  S GG  TG  STG  +T
Sbjct: 102 GALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFT 161

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG   TG  +TG  STG  +TG  STG  +TG   TG
Sbjct: 162 GALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTG 207

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG   TG  +TG  STG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 262 GALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFT 321

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG   TG  +TG   TGG +TG  STGG +TG  STG
Sbjct: 322 GALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTG 367

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG  STG  +TG  STG  +TG L TG   TG  S G   TG   TG  +T
Sbjct: 272 GALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFT 331

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG   TGG +TG  STGG +TG  STG  +TG  STG
Sbjct: 332 GALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTG 377

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG  STG  +TG L TG   TG    G   TG   TG  +T
Sbjct: 282 GALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFT 341

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TGG  TG  STGG +TG  STG  +TG  STG  +TG   TG
Sbjct: 342 GALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTG 387

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG   TG  +TG L TG   TG    GG  TG  STGG +T
Sbjct: 302 GALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFT 361

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG   TG  +TG  STG  +TG   TG
Sbjct: 362 GALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTG 407

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 52/107 (48%), Positives = 59/107 (55%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG  STG  +TG  STG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 42  GALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFT 101

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
           G  STG   TG  STG  +TG  STG  +TG   TG  +TG  STGG
Sbjct: 102 GALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGG 148

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 56/110 (50%), Positives = 65/110 (59%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G + TG L TG + TG L TG + TG L TG   TG L TG +  G L TG + TG L T
Sbjct: 257 GVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALST 316

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*T 2
           G   TG L TG + TG L TG + TG L TGG+ TG L TGG+ TG L T
Sbjct: 317 GVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALST 366

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG   TG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 12  GALSTGVYFTGALSTGVYFTGALFTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFT 71

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG  STG  +TG  STG  +TG  STG
Sbjct: 72  GALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTG 117

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG   TG  +TG L TGG  TG  S G   TG  STG  +T
Sbjct: 112 GALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFT 171

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG  STG  +TG  STG  +TG   TG  +TG  STG
Sbjct: 172 GALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTG 217

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG   TG  +TG  STGG +TG L TG   TG  S G   TG   TG  +T
Sbjct: 122 GALSTGVYFTGALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFT 181

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG   TG  +TG  STG  +TG  STG
Sbjct: 182 GALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTG 227

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG  STGG +TG  STG  +TG L TG   TG    G   TG  STG  +T
Sbjct: 132 GALCTGVYFTGALSTGGYFTGALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFT 191

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG   TG  +TG  STG  +TG  STG  +TG  STG
Sbjct: 192 GALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTG 237

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG   TG  +TG   TG  +TG L TGG  TG  S GG  TG  STG  +T
Sbjct: 312 GALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFT 371

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG   TG  +TG  STG  +TG   TG  +TG   TG
Sbjct: 372 GALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTG 417

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TGG +TG  STGG +TG  STG  +TG L TG   TG    G   TG  STG  +T
Sbjct: 342 GALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFT 401

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG   TG  +TG  STG  +TG   TG  +TG  STG
Sbjct: 402 GALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTG 447

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG  STG  +TG  STG  +TG L TG   TG    G   TG  STG  +T
Sbjct: 2   GALCTGVYFTGALSTGVYFTGALSTGVYFTGALFTGVYFTGALCTGVYFTGALSTGVYFT 61

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG  STG  +TG  STG  +TG  STG
Sbjct: 62  GALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALSTG 107

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG  STG  +TG L TG   TG    G   TG  STG  +T
Sbjct: 212 GALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFT 271

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG  STG  +TG  STG  +TG  STG  +TG  STG
Sbjct: 272 GALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTG 317

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG  STG  +TG L TG   TG  S G   TG   TG  +T
Sbjct: 222 GALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFT 281

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG  STG  +TG  STG  +TG   TG
Sbjct: 282 GALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTG 327

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 50/107 (46%), Positives = 57/107 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG  STG  +TG   TG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 252 GALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFT 311

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
           G  STG   TG   TG  +TG   TG  +TG   TGG +TG  STGG
Sbjct: 312 GALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGG 358

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/110 (50%), Positives = 64/110 (58%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G + TG L TG + TG L TG + TG L TG   TG L TG +  G L TG   TG L T
Sbjct: 267 GVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCT 326

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*T 2
           G + TG L TG + TG L TGG+ TG L TGG+ TG L TG   TG L T
Sbjct: 327 GVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALST 376

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/110 (50%), Positives = 64/110 (58%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G + TG L TG + TG L TG + TG L TG   TG L TG    G L TG + TG L T
Sbjct: 277 GVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCT 336

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*T 2
           G + TG L TGG+ TG L TGG+ TG L TG   TG L TG + TG L T
Sbjct: 337 GVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCT 386

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 56/110 (50%), Positives = 64/110 (58%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G + TG L TGG+ TG L TGG+ TG L TG   TG L TG +  G L TG   TG L T
Sbjct: 337 GVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALST 396

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*T 2
           G + TG L TG + TG L TG   TG L TG + TG L TG + TG L T
Sbjct: 397 GVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALST 446

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG   TG  +TG   TG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 22  GALSTGVYFTGALFTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFT 81

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG  STG  +TG  STG  +TG  STG
Sbjct: 82  GALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTG 127

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STGG +TG  STG  +TG  STG  +TG L TG   TG  S G   TG   TG  +T
Sbjct: 352 GALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFT 411

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG  STG  +TG   TG  +TG  STG  +TG   TG
Sbjct: 412 GALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTG 457

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 49/106 (46%), Positives = 56/106 (52%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG   TG  +TG   TGG +TG L TGG  TG  S G   TG  STG  +T
Sbjct: 322 GALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFT 381

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG  STG  +TG   TG  +TG   TG  +TG  STG
Sbjct: 382 GALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTG 427

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 49/106 (46%), Positives = 56/106 (52%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG   TGG +TG  STGG +TG L TG   TG  S G   TG   TG  +T
Sbjct: 332 GALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCTGVCFT 391

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG   TG  +TG   TG  +TG  STG  +TG   TG
Sbjct: 392 GALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTG 437

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 50/107 (46%), Positives = 57/107 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG   TG  +TG  STG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 242 GALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFT 301

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGG 11
           G  STG   TG  STG  +TG   TG  +TG   TG  +TG   TGG
Sbjct: 302 GALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGG 348

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG   TG  +TG L TG   TG  S G   TG   TG  +T
Sbjct: 152 GALSTGVYFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYFT 211

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG  STG  +TG  STG  +TG   TG
Sbjct: 212 GALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTG 257

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG   TG  +TG  STG  +TG L TG   TG    G   TG  STG  +T
Sbjct: 162 GALSTGVYFTGALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFT 221

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG  STG  +TG   TG  +TG  STG
Sbjct: 222 GALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTG 267

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG  STG  +TG  STG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 172 GALCTGVCFTGALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFT 231

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG   TG  +TG  STG  +TG   TG
Sbjct: 232 GALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTG 277

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG   TG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 182 GALSTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFT 241

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG   TG  +TG  STG  +TG   TG  +TG  STG
Sbjct: 242 GALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTG 287

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG   TG  +TG  STG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 192 GALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFT 251

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG  STG  +TG   TG  +TG  STG  +TG  STG
Sbjct: 252 GALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTG 297

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG  STG  +TG  STG  +TG L TG   TG  S G   TG   TG  +T
Sbjct: 202 GALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFT 261

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG   TG  +TG  STG  +TG  STG  +TG  STG
Sbjct: 262 GALSTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTG 307

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 56/110 (50%), Positives = 63/110 (57%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G + TG L TG + TG L TGG+ TG L TGG  TG L TG    G L TG + TG L T
Sbjct: 327 GVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYFTGALCT 386

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*T 2
           G   TG L TG + TG L TG + TG L TG   TG L TG + TG L T
Sbjct: 387 GVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCT 436

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG   TG  +TG  STG  +TG L TG   TG    G   TG   TG  +T
Sbjct: 422 GALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGVYFT 481

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG  STG  +TG  STG  +TG  STG
Sbjct: 482 GALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTGVCFTGALSTG 527

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG   TG  +TG  STG  +TG L TG   TG  S G   TG  STG  +T
Sbjct: 32  GALFTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTGVYFT 91

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG  STG  +TG  STG  +TG   TG
Sbjct: 92  GALSTGVCFTGALSTGVYFTGALSTGVYFTGALSTGVYFTGALCTG 137

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 55/106 (51%), Positives = 61/106 (57%)
 Frame = -2

Query: 319 TGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYTGGFS 140
           TG L TG + TG L TG + TG L TGG  TG L TGG+  G L TG   TG L TG + 
Sbjct: 321 TGALCTGVYFTGALCTGVYFTGALCTGGYFTGALSTGGYFTGALSTGVCFTGALSTGVYF 380

Query: 139 TGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTGGL*T 2
           TG L TG   TG L TG + TG L TG + TG L TG   TG L T
Sbjct: 381 TGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALST 426

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/106 (46%), Positives = 56/106 (52%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG   TG  +TG L TG   TG    G   TG  STG  +T
Sbjct: 232 GALSTGVYFTGALSTGVCFTGALCTGVYFTGALSTGVYFTGALCTGVYFTGALSTGVYFT 291

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG  STG  +TG  STG  +TG   TG  +TG   TG
Sbjct: 292 GALSTGVYFTGALSTGVYFTGALSTGVCFTGALCTGVYFTGALCTG 337

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 48/106 (45%), Positives = 55/106 (51%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG   TG  +TG  STG  +TG L TG   TG  S G   TG   TG  +T
Sbjct: 402 GALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYFT 461

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG   TG  +TG  STG  +TG  STG  +TG  STG
Sbjct: 462 GALCTGVYFTGALCTGVYFTGALSTGVYFTGALSTGVCFTGALSTG 507

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 48/106 (45%), Positives = 55/106 (51%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG  STG  +TG   TG  +TG L TG   TG    G   TG   TG  +T
Sbjct: 412 GALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFT 471

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG  STG  +TG  STG  +TG  STG  +TG  STG
Sbjct: 472 GALCTGVYFTGALSTGVYFTGALSTGVCFTGALSTGVYFTGALSTG 517

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 47/106 (44%), Positives = 54/106 (50%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG  STG  +TG   TG  +TG L TG   TG    G   TG   TG  +T
Sbjct: 362 GALSTGVCFTGALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFT 421

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG   TG  +TG  STG  +TG   TG  +TG   TG
Sbjct: 422 GALSTGVYFTGALCTGVYFTGALSTGVCFTGALCTGVYFTGALCTG 467

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 47/106 (44%), Positives = 54/106 (50%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG   TG  +TG  STG  +TG L TG   TG    G   TG  STG  +T
Sbjct: 372 GALSTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFT 431

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG  STG  +TG   TG  +TG   TG  +TG   TG
Sbjct: 432 GALCTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTG 477

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 47/106 (44%), Positives = 54/106 (50%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG  STG  +TG   TG  +TG L TG   TG  S G   TG   TG  +T
Sbjct: 382 GALCTGVCFTGALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFT 441

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G  STG   TG   TG  +TG   TG  +TG   TG  +TG  STG
Sbjct: 442 GALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGVYFTGALSTG 487

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 47/106 (44%), Positives = 54/106 (50%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G  STG  +TG   TG  +TG   TG  +TG L TG   TG    G   TG  STG  +T
Sbjct: 392 GALSTGVYFTGALCTGVYFTGALCTGVCFTGALSTGVYFTGALCTGVYFTGALSTGVCFT 451

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           G   TG   TG   TG  +TG   TG  +TG  STG  +TG  STG
Sbjct: 452 GALCTGVYFTGALCTGVYFTGALCTGVYFTGALSTGVYFTGALSTG 497

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 47/101 (46%), Positives = 54/101 (53%)
 Frame = -2

Query: 331 GGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYT 152
           G   TG  +TG  STG  +TG   TG  +TG L TG   TG    G   TG  STG  +T
Sbjct: 432 GALCTGVYFTGALSTGVCFTGALCTGVYFTGALCTGVYFTGALCTGVYFTGALSTGVYFT 491

Query: 151 GGFSTGGL*TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTG 29
           G  STG   TG  STG  +TG  STG  +TG  STG  +TG
Sbjct: 492 GALSTGVCFTGALSTGVYFTGALSTGVCFTGALSTGVYFTG 532

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 46/97 (47%), Positives = 52/97 (53%)
 Frame = -2

Query: 304 TGGFSTGGLYTGGFSTGGLYTGGL*TGGL*TGGFSAGGL*TGGFSTGGLYTGGFSTGGL* 125
           TG   TG  +TG  STG  +TG L TG   TG    G   TG   TG  +TG  STG   
Sbjct: 1   TGALCTGVYFTGALSTGVYFTGALSTGVYFTGALFTGVYFTGALCTGVYFTGALSTGVYF 60

Query: 124 TGGFSTGGLYTGGFSTGGLYTGGFSTGGLYTGGFSTG 14
           TG  STG  +TG  STG  +TG  STG  +TG  STG
Sbjct: 61  TGALSTGVYFTGALSTGVYFTGALSTGVYFTGALSTG 97

[134][TOP]
>UniRef100_C7ZH41 Predicted protein n=1 Tax=Nectria haematococca mpVI 77-13-4
           RepID=C7ZH41_NECH7
          Length = 234

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 66/116 (56%), Positives = 72/116 (62%), Gaps = 8/116 (6%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKP--------PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 161
           YK P EK P YK PV+KP        PVYK P +K P YK P EK P YK PV+K P YK
Sbjct: 64  YKAP-EKKPEYKAPVKKPSYKAPEKKPVYKAPAKK-PAYKAP-EKKPEYKAPVKK-PAYK 119

Query: 162 PPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
            P EK P YK PA+K P YK P  K P YK PV+K P YK P EK PVYK P +KP
Sbjct: 120 AP-EKKPEYKAPAKK-PAYKAP-EKKPEYKAPVKK-PAYKAP-EKKPVYKAPAKKP 170

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 65/118 (55%), Positives = 71/118 (60%), Gaps = 10/118 (8%)
 Frame = +3

Query: 6   YKPPVEKP--------PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 161
           YK PV+KP        PVYK P +K P YK P EK P YK PV+K P YK P EK P YK
Sbjct: 73  YKAPVKKPSYKAPEKKPVYKAPAKK-PAYKAP-EKKPEYKAPVKK-PAYKAP-EKKPEYK 128

Query: 162 PPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKP 329
            P +K P YK P EK P YK PV K P YK P EK PVYK P +KP    YK P +KP
Sbjct: 129 APAKK-PAYKAP-EKKPEYKAPV-KKPAYKAP-EKKPVYKAPAKKPAHNTYKAPEKKP 182

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 62/114 (54%), Positives = 69/114 (60%), Gaps = 6/114 (5%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           YK PV+KP  YK P EK P YK P +KP  YK P EK P YK PV+KP  YK P EK PV
Sbjct: 109 YKAPVKKP-AYKAP-EKKPEYKAPAKKP-AYKAP-EKKPEYKAPVKKP-AYKAP-EKKPV 162

Query: 186 YKPPAEKPP--VYKPPVYKPP--VYKPPVEKPP--VYKPPVEKPPVYKPPVEKP 329
           YK PA+KP    YK P  KP    YK P +KP    YK P +K P YK P +KP
Sbjct: 163 YKAPAKKPAHNTYKAPEKKPEHNTYKAPAKKPAHNTYKAPAKK-PAYKAPAKKP 215

[135][TOP]
>UniRef100_Q9SKP9 Putative proline-rich protein n=1 Tax=Arabidopsis thaliana
           RepID=Q9SKP9_ARATH
          Length = 321

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 60/130 (46%), Positives = 74/130 (56%), Gaps = 23/130 (17%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKP--PVYKPPVEKP-----------PVYKPPVEKPPVYKPPVEKPP 152
           PP+  PP+  P ++KP  P+YKPPV  P           P+YKPPV   P+YKPPV   P
Sbjct: 168 PPLNLPPLTFPKIKKPCPPIYKPPVVIPKKPCPPKIAHKPIYKPPV---PIYKPPV---P 221

Query: 153 VYKPPVEKP----------PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPP 302
           +YKPPV  P          P+YKPP    P+YKPPV  P    PP+ K P+YK PV   P
Sbjct: 222 IYKPPVVIPKKPCPPKIHKPIYKPPV---PIYKPPVVIPKKTFPPLHK-PIYKHPV---P 274

Query: 303 VYKPPVEKPP 332
           +YK P+ KPP
Sbjct: 275 IYK-PIFKPP 283

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 54/122 (44%), Positives = 65/122 (53%), Gaps = 17/122 (13%)
 Frame = +3

Query: 3   VYKPPVEKP-----------PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 149
           +YKPPV  P           P+YKPPV   P+YKPPV   P+YKPPV  P    PP    
Sbjct: 187 IYKPPVVIPKKPCPPKIAHKPIYKPPV---PIYKPPV---PIYKPPVVIPKKPCPPKIHK 240

Query: 150 PVYKPPVEKPPVYKPPAEKPPVYKPPVYKP------PVYKPPVEKPPVYKPPVEKPPVYK 311
           P+YKPPV   P+YKPP   P    PP++KP      P+YKP  + P V  P    PP+ K
Sbjct: 241 PIYKPPV---PIYKPPVVIPKKTFPPLHKPIYKHPVPIYKPIFKPPVVVIPKKPCPPLPK 297

Query: 312 PP 317
            P
Sbjct: 298 FP 299

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 50/110 (45%), Positives = 59/110 (53%), Gaps = 16/110 (14%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKP----------PVYKPPVEKPPVYKPPVEKPP 152
           +YKPPV   P+YKPPV   P+YKPPV  P          P+YKPPV   P+YKPPV  P 
Sbjct: 208 IYKPPV---PIYKPPV---PIYKPPVVIPKKPCPPKIHKPIYKPPV---PIYKPPVVIPK 258

Query: 153 VYKPPVEKP------PVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKP 284
              PP+ KP      P+YKP  + P V  P    PP+ K P   PP Y P
Sbjct: 259 KTFPPLHKPIYKHPVPIYKPIFKPPVVVIPKKPCPPLPKFP-HFPPKYIP 307

[136][TOP]
>UniRef100_UPI00004D7A1C UPI00004D7A1C related cluster n=1 Tax=Xenopus (Silurana) tropicalis
           RepID=UPI00004D7A1C
          Length = 213

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 44/105 (41%), Positives = 55/105 (52%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P  KPP Y P + + P+  PP+   P  KPP   PP+   P  K P Y PP  KPP+   
Sbjct: 80  PAAKPPSYCPHLNQAPLILPPICTVPASKPPSYSPPICTVPAAKAPSYCPPTAKPPICTV 139

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PA KPP+   P  KPP+   P  KPP+   P  KPP+Y  P + P
Sbjct: 140 PAAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPLYCAPSKAP 184

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 43/106 (40%), Positives = 54/106 (50%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P+  PP+   P  KPP Y P + + P+  PP+   P  KPP   PP+   P  K P Y P
Sbjct: 70  PLILPPICTVPAAKPPSYCPHLNQAPLILPPICTVPASKPPSYSPPICTVPAAKAPSYCP 129

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P  KPP+   P  KPP+   P  KPP+   P  KPP+   P  KPP
Sbjct: 130 PTAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPP 175

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 51/135 (37%), Positives = 59/135 (43%), Gaps = 29/135 (21%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           P  KPP+   P  KPP+   P  KPP+   P  KPP+   P  KPP+   P  KPP Y P
Sbjct: 1   PAAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPSYCP 60

Query: 195 -------------------PAEKPPVYKP-----PVYKPPVYKPPVEKPPVYKPPV---- 290
                              PA KPP Y P     P+  PP+   P  KPP Y PP+    
Sbjct: 61  HLYCASSQAPLILPPICTVPAAKPPSYCPHLNQAPLILPPICTVPASKPPSYSPPICTVP 120

Query: 291 -EKPPVYKPPVEKPP 332
             K P Y PP  KPP
Sbjct: 121 AAKAPSYCPPTAKPP 135

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 49/132 (37%), Positives = 58/132 (43%), Gaps = 24/132 (18%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPV-----EKPPVYKPPVEKPPVYKPPVEKPPVYKP------------- 134
           KPP+   P  KPP+      KPP+   P  KPP+   P  KPP Y P             
Sbjct: 14  KPPICTVPAAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPSYCPHLYCASSQAPLIL 73

Query: 135 ------PVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEK 296
                 P  KPP Y P + + P+  PP    P  KPP Y PP+   P  K P Y PP  K
Sbjct: 74  PPICTVPAAKPPSYCPHLNQAPLILPPICTVPASKPPSYSPPICTVPAAKAPSYCPPTAK 133

Query: 297 PPVYKPPVEKPP 332
           PP+   P  KPP
Sbjct: 134 PPICTVPAAKPP 145

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 41/107 (38%), Positives = 50/107 (46%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PP+   P  KPP   PP+   P  K P Y PP  KPP+   P  KPP+   P  KPP+  
Sbjct: 99  PPICTVPASKPPSYSPPICTVPAAKAPSYCPPTAKPPICTVPAAKPPICTVPAAKPPICT 158

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PA KPP+   P  KPP+Y  P + P     P    P    P +  P
Sbjct: 159 VPAAKPPICTVPAAKPPLYCAPSKAPASVPVPAAAMPRNPSPSQPRP 205

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 39/103 (37%), Positives = 46/103 (44%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY 188
           KPP   PP+   P  K P Y PP  KPP+   P  KPP+   P  KPP+   P  KPP+ 
Sbjct: 108 KPPSYSPPICTVPAAKAPSYCPPTAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPIC 167

Query: 189 KPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
             PA KPP+Y  P   P     P    P    P +  P    P
Sbjct: 168 TVPAAKPPLYCAPSKAPASVPVPAAAMPRNPSPSQPRPAPSSP 210

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 31/84 (36%), Positives = 37/84 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP  KPP+   P  KPP+   P  KPP+   P  KPP+   P  KPP+Y  P + P  
Sbjct: 127 YCPPTAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPICTVPAAKPPLYCAPSKAPAS 186

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPP 257
              PA   P    P    P    P
Sbjct: 187 VPVPAAAMPRNPSPSQPRPAPSSP 210

[137][TOP]
>UniRef100_B9RZI2 Protein binding protein, putative n=1 Tax=Ricinus communis
           RepID=B9RZI2_RICCO
          Length = 829

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 57/113 (50%), Positives = 64/113 (56%), Gaps = 6/113 (5%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           PP   PPV+ PP   PPVY PP   PP  V+ PP   PPV+ PP   PPV+ PP   PPV
Sbjct: 672 PPSPPPPVHSPP---PPVYSPPPPSPPPPVHSPP---PPVHSPP---PPVHSPP---PPV 719

Query: 186 YKPPAEKPPVYKPPVYK--PPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPP 332
           Y PP   PP   PP++   PPVY PP   PPV  PP   PPV+   PPV  PP
Sbjct: 720 YSPPPPSPPSPPPPMHSPPPPVYSPP--PPPVRSPP---PPVHSPPPPVHSPP 767

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 57/114 (50%), Positives = 63/114 (55%), Gaps = 7/114 (6%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPV 185
           PPV  PP   PPV  PP   PP   PPV+ PP   PPVY PP   PP  V+ PP   PPV
Sbjct: 658 PPVNSPP---PPVYSPP---PPSPPPPVHSPP---PPVYSPPPPSPPPPVHSPP---PPV 705

Query: 186 YKPPAEKPPVYKPP--VYKPPVYKPPVEKPPVYKPPVEKPPVYK---PPVEKPP 332
           + PP   PPV+ PP  VY PP   PP   PP++ PP   PPVY    PPV  PP
Sbjct: 706 HSPP---PPVHSPPPPVYSPPPPSPPSPPPPMHSPP---PPVYSPPPPPVRSPP 753

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 54/109 (49%), Positives = 60/109 (55%), Gaps = 2/109 (1%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--V 185
           PP + PP   PPV  PP   PPV  PP   PP   PPV+ PP   PPVY PP   PP  V
Sbjct: 651 PPTQSPP---PPVNSPP---PPVYSPP---PPSPPPPVHSPP---PPVYSPPPPSPPPPV 698

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           + PP   PPV+ PP   PPV+ PP   PPVY PP   PP   PP+  PP
Sbjct: 699 HSPP---PPVHSPP---PPVHSPP---PPVYSPPPPSPPSPPPPMHSPP 738

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 53/104 (50%), Positives = 60/104 (57%), Gaps = 2/104 (1%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK--PPV 185
           PP   PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PP   PP+    PPV
Sbjct: 691 PPSPPPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPPPPSPPSPPPPMHSPPPPV 741

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           Y PP   PPV  PP   PPV+ PP   PPV+ PP   PP+Y PP
Sbjct: 742 YSPP--PPPVRSPP---PPVHSPP---PPVHSPP---PPIYSPP 774

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 54/114 (47%), Positives = 62/114 (54%), Gaps = 4/114 (3%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEK 176
           V+ PP   PPV+ PP   PPVY PP   PP   PP+  PP  VY PP   PPV  PP   
Sbjct: 705 VHSPP---PPVHSPP---PPVYSPPPPSPPSPPPPMHSPPPPVYSPP--PPPVRSPP--- 753

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYK--PPVEKPP 332
           PPV+ PP   PPV+ PP   PP+Y PP   PP + PP   PP +   PP   PP
Sbjct: 754 PPVHSPP---PPVHSPP---PPIYSPP---PPRFSPP---PPRFSPPPPTSSPP 795

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 52/111 (46%), Positives = 59/111 (53%), Gaps = 4/111 (3%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYK 191
           PPV  PP   PP   PP++ PP   PPVY PP   PPV  PP   PPV+ PP   PPV+ 
Sbjct: 717 PPVYSPPPPSPPSPPPPMHSPP---PPVYSPP--PPPVRSPP---PPVHSPP---PPVHS 765

Query: 192 PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP----VEKPP 332
           PP   PP+Y PP   PP + PP   PP + PP   PP   PP    V  PP
Sbjct: 766 PP---PPIYSPP---PPRFSPP---PPRFSPP---PPTSSPPPTPTVAAPP 804

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 53/119 (44%), Positives = 60/119 (50%), Gaps = 12/119 (10%)
 Frame = +3

Query: 12  PPVEKPPVY------KPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-- 167
           PP + PP         PP + PP   PP + PP   PPV  PP   PPV  PP   PP  
Sbjct: 628 PPGQSPPPTTPEQSPSPPGQSPP---PPTQSPP---PPVNSPP---PPVYSPPPPSPPPP 678

Query: 168 --VEKPPVYK--PPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
                PPVY   PP+  PPV+ PP   PPV+ PP   PPV+ PP   PPVY PP   PP
Sbjct: 679 VHSPPPPVYSPPPPSPPPPVHSPP---PPVHSPP---PPVHSPP---PPVYSPPPPSPP 728

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 51/109 (46%), Positives = 57/109 (52%), Gaps = 2/109 (1%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPP--VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           VY PP   PP   PP+  PP  VY PP   PPV  PP   PPV+ PP   PPV+ PP   
Sbjct: 719 VYSPPPPSPPSPPPPMHSPPPPVYSPP--PPPVRSPP---PPVHSPP---PPVHSPP--- 767

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           PP+Y PP   PP + PP   PP + PP   PP   PP   P V  PP E
Sbjct: 768 PPIYSPP---PPRFSPP---PPRFSPP---PPTSSPP-PTPTVAAPPPE 806

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 43/104 (41%), Positives = 48/104 (46%), Gaps = 3/104 (2%)
 Frame = +3

Query: 30  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE-KPPVYKPPVEKPPVYKPPAEK 206
           P  + P+  P    P +E+ P   PP + PP   P     PP   PP   PP   PP   
Sbjct: 608 PSPESPLSSPT--SPTLEQSP--SPPGQSPPPTTPEQSPSPPGQSPP---PPTQSPP--- 657

Query: 207 PPVYKPPVYKPPVYKPPVEKPPVYKPPVEK--PPVYKPPVEKPP 332
           PPV  PP   PPVY PP   PP   PPV    PPVY PP   PP
Sbjct: 658 PPVNSPP---PPVYSPPPPSPP---PPVHSPPPPVYSPPPPSPP 695

[138][TOP]
>UniRef100_A8WLZ2 Putative uncharacterized protein (Fragment) n=1 Tax=Caenorhabditis
           briggsae AF16 RepID=A8WLZ2_CAEBR
          Length = 1042

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 53/110 (48%), Positives = 63/110 (57%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 224 VEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAP 283

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P E  PV   PV + PV+  PVE  PV + PVE  PV   PVE+ P
Sbjct: 284 VKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKP 333

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 53/110 (48%), Positives = 62/110 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE  PV + PVE  P
Sbjct: 234 VEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAP 293

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV+  PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 294 VEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 343

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 52/106 (49%), Positives = 61/106 (57%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV + PVE  PV + PVE  PV   PVE+ PV+  
Sbjct: 248 PVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAA 307

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 308 PVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAP 353

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 51/103 (49%), Positives = 60/103 (58%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV + PVE  PV + PVE  PV   PVE+ PV+  PVE  PV + 
Sbjct: 258 PVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEK 317

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           P E  PV   PV + PV   PVE  PV + PVE  PV + PVE
Sbjct: 318 PVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVE 360

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/110 (47%), Positives = 62/110 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PVE  PV + PVE  PV   PVE+ PV+  PVE  PV + PVE  P
Sbjct: 264 VEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAP 323

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV   PV + PVE  PV + PVE   V   PVE+ P
Sbjct: 324 VEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKP 373

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 52/110 (47%), Positives = 62/110 (56%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PVE  PV   PVE+ PV+  PVE  PV + PVE  PV   PVE+ P
Sbjct: 274 VEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKP 333

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E  PV + PV   PV + PVE   V   PVE+ PV   PVE+ P
Sbjct: 334 VDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKP 383

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 51/105 (48%), Positives = 60/105 (57%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           VE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + P
Sbjct: 219 VEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKP 278

Query: 198 AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            E  PV + PV   PV   PVE+ PV+  PVE  PV + PVE  P
Sbjct: 279 VEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAP 323

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 52/106 (49%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   
Sbjct: 626 PVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAA 685

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE+ PV   PVE  PV   PVE+ P
Sbjct: 686 PFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKP 731

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 51/106 (48%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV    VE  PV + PVE  PV + PVE  PV   PVE+ PV   PVE  PV + 
Sbjct: 208 PVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEK 267

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV + PVE  PV   PVE+ PV+  PVE  P
Sbjct: 268 PVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAP 313

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 52/110 (47%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV+  PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 284 VKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 343

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P E  PV + PV    V   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 344 VEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 393

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 51/106 (48%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV+  PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + 
Sbjct: 298 PVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEK 357

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E   V   PV + PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 358 PVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 403

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 52/110 (47%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V+  PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE   
Sbjct: 304 VHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQ 363

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 364 VEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 413

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 52/110 (47%), Positives = 61/110 (55%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE+ P
Sbjct: 692  VEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKP 751

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P E  PV + PV   PV   PVE+ PV   PVE  PV + PV+  P
Sbjct: 752  VEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAP 801

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 52/110 (47%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   P E  PV + PVE  P
Sbjct: 642 VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAP 701

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV   PV   PVE+ PV   PVE+ PV   PVE+ P
Sbjct: 702 VEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKP 751

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 51/106 (48%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   P E  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   
Sbjct: 676 PVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAA 735

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 736 PVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 781

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 50/106 (47%), Positives = 60/106 (56%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PV+  PV + PVE  PV + 
Sbjct: 691  PVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEK 750

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV   PV + PV   PVE  PV + PV+  PV   PVE+ P
Sbjct: 751  PVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKP 796

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 51/106 (48%), Positives = 60/106 (56%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 198 PVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVA 257

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 258 PVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKP 303

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 49/106 (46%), Positives = 61/106 (57%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE+ PV   PV++ PV   
Sbjct: 233 PVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAA 292

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV+  PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 293 PVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 338

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   P E  PV + 
Sbjct: 636 PVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEK 695

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE  PV   PVE+ PV   PVE+ P
Sbjct: 696 PVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKP 741

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV   PVE+ PV   P E  PV + PVE  PV   PVE+ PV   
Sbjct: 656 PVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAA 715

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 716 PVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAP 761

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV   PVE+ PV   P E  PV + PVE  PV   PVE+ PV   PVE  PV   
Sbjct: 666 PVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAA 725

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV + PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 726 PVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 771

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 51/106 (48%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            P E  PV + PVE  PV   PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   
Sbjct: 686  PFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAA 745

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV   PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 746  PVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 791

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/110 (47%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV + PVE   V   PVE+ P
Sbjct: 314 VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKP 373

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 374 VEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 423

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/110 (46%), Positives = 59/110 (53%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  P
Sbjct: 627 VEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAP 686

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
               P E+ PV   PV   PV + PVE  PV   PVE  PV + PV+  P
Sbjct: 687 FEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAP 736

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PVE  P    PVE+ PV   
Sbjct: 641 PVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAA 700

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE  PV + PV+  PV + PVE  P
Sbjct: 701 PVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAP 746

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 50/106 (47%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PVE  PV + PVE  P    PVE+ PV   PVE  PV + 
Sbjct: 651 PVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEET 710

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV   PV + PV+  PV + PVE  PV + PVE  P
Sbjct: 711 PVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAP 756

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/110 (46%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE  PV + PVE  P    PVE+ PV   PVE  PV + PVE  P
Sbjct: 657 VEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAP 716

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E  PV + PV   PV + PVE  PV + PVE  PV   PV++ P
Sbjct: 717 VEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKP 766

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 51/106 (48%), Positives = 59/106 (55%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 726  PVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAA 785

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV + PV   PV   PVE   V   PVE+ PV   PVE+ P
Sbjct: 786  PVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKP 831

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 50/103 (48%), Positives = 58/103 (56%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + 
Sbjct: 706  PVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEK 765

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
            P E  PV   PV + PV   PVE  PV + PV+  PV   PVE
Sbjct: 766  PVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVE 808

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 49/106 (46%), Positives = 59/106 (55%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE  PV   PVE  PV + PV+  PV + PVE  PV + PVE  PV   
Sbjct: 701  PVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAA 760

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P ++ PV   PV   PV + PV+  PV   PVE+ PV   PVE  P
Sbjct: 761  PVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAP 806

 Score = 90.1 bits (222), Expect = 7e-17
 Identities = 49/106 (46%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  P    PVE+ PV   PVE  PV + PVE  PV   PVE  PV + 
Sbjct: 671 PVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEK 730

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P +  PV + PV   PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 731 PVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 776

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/110 (44%), Positives = 61/110 (55%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE+ PV   PV++ PV   PVE  PV + PV   P
Sbjct: 249 VEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAP 308

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P ++ PV   PV   PV + PV+  PV   PVE+ PV   PVE+ P
Sbjct: 309 VEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKP 358

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV    VE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 611 PVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAA 670

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   P    PVE+ PV   PVE  PV + PVE  P
Sbjct: 671 PVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAP 716

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 51/110 (46%), Positives = 58/110 (52%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE   V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 612 VEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 671

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   P    PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 672 VEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAP 721

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 49/110 (44%), Positives = 60/110 (54%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  P    PVE+ PV   PVE  PV + PVE  PV   PVE  PV + PV+  P
Sbjct: 677  VEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAPVEEKPVDAAP 736

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V + P E  PV + PV   PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 737  VEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 786

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 50/106 (47%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   
Sbjct: 716  PVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAA 775

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV   PV   PV + PV+  PV   PVE   V   PVE+ P
Sbjct: 776  PVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKP 821

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 50/110 (45%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 209 VEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKP 268

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV + PV   PVE  PV + PV   PV   PV++ P
Sbjct: 269 VEAAPVEEKPVEAAPVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKP 318

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 50/105 (47%), Positives = 56/105 (53%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           VE  PV + PVE  PV   PVE+ PV   PVE  PV + PVE  PV   PVE  PV + P
Sbjct: 622 VEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEAAPVEEKP 681

Query: 198 AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            E  P    PV + PV   PVE  PV + PVE  PV   PVE  P
Sbjct: 682 VEAAPFEAAPVEEKPVEAAPVEAAPVEETPVEAAPVEAAPVEAAP 726

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 50/110 (45%), Positives = 60/110 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PV+   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PVE  P
Sbjct: 184 VEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAP 243

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV   PV + PVE  PV + PVE  PV + PVE  P
Sbjct: 244 VEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAP 293

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 49/106 (46%), Positives = 57/106 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV+  PV + PVE   V   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   
Sbjct: 606 PVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAA 665

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   P E  PV + PVE  PV   PVE+ P
Sbjct: 666 PVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAPVEETP 711

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 50/106 (47%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV   PVE+ PV    VE  PV + PVE  PV + PVE   V   PVE+ PV   
Sbjct: 173 PVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAA 232

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV   PV + PVE  PV   PVE+ PV   PVE+ P
Sbjct: 233 PVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKP 278

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + 
Sbjct: 338 PVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEK 397

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE  PV    VE  PV + PVE  P
Sbjct: 398 PVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAP 443

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 50/110 (45%), Positives = 59/110 (53%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV   PVE  PV + PV+  PV + PVE  PV + PVE  PV   PV++ P
Sbjct: 707  VEETPVEAAPVEAAPVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKP 766

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P E  PV + PV   PV   PVE+ PV   PVE  PV    VE  P
Sbjct: 767  VEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAP 816

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/106 (46%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV    VE  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   
Sbjct: 183 PVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAA 242

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE+ PV   PVE+ PV   PV++ P
Sbjct: 243 PVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKP 288

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/105 (46%), Positives = 58/105 (55%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           VE  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + P
Sbjct: 194 VEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 253

Query: 198 AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            E  PV   PV + PV   PVE+ PV   PV++ PV   PVE  P
Sbjct: 254 VEVAPVEAAPVEEKPVEAAPVEEKPVEAAPVKEKPVEAAPVEAAP 298

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 50/106 (47%), Positives = 57/106 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   
Sbjct: 328 PVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAA 387

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE+ PV   PVE  PV    VE  P
Sbjct: 388 PVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAP 433

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 49/106 (46%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PV+   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + 
Sbjct: 178 PVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEK 237

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE  PV + PVE  PV + PVE  P
Sbjct: 238 PVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAPVEEKPVEAAP 283

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/103 (46%), Positives = 57/103 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PV+  PV   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + 
Sbjct: 323 PVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEK 382

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           P E  PV   PV + PV   PVE  PV + PV+  PV   PVE
Sbjct: 383 PVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVE 425

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 49/106 (46%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PVE  PV   PV++ PV   
Sbjct: 343 PVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAA 402

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PVE   V   PVE+ PV   PVE+ P
Sbjct: 403 PVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKP 448

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 48/106 (45%), Positives = 58/106 (54%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PV+  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + 
Sbjct: 721  PVEAAPVEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEK 780

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P +  PV   PV + PV   PVE  PV    VE  PV + PVE  P
Sbjct: 781  PVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAP 826

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 47/106 (44%), Positives = 59/106 (55%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV++ PV   PVE  PV + PV+  PV   PVE+ PV   PVE+ PV    VE  PV + 
Sbjct: 313 PVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEK 372

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV   PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 373 PVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 418

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 49/106 (46%), Positives = 57/106 (53%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + 
Sbjct: 736  PVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEK 795

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P +  PV   PV    V   PVE+ PV   PVE+ PV    VE  P
Sbjct: 796  PVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAP 841

 Score = 86.7 bits (213), Expect = 8e-16
 Identities = 49/106 (46%), Positives = 57/106 (53%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   
Sbjct: 746  PVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAA 805

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E   V   PV + PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 806  PVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAP 851

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 47/106 (44%), Positives = 58/106 (54%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV++ PV   PVE  PV + PV   PV   PV++ PV   PVE  PV + PV+  PV   
Sbjct: 283 PVKEKPVEAAPVEAAPVEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAA 342

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV   PV + PV    VE  PV + PVE  PV + PVE  P
Sbjct: 343 PVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAP 388

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 48/110 (43%), Positives = 59/110 (53%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PV   PV   PV++ PV   PVE  PV + PV+  PV   PVE+ PV   PVE+ P
Sbjct: 299 VEEKPVHAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVEAAPVEEKP 358

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V     E  PV + PV   PV + PVE  PV   PV++ PV   PVE  P
Sbjct: 359 VEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAP 408

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 49/106 (46%), Positives = 57/106 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV    VE  PV + 
Sbjct: 378 PVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEK 437

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV    V   PV++ PV   PVE  PV + PVE  P
Sbjct: 438 PVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAP 483

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/107 (45%), Positives = 58/107 (54%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 344 VEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAP 403

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           V   P E+ PV   PV   PV    VE  PV + PVE  PV + PV+
Sbjct: 404 VEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVD 450

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 48/106 (45%), Positives = 57/106 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PVE+ PV   PVE  PV    VE  PV + PVE  PV + 
Sbjct: 388 PVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEK 447

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P +   V   PV + PV   PVE  PV + PVE  PV + PV+  P
Sbjct: 448 PVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAP 493

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/110 (44%), Positives = 59/110 (53%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   PVE   V   PVE+ P
Sbjct: 762  VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKP 821

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P E+ PV    V   PV + PVE  PV   PV++ PV   PVE+ P
Sbjct: 822  VEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKP 871

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 48/110 (43%), Positives = 59/110 (53%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PV+  PV   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PVE  P
Sbjct: 329 VEEKPVDAAPVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAP 388

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P ++ PV   PV   PV + PV+  PV   PVE   V   PVE+ P
Sbjct: 389 VEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKP 438

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 48/106 (45%), Positives = 57/106 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ PV   PVE  PV   
Sbjct: 368 PVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAA 427

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             E  PV + PV   PV + PV+   V   PV++ PV   PVE  P
Sbjct: 428 QVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAP 473

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 48/106 (45%), Positives = 57/106 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ PV    VE  PV + 
Sbjct: 403 PVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEK 462

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV   PV + PV   PVE+ PV   PVE  PV + PV+  P
Sbjct: 463 PVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAP 508

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 48/106 (45%), Positives = 57/106 (53%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ PV    VE  PV + 
Sbjct: 786  PVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEK 845

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV   PV + PV   PVE+ PV   PVE  PV + PV+  P
Sbjct: 846  PVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAP 891

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 50/110 (45%), Positives = 58/110 (52%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PVE   V   PVE  PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 149 VEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAP 208

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P E   V   PV + PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 209 VEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAP 258

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 50/110 (45%), Positives = 58/110 (52%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE   V   PVE  PV   PVE+ PV    VE  PV + PVE  PV + PVE   
Sbjct: 159 VEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQ 218

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV + PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 219 VEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKP 268

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/110 (43%), Positives = 59/110 (53%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV+   
Sbjct: 394 VKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQ 453

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P ++ PV   PV   PV + PVE  PV + PV+  PV   PVE+ P
Sbjct: 454 VEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKP 503

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 47/107 (43%), Positives = 59/107 (55%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PV+  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  P
Sbjct: 727  VEEKPVDAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAP 786

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
            V   P E+ PV   PV   PV    VE  PV + PVE  PV + PV+
Sbjct: 787  VEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVD 833

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/106 (45%), Positives = 57/106 (53%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE  PV   PVE+ PV   PVE  PV + PV+  PV   PVE   V   
Sbjct: 756  PVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAA 815

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV   PV + PV    VE  PV + PVE  PV   PV++ P
Sbjct: 816  PVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKP 861

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/106 (45%), Positives = 57/106 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE+ PV    VE  PV   PVE  PV + PV+   V   PVE+ PV   
Sbjct: 148 PVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAA 207

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV    V   PV + PVE  PV + PVE  PV   PVE+ P
Sbjct: 208 PVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKP 253

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/110 (43%), Positives = 59/110 (53%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PVE   
Sbjct: 369 VEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQ 428

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV + PV    VE  PV + PVE  PV   PV++ P
Sbjct: 429 VEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKP 478

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/110 (43%), Positives = 59/110 (53%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PVE   V   PVE+ P
Sbjct: 379 VEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKP 438

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV    V   PV + PVE  PV   PV++ PV   PVE+ P
Sbjct: 439 VEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKP 488

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 47/106 (44%), Positives = 57/106 (53%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PV+  PV   PVE+ PV   PVE  PV    VE  PV + PVE  PV + 
Sbjct: 771  PVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEK 830

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P +   V   PV + PV   PVE  PV + PVE  PV + PV+  P
Sbjct: 831  PVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAP 876

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 48/106 (45%), Positives = 57/106 (53%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ PV   
Sbjct: 776  PVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAA 835

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
              E  PV + PV   PV   PV++ PV   PVE+ PV   PVE  P
Sbjct: 836  QVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAP 881

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 48/105 (45%), Positives = 56/105 (53%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           VE  PV   PVE  PV + PV+   V   PVE+ PV   PVE+ PV    VE  PV + P
Sbjct: 169 VEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKP 228

Query: 198 AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            E  PV + PV   PV   PVE+ PV   PVE  PV + PVE  P
Sbjct: 229 VEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAPVEEKPVEAAP 273

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 47/110 (42%), Positives = 59/110 (53%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PV+  PV   PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV+   
Sbjct: 777  VEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQ 836

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P ++ PV   PV   PV + PVE  PV + PV+  PV   PVE+ P
Sbjct: 837  VEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKP 886

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 48/106 (45%), Positives = 56/106 (52%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV    VE  PV   PVE  PV + PV+   V   PVE+ PV   PVE+ PV   
Sbjct: 158 PVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAA 217

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             E  PV + PV   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 218 QVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVEEKPVEVAPVEAAP 263

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/106 (44%), Positives = 57/106 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PV++ PV   PVE  PV + PV+  PV   PVE   V   PVE+ PV   PVE+ PV   
Sbjct: 393 PVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAA 452

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             E  PV + PV   PV   PV++ PV   PVE+ PV   PVE  P
Sbjct: 453 QVEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAP 498

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/110 (42%), Positives = 59/110 (53%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PVE+ P
Sbjct: 737  VEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKP 796

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V   P E  PV    V   PV + PVE  PV + PV+   V   PV++ P
Sbjct: 797  VDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKP 846

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/106 (44%), Positives = 57/106 (53%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PV++ PV   PVE  PV + PV+  PV   PVE+ PV   PVE  PV    VE  PV + 
Sbjct: 761  PVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAPVEAAQVEAAPVEEK 820

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E  PV + PV    V   PV++ PV   PVE  PV + PVE  P
Sbjct: 821  PVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAPVKEKPVEAAP 866

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 48/110 (43%), Positives = 58/110 (52%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE   V   PVE+ PV   PVE+ PV   PVE  PV + PVE  PV   PVE+ P
Sbjct: 354 VEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKP 413

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E  PV    V   PV + PVE  PV + PV+   V   PV++ P
Sbjct: 414 VDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKP 463

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 47/105 (44%), Positives = 56/105 (53%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           VE  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + PV+  PV   P
Sbjct: 364 VEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAP 423

Query: 198 AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            E   V   PV + PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 424 VEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAP 468

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 47/110 (42%), Positives = 58/110 (52%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV   PV++ PV   PVE  PV + PV+  PV   PVE+ PV   PVE  P
Sbjct: 747  VEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPVEAAP 806

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            V     E  PV + PV   PV + PV+   V   PV++ PV   PVE  P
Sbjct: 807  VEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAPVEAAP 856

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 47/106 (44%), Positives = 56/106 (52%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV    VE  PV + PVE  PV + PVE  PV   PV++ PV   PVE  PV + 
Sbjct: 353 PVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAPVKEKPVEAAPVEAAPVEEK 412

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P +  PV   PV    V   PVE+ PV   PVE+ PV    VE  P
Sbjct: 413 PVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAP 458

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/106 (45%), Positives = 56/106 (52%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV    VE  PV + PVE  PV + PVE   V   PVE  PV   PVE+ PV   
Sbjct: 133 PVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAA 192

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             E  PV + PV   PV + PVE   V   PVE+ PV   PVE+ P
Sbjct: 193 QVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKP 238

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 48/105 (45%), Positives = 55/105 (52%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           VE  PV + PVE  PV + PVE   V   PVE  PV   PVE+ PV    VE  PV + P
Sbjct: 144 VEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKP 203

Query: 198 AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            E  PV + PV    V   PVE+ PV   PVE+ PV   PVE  P
Sbjct: 204 VEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAPVEAAP 248

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 48/106 (45%), Positives = 56/106 (52%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PVE   V   PVE  PV   
Sbjct: 123 PVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVA 182

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E+ PV    V   PV + PVE  PV + PVE   V   PVE+ P
Sbjct: 183 PVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKP 228

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 48/106 (45%), Positives = 56/106 (52%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE+ PV   PVE+ PV   PVE   V +  VE  PV    VE+ PV   
Sbjct: 937  PVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALVEEKPVDAA 996

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P E+ PV    V   PV + PVE  PV   PVE+ PV   PVE  P
Sbjct: 997  PVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 1042

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 54/132 (40%), Positives = 62/132 (46%), Gaps = 22/132 (16%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV------------------YKP----PVEK 116
           V + PVE  PV + PVE  PV + PVE  PV                   KP    PVE+
Sbjct: 555 VEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALKPVDAAPVEE 614

Query: 117 PPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEK 296
            PV    VE  PV + PVE  PV   P E+ PV   PV   PV + PVE  PV   PVE 
Sbjct: 615 KPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEA 674

Query: 297 PPVYKPPVEKPP 332
            PV + PVE  P
Sbjct: 675 APVEEKPVEAAP 686

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 47/104 (45%), Positives = 55/104 (52%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
           E+ PV   PVE+ PV   PVE  PV + PVE   V   PVE+ PV   PVE+ PV     
Sbjct: 85  EEKPVEAAPVEEEPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQV 144

Query: 201 EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           E  PV + PV   PV + PVE   V   PVE  PV   PVE+ P
Sbjct: 145 EAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKP 188

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 48/106 (45%), Positives = 55/106 (51%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV + PVE   V   PVE+ PV   PVE+ PV    VE  PV + 
Sbjct: 93  PVEEEPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEK 152

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E  PV + PV    V   PVE  PV   PVE+ PV    VE  P
Sbjct: 153 PVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAP 198

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 48/106 (45%), Positives = 55/106 (51%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + 
Sbjct: 103 PVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEK 162

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           P E   V   PV   PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 163 PVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAP 208

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 47/106 (44%), Positives = 56/106 (52%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE  PV + PVE  PV + PVE  PV + PVE  PV    VE+  V   PVE   V + 
Sbjct: 932  PVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALVEEK 991

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            P +  PV + PV    V   PVE+ PV   PVE  PV + PVE  P
Sbjct: 992  PVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAP 1037

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 46/103 (44%), Positives = 55/103 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE  PV + PVE  PV   PVE+ PV    VE  PV + PVE  PV + PV+   V   
Sbjct: 88  PVEAAPVEEEPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAA 147

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           P E+ PV   PV + PV    VE  PV   PVE  PV + PV+
Sbjct: 148 PVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVD 190

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/110 (42%), Positives = 57/110 (51%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PV+   V   PVE+ PV   PVE+ PV    VE  PV   PVE  PV + PV+   
Sbjct: 134 VEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQ 193

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV   PV + PV    VE  PV + PVE  PV + PVE  P
Sbjct: 194 VEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAPVEEKPVEAAP 243

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 53/128 (41%), Positives = 60/128 (46%), Gaps = 22/128 (17%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV------------------YKP-- 134
           PVE  PV + PVE  PV + PVE  PV + PVE  PV                   KP  
Sbjct: 549 PVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALKPVD 608

Query: 135 --PVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVY 308
             PVE+ PV    VE  PV + P E  PV   PV + PV   PVE  PV + PVE  PV 
Sbjct: 609 AAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVE 668

Query: 309 KPPVEKPP 332
             PVE  P
Sbjct: 669 AAPVEAAP 676

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 47/110 (42%), Positives = 57/110 (51%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV   PVE+ PV    VE  PV + PVE  PV + PV+   V   PVE+ P
Sbjct: 94  VEEEPVEAAPVEAAPVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKP 153

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V   P E+ PV    V   PV   PVE  PV + PV+   V   PVE+ P
Sbjct: 154 VEAAPVEEKPVEAAQVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKP 203

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 46/106 (43%), Positives = 56/106 (52%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV    VE  PV + PVE  PV + PV+   V   PVE+ PV   PVE+ PV   
Sbjct: 108 PVEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAA 167

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             E  PV   PV   PV + PV+   V   PVE+ PV   PVE+ P
Sbjct: 168 QVEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKP 213

 Score = 80.1 bits (196), Expect = 7e-14
 Identities = 47/110 (42%), Positives = 57/110 (51%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE  PV + PV+   V   PVE+ PV   PVE+ PV    VE  PV   PVE  P
Sbjct: 124 VEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKPVEVAP 183

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V + P +   V   PV + PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 184 VEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEEKPVEAAP 233

 Score = 79.7 bits (195), Expect = 9e-14
 Identities = 48/107 (44%), Positives = 56/107 (52%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PVE   V   PVE+ PV   PVE+ PV    VE  PV + PVE  PV + PVE   
Sbjct: 109 VEEKPVEAAQVEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQ 168

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVE 323
           V   P E  PV   PV + PV    VE  PV + PVE  PV + PVE
Sbjct: 169 VEAAPVEAKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVE 215

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 44/102 (43%), Positives = 55/102 (53%)
 Frame = +3

Query: 15  PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
           PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV+   V   PV++ PV   
Sbjct: 408 PVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAA 467

Query: 195 PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 320
           P E  PV + PV   PV + PV+  PV   PVE+ PV   P+
Sbjct: 468 PVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPL 509

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 44/102 (43%), Positives = 55/102 (53%)
 Frame = +3

Query: 15   PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKP 194
            PVE+ PV   PVE  PV    VE  PV + PVE  PV + PV+   V   PV++ PV   
Sbjct: 791  PVEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAA 850

Query: 195  PAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 320
            P E  PV + PV   PV + PV+  PV   PVE+ PV   P+
Sbjct: 851  PVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPL 892

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 46/104 (44%), Positives = 55/104 (52%)
 Frame = +3

Query: 21   EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPA 200
            E+ PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE   V +  VE  PV     
Sbjct: 929  EEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALV 988

Query: 201  EKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            E+ PV   PV + PV    VE  PV + PVE  PV   PVE+ P
Sbjct: 989  EEKPVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKP 1032

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 46/105 (43%), Positives = 54/105 (51%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           VE  PV + PVE  PV + PV+   V   PVE+ PV   PVE+ PV    VE  PV   P
Sbjct: 119 VEAAPVEEKPVEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAPVEAKP 178

Query: 198 AEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            E  PV + PV    V   PVE+ PV   PVE+ PV    VE  P
Sbjct: 179 VEVAPVEEKPVDAAQVEAAPVEEKPVEAAPVEEKPVEAAQVEAAP 223

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 49/121 (40%), Positives = 57/121 (47%), Gaps = 17/121 (14%)
 Frame = +3

Query: 21  EKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK-----------------P 149
           E+ PV   PVE+ PV   PVE+ PV   PVE+ PV   PVE                   
Sbjct: 546 EEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALK 605

Query: 150 PVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKP 329
           PV   PVE+ PV     E  PV + PV   PV   PVE+ PV   PVE  PV + PVE  
Sbjct: 606 PVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAPVEEKPVEAA 665

Query: 330 P 332
           P
Sbjct: 666 P 666

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/101 (42%), Positives = 54/101 (53%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
           V + PV+  PV   PVE   V   PVE+ PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 409 VEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAP 468

Query: 183 VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPV 305
           V   P ++ PV   PV + PV   PVE  PV + PV+  P+
Sbjct: 469 VEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPL 509

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 43/101 (42%), Positives = 54/101 (53%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PV+  PV   PVE   V   PVE+ PV   PVE+ PV    VE  PV + PVE  P
Sbjct: 792  VEEKPVDAAPVEAAPVEAAQVEAAPVEEKPVEAAPVEEKPVDAAQVEAAPVKEKPVEAAP 851

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPV 305
            V   P ++ PV   PV + PV   PVE  PV + PV+  P+
Sbjct: 852  VEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPL 892

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 45/105 (42%), Positives = 54/105 (51%)
 Frame = +3

Query: 3    VYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 182
            V + PVE  PV + PVE  PV + PVE  PV    VE+  V   PVE   V + PV+  P
Sbjct: 938  VEEEPVEAAPVEQKPVEAAPVEEKPVEAAPVEAAKVEEKSVEAVPVEAALVEEKPVDAAP 997

Query: 183  VYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
            V + P E   V   PV + PV   PVE  PV + PVE  PV   P
Sbjct: 998  VEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEAAPVEAAP 1042

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 51/117 (43%), Positives = 58/117 (49%), Gaps = 7/117 (5%)
 Frame = +3

Query: 3   VYKPPVEKPPVYKP--PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEK 176
           V +  VE  PV     PV+  PV + PVE   V   PVE+ PV   PVE  PV + PVE 
Sbjct: 590 VEEKSVEAVPVEAALKPVDAAPVEEKPVEAAKVEAAPVEEKPVEAAPVEAAPVEEKPVEA 649

Query: 177 PPVYK-PPAEKP----PVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PV   P  EKP    PV   PV   PV + PVE  P    PVE+ PV   PVE  P
Sbjct: 650 APVEAAPVEEKPVEAAPVEAAPVEAAPVEEKPVEAAPFEAAPVEEKPVEAAPVEAAP 706

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/133 (35%), Positives = 58/133 (43%), Gaps = 31/133 (23%)
 Frame = +3

Query: 18  VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
           VE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV + PV+  P+    
Sbjct: 454 VEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPLVFSK 513

Query: 198 A-------------------------------EKPPVYKPPVYKPPVYKPPVEKPPVYKP 284
           A                               E+ PV   PV + PV   PVE+ PV   
Sbjct: 514 AEIFCGLELDLLMESSEFIEGNISRIPQISVTEEKPVEAAPVEEEPVEAAPVEQKPVEAA 573

Query: 285 PVEKPPVYKPPVE 323
           PVE+ PV   PVE
Sbjct: 574 PVEEKPVEAAPVE 586

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/133 (35%), Positives = 58/133 (43%), Gaps = 31/133 (23%)
 Frame = +3

Query: 18   VEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP 197
            VE  PV + PVE  PV   PV++ PV   PVE+ PV   PVE  PV + PV+  P+    
Sbjct: 837  VEAAPVKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPLVFSK 896

Query: 198  A-------------------------------EKPPVYKPPVYKPPVYKPPVEKPPVYKP 284
            A                               E+ PV   PV + PV   PVE+ PV   
Sbjct: 897  AETFCGLELDLLMESSEFIEGNISRIPQISVTEEKPVEAAPVEEEPVEAAPVEQKPVEAA 956

Query: 285  PVEKPPVYKPPVE 323
            PVE+ PV   PVE
Sbjct: 957  PVEEKPVEAAPVE 969

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 49/151 (32%), Positives = 60/151 (39%), Gaps = 41/151 (27%)
 Frame = +3

Query: 3    VYKPPVEKPPVYK-P----PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV--------- 140
            V + PVE  PV   P    PVE  PV + PV+  PV   PVE+ PV   P+         
Sbjct: 842  VKEKPVEAAPVEAAPVKEKPVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPLVFSKAETFC 901

Query: 141  ---------------------------EKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKP 239
                                       E+ PV   PVE+ PV   P E+ PV   PV + 
Sbjct: 902  GLELDLLMESSEFIEGNISRIPQISVTEEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEEK 961

Query: 240  PVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
            PV   PVE   V +  VE  PV    VE+ P
Sbjct: 962  PVEAAPVEAAKVEEKSVEAVPVEAALVEEKP 992

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 48/144 (33%), Positives = 58/144 (40%), Gaps = 37/144 (25%)
 Frame = +3

Query: 3   VYKPPVEKPPVYK-PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVY------- 158
           V + PVE  PV   P  EK PV   PVE+ PV   PVE  PV + PV+  P+        
Sbjct: 459 VKEKPVEAAPVEAAPVKEK-PVEAAPVEEKPVDAAPVEAAPVEEKPVDAAPLVFSKAEIF 517

Query: 159 -----------------------------KPPVEKPPVYKPPAEKPPVYKPPVYKPPVYK 251
                                        + PVE  PV + P E  PV + PV   PV +
Sbjct: 518 CGLELDLLMESSEFIEGNISRIPQISVTEEKPVEAAPVEEEPVEAAPVEQKPVEAAPVEE 577

Query: 252 PPVEKPPVYKPPVEKPPVYKPPVE 323
            PVE  PV    VE+  V   PVE
Sbjct: 578 KPVEAAPVEAAKVEEKSVEAVPVE 601

[139][TOP]
>UniRef100_UPI000198347E PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vinifera
           RepID=UPI000198347E
          Length = 207

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 72/142 (50%), Positives = 77/142 (54%), Gaps = 32/142 (22%)
 Frame = +3

Query: 3   VYK-PPVEKPPV-YKPPVEKPPVYKPP----VEKPPV-YKPPV---EKPPVYKPPVE-KP 149
           VYK PP+ KPP  YKPP    PVYKPP    VEKPP  YKPP      PPV KPP E KP
Sbjct: 38  VYKSPPLGKPPPEYKPPT---PVYKPPPSPPVEKPPPEYKPPTPVYRPPPVEKPPPEYKP 94

Query: 150 --PVYK-PPVEK-PPVYKPPA----EKPPVYKPPVYKPPVYK-PPVEKPPVYKPPVEKPP 302
             PVYK PPVEK PP YKPP       PP +K P   P V + PP  KPP   P + +PP
Sbjct: 95  PTPVYKPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPP 154

Query: 303 VYK------------PPVEKPP 332
             K            PPVE PP
Sbjct: 155 PTKEPSPPQGHYPGHPPVETPP 176

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 66/127 (51%), Positives = 76/127 (59%), Gaps = 18/127 (14%)
 Frame = +3

Query: 6   YKPPV---EKPPVYKPPVE-KP--PVYKPPVEKPPVYKPPVE-KP--PVYK-PPVEK-PP 152
           +KPP+   + PP+ KPP E KP  PVYKPP   PPV KPP E KP  PVY+ PPVEK PP
Sbjct: 32  HKPPLPVYKSPPLGKPPPEYKPPTPVYKPP-PSPPVEKPPPEYKPPTPVYRPPPVEKPPP 90

Query: 153 VYKPPVEKPPVYKPP--AEKPPVYKPPV----YKPPVYKPPVEKPPVYK-PPVEKPPVYK 311
            YKPP    PVYKPP   + PP YKPP       PP +K P   P V + PP  KPP   
Sbjct: 91  EYKPPT---PVYKPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLP 147

Query: 312 PPVEKPP 332
           P + +PP
Sbjct: 148 PIIVRPP 154

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 67/119 (56%), Positives = 73/119 (61%), Gaps = 16/119 (13%)
 Frame = +3

Query: 24  KPPVY--KPPV---EKPPVYKPPVE-KP--PVYKPPVEKPPVYKPPVE-KP--PVYK-PP 167
           KPP Y  KPP+   + PP+ KPP E KP  PVYKPP   PPV KPP E KP  PVY+ PP
Sbjct: 26  KPPPYEHKPPLPVYKSPPLGKPPPEYKPPTPVYKPP-PSPPVEKPPPEYKPPTPVYRPPP 84

Query: 168 VEK-PPVYKPPAEKPPVYKPPVYK--PPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKPP 332
           VEK PP YKPP    PVYKPP  +  PP YKPP   KPP   PP  K P   P V +PP
Sbjct: 85  VEKPPPEYKPPT---PVYKPPPVEKPPPEYKPPTPVKPP--PPPKHKTPTLPPRVVRPP 138

 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 44/113 (38%), Positives = 51/113 (45%), Gaps = 31/113 (27%)
 Frame = +3

Query: 3   VYKPP-VEKPPV-YKPPVE-KPP--------------VYKPPVEKPPVYKPPVEKPPVYK 131
           VYKPP VEKPP  YKPP   KPP              V  PP  KPP   P + +PP  K
Sbjct: 98  VYKPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPPPTK 157

Query: 132 ------------PPVEKPPVYKPPVEKPPVYKPPAEKP--PVYKPPVYKPPVY 248
                       PPVE PP    P +KPP    P +KP  P +K     PP++
Sbjct: 158 EPSPPQGHYPGHPPVETPP--STPYKKPPT---PEKKPWAPHHKHFKAPPPIH 205

[140][TOP]
>UniRef100_Q9M4I2 Putative proline-rich cell wall protein n=1 Tax=Vitis vinifera
           RepID=Q9M4I2_VITVI
          Length = 204

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 71/142 (50%), Positives = 78/142 (54%), Gaps = 32/142 (22%)
 Frame = +3

Query: 3   VYK-PPVEKPPV-YKPPVEKPPVYKP-PVEKP--------PVYK-PPVEK-PPVYKPPVE 143
           VYK PP+ KPP  YKPP    PVY+P PVEKP        PVYK PPVEK PP YKPP  
Sbjct: 38  VYKSPPLGKPPPEYKPPT---PVYRPPPVEKPPPEYKPLTPVYKSPPVEKPPPEYKPPT- 93

Query: 144 KPPVYK-PPVEK-PPVYKPPA----EKPPVYKPPVYKPPVYK-PPVEKPPVYKPPVEKPP 302
             PVY+ PPVEK PP YKPP       PP +K P   P V + PP  KPP   P + +PP
Sbjct: 94  --PVYRPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPPIIVRPP 151

Query: 303 VYK------------PPVEKPP 332
             K            PPVE PP
Sbjct: 152 PTKEPSPPHGHYPGHPPVETPP 173

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 65/126 (51%), Positives = 74/126 (58%), Gaps = 17/126 (13%)
 Frame = +3

Query: 6   YKPPVEKPPVYK-PPVEKPPV-YKPPV---EKPPVYKPPVE-KP--PVYK-PPVEK-PPV 155
           +KPP+   PVYK PP+ KPP  YKPP      PPV KPP E KP  PVYK PPVEK PP 
Sbjct: 32  HKPPL---PVYKSPPLGKPPPEYKPPTPVYRPPPVEKPPPEYKPLTPVYKSPPVEKPPPE 88

Query: 156 YKPPVEKPPVYKPP--AEKPPVYKPPV----YKPPVYKPPVEKPPVYK-PPVEKPPVYKP 314
           YKPP    PVY+PP   + PP YKPP       PP +K P   P V + PP  KPP   P
Sbjct: 89  YKPPT---PVYRPPPVEKPPPEYKPPTPVKPPPPPKHKTPTLPPRVVRPPPTPKPPTLPP 145

Query: 315 PVEKPP 332
            + +PP
Sbjct: 146 IIVRPP 151

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 66/121 (54%), Positives = 72/121 (59%), Gaps = 18/121 (14%)
 Frame = +3

Query: 24  KPPVY--KPPVEKPPVYK-PPVEKPPV-YKPPVEKPPVYKP-PVEKP--------PVYK- 161
           KPP Y  KPP+   PVYK PP+ KPP  YKPP    PVY+P PVEKP        PVYK 
Sbjct: 26  KPPPYEHKPPL---PVYKSPPLGKPPPEYKPPT---PVYRPPPVEKPPPEYKPLTPVYKS 79

Query: 162 PPVEK-PPVYKPPAEKPPVYKPPVYK--PPVYKPPVE-KPPVYKPPVEKPPVYKPPVEKP 329
           PPVEK PP YKPP    PVY+PP  +  PP YKPP   KPP   PP  K P   P V +P
Sbjct: 80  PPVEKPPPEYKPPT---PVYRPPPVEKPPPEYKPPTPVKPP--PPPKHKTPTLPPRVVRP 134

Query: 330 P 332
           P
Sbjct: 135 P 135

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 59/117 (50%), Positives = 64/117 (54%), Gaps = 7/117 (5%)
 Frame = +3

Query: 3   VYK-PPVEKPPV-YKPPVEKPPVYKP-PVEK-PPVYKPPVE-KPPVYKPPVEKPPVYKPP 167
           VYK PPVEKPP  YKPP    PVY+P PVEK PP YKPP   KPP   PP  K P   P 
Sbjct: 76  VYKSPPVEKPPPEYKPPT---PVYRPPPVEKPPPEYKPPTPVKPP--PPPKHKTPTLPPR 130

Query: 168 VEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVY--KPPVEKPPVYKPPVEKPP 332
           V +P    PP  KPP   P + +PP  K P      Y   PPVE PP    P +KPP
Sbjct: 131 VVRP----PPTPKPPTLPPIIVRPPPTKEPSPPHGHYPGHPPVETPP--STPYKKPP 181

[141][TOP]
>UniRef100_Q39863 Soybean (G.max) hydroproline-rich protein (Fragment) n=1
           Tax=Glycine max RepID=Q39863_SOYBN
          Length = 121

 Score = 97.1 bits (240), Expect = 6e-19
 Identities = 61/119 (51%), Positives = 74/119 (62%), Gaps = 15/119 (12%)
 Frame = +1

Query: 1   RFTS-----PQLRNHQCTSPQ*RSHRCTSLQLRSHP-----CTSPQLRSHLFTNL----- 135
           RFTS     PQL+NH   S Q  SH+CTSLQ  SHP     CTS QLRSH +TN      
Sbjct: 3   RFTSLQCINPQLKNHPFISHQFTSHQCTSLQFTSHPFTSHQCTSHQLRSHQYTNHPFISH 62

Query: 136 RWRSHQCTSPQLRNPQFTSPRRRSPQFTSPRFTSHRCTSPQLRSHQCTSPQLRSHLCTS 312
           ++ SHQCTS QLR+ Q TS +  S Q+T+ +F S +CTS Q  +HQ  S QLR+ L TS
Sbjct: 63  QFTSHQCTSHQLRSHQCTSLQCTSHQYTNHQFISLQCTSHQYTNHQFISLQLRNLLFTS 121

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 46/92 (50%), Positives = 58/92 (63%)
 Frame = +1

Query: 55  SHRCTSLQLRSHPCTSPQLRSHLFTNLRWRSHQCTSPQLRNPQFTSPRRRSPQFTSPRFT 234
           +HR TSLQ     C +PQL++H F + ++ SHQCTS Q  +  FTS +  S Q  S ++T
Sbjct: 1   NHRFTSLQ-----CINPQLKNHPFISHQFTSHQCTSLQFTSHPFTSHQCTSHQLRSHQYT 55

Query: 235 SHRCTSPQLRSHQCTSPQLRSHLCTSPQLRSH 330
           +H   S Q  SHQCTS QLRSH CTS Q  SH
Sbjct: 56  NHPFISHQFTSHQCTSHQLRSHQCTSLQCTSH 87

[142][TOP]
>UniRef100_UPI0000D9B337 PREDICTED: hypothetical protein n=1 Tax=Macaca mulatta
           RepID=UPI0000D9B337
          Length = 376

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 49/109 (44%), Positives = 52/109 (47%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y+PP    P Y PP   PP Y  P   PP Y  P   PP Y  P  +PP Y PP   PP 
Sbjct: 131 YRPPEYGTPEYGPPEYGPPKYGTPECGPPEYGTPEYGPPEYGTPEYRPPKYGPPEYGPPE 190

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y  P   PP Y  P Y PP Y  P   PP Y PP   PP Y+PP   PP
Sbjct: 191 YGTPKCGPPEYGTPEYGPPEYGTPEYGPPKYGPPEYGPPEYRPPEYGPP 239

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 49/109 (44%), Positives = 51/109 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP   PP Y  P   PP Y  P   PP Y  P  +PP Y PP   PP Y  P   PP 
Sbjct: 141 YGPPEYGPPKYGTPECGPPEYGTPEYGPPEYGTPEYRPPKYGPPEYGPPEYGTPKCGPPE 200

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y  P   PP Y  P Y PP Y PP   PP Y+PP   PP Y  P   PP
Sbjct: 201 YGTPEYGPPEYGTPEYGPPKYGPPEYGPPEYRPPEYGPPEYGTPEYGPP 249

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 49/109 (44%), Positives = 51/109 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y  P   PP Y  P  +PP Y PP   PP Y  P   PP Y  P   PP Y  P   PP 
Sbjct: 161 YGTPEYGPPEYGTPEYRPPKYGPPEYGPPEYGTPKCGPPEYGTPEYGPPEYGTPEYGPPK 220

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y PP   PP Y+PP Y PP Y  P   PP Y P    PP Y PP   PP
Sbjct: 221 YGPPEYGPPEYRPPEYGPPEYGTPEYGPPKYGPLECGPPEYGPPEYGPP 269

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 49/109 (44%), Positives = 51/109 (46%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP   PP Y+PP   PP Y  P   PP Y P    PP Y PP   PP Y  P    P 
Sbjct: 221 YGPPEYGPPEYRPPEYGPPEYGTPEYGPPKYGPLECGPPEYGPPEYGPPEYGTPEYGTPE 280

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y PP   PP   PP Y  P Y PP   PP Y PP   PP Y PP  + P
Sbjct: 281 YGPPECGPPECGPPEYGTPEYGPPEYGPPEYGPPEYGPPEYGPPEYETP 329

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 49/114 (42%), Positives = 52/114 (45%), Gaps = 5/114 (4%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP    P Y+PP    P Y PP   PP Y  P   PP Y  P   PP Y  P  +PP 
Sbjct: 121 YGPPEYGTPEYRPPEYGTPEYGPPEYGPPKYGTPECGPPEYGTPEYGPPEYGTPEYRPPK 180

Query: 186 YKPPAEKPPVY-----KPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y PP   PP Y      PP Y  P Y PP    P Y PP   PP Y PP  +PP
Sbjct: 181 YGPPEYGPPEYGTPKCGPPEYGTPEYGPPEYGTPEYGPPKYGPPEYGPPEYRPP 234

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 47/104 (45%), Positives = 49/104 (47%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y  P  +PP Y PP   PP Y  P   PP Y  P   PP Y  P   PP Y PP   PP 
Sbjct: 171 YGTPEYRPPKYGPPEYGPPEYGTPKCGPPEYGTPEYGPPEYGTPEYGPPKYGPPEYGPPE 230

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           Y+PP   PP Y  P Y PP Y P    PP Y PP   PP Y  P
Sbjct: 231 YRPPEYGPPEYGTPEYGPPKYGPLECGPPEYGPPEYGPPEYGTP 274

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 48/109 (44%), Positives = 50/109 (45%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y  P   PP Y  P   PP Y  P  +PP Y PP   PP Y  P   PP Y  P   PP 
Sbjct: 151 YGTPECGPPEYGTPEYGPPEYGTPEYRPPKYGPPEYGPPEYGTPKCGPPEYGTPEYGPPE 210

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y  P   PP Y PP Y PP Y+PP   PP Y  P   PP Y P    PP
Sbjct: 211 YGTPEYGPPKYGPPEYGPPEYRPPEYGPPEYGTPEYGPPKYGPLECGPP 259

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/109 (43%), Positives = 49/109 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP   PP Y PP  +PP Y PP   P  Y  P   P  Y  P   PP Y PP    P 
Sbjct: 41  YGPPEYGPPEYGPPEYRPPEYGPPEYGPLEYGTPEYGPLEYGTPEYGPPEYGPPEYGTPE 100

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y  P   PP Y PP Y  P Y PP    P Y+PP    P Y PP   PP
Sbjct: 101 YGTPESGPPEYGPPEYGTPEYGPPEYGTPEYRPPEYGTPEYGPPEYGPP 149

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/109 (43%), Positives = 49/109 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP    P Y  P   PP Y PP    P Y PP    P Y+PP    P Y PP   PP 
Sbjct: 91  YGPPEYGTPEYGTPESGPPEYGPPEYGTPEYGPPEYGTPEYRPPEYGTPEYGPPEYGPPK 150

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y  P   PP Y  P Y PP Y  P  +PP Y PP   PP Y  P   PP
Sbjct: 151 YGTPECGPPEYGTPEYGPPEYGTPEYRPPKYGPPEYGPPEYGTPKCGPP 199

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 47/109 (43%), Positives = 49/109 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y  P   PP Y PP    P Y PP    P Y+PP    P Y PP   PP Y  P   PP 
Sbjct: 101 YGTPESGPPEYGPPEYGTPEYGPPEYGTPEYRPPEYGTPEYGPPEYGPPKYGTPECGPPE 160

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y  P   PP Y  P Y+PP Y PP   PP Y  P   PP Y  P   PP
Sbjct: 161 YGTPEYGPPEYGTPEYRPPKYGPPEYGPPEYGTPKCGPPEYGTPEYGPP 209

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 48/109 (44%), Positives = 49/109 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP    P Y PP   PP Y PP  +PP Y PP    P Y PP   P    PP   PP 
Sbjct: 206 YGPPEYGTPEYGPPKYGPPEYGPPEYRPPEYGPPEYGTPEYGPPKYGPLECGPPEYGPPE 265

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y PP    P Y  P Y PP   PP   PP Y  P   PP Y PP   PP
Sbjct: 266 YGPPEYGTPEYGTPEYGPPECGPPECGPPEYGTPEYGPPEYGPPEYGPP 314

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 48/109 (44%), Positives = 49/109 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y  P   PP Y PP   PP Y+PP   PP Y  P   PP Y P    PP Y PP   PP 
Sbjct: 211 YGTPEYGPPKYGPPEYGPPEYRPPEYGPPEYGTPEYGPPKYGPLECGPPEYGPPEYGPPE 270

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y  P    P Y PP   PP   PP    P Y PP   PP Y PP   PP
Sbjct: 271 YGTPEYGTPEYGPPECGPPECGPPEYGTPEYGPPEYGPPEYGPPEYGPP 319

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 48/109 (44%), Positives = 50/109 (45%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y+PP   PP Y  P   PP Y P    PP Y PP   PP Y  P    P Y PP   PP 
Sbjct: 231 YRPPEYGPPEYGTPEYGPPKYGPLECGPPEYGPPEYGPPEYGTPEYGTPEYGPPECGPPE 290

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PP    P Y PP Y PP Y PP   PP Y PP  + P Y  P   PP
Sbjct: 291 CGPPEYGTPEYGPPEYGPPEYGPPEYGPPEYGPPEYETPKYGTPECGPP 339

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 48/109 (44%), Positives = 49/109 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP   PP Y  P   PP Y  P   PP Y  P   PP Y PP   PP Y+PP   PP 
Sbjct: 181 YGPPEYGPPEYGTPKCGPPEYGTPEYGPPEYGTPEYGPPKYGPPEYGPPEYRPPEYGPPE 240

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y  P   PP Y P    PP Y PP   PP Y  P    P Y PP   PP
Sbjct: 241 YGTPEYGPPKYGPLECGPPEYGPPEYGPPEYGTPEYGTPEYGPPECGPP 289

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 48/109 (44%), Positives = 49/109 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y  P   PP Y  P   PP Y PP   PP Y+PP   PP Y  P   PP Y P    PP 
Sbjct: 201 YGTPEYGPPEYGTPEYGPPKYGPPEYGPPEYRPPEYGPPEYGTPEYGPPKYGPLECGPPE 260

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y PP   PP Y  P Y  P Y PP   PP   PP    P Y PP   PP
Sbjct: 261 YGPPEYGPPEYGTPEYGTPEYGPPECGPPECGPPEYGTPEYGPPEYGPP 309

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 47/109 (43%), Positives = 49/109 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y PP    P Y PP    P Y+PP    P Y PP   PP Y  P   PP Y  P   PP 
Sbjct: 111 YGPPEYGTPEYGPPEYGTPEYRPPEYGTPEYGPPEYGPPKYGTPECGPPEYGTPEYGPPE 170

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y  P  +PP Y PP Y PP Y  P   PP Y  P   PP Y  P   PP
Sbjct: 171 YGTPEYRPPKYGPPEYGPPEYGTPKCGPPEYGTPEYGPPEYGTPEYGPP 219

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 46/109 (42%), Positives = 48/109 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y  P   PP Y PP    P Y  P   PP Y PP    P Y PP    P Y+PP    P 
Sbjct: 81  YGTPEYGPPEYGPPEYGTPEYGTPESGPPEYGPPEYGTPEYGPPEYGTPEYRPPEYGTPE 140

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           Y PP   PP Y  P   PP Y  P   PP Y  P  +PP Y PP   PP
Sbjct: 141 YGPPEYGPPKYGTPECGPPEYGTPEYGPPEYGTPEYRPPKYGPPEYGPP 189

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 46/104 (44%), Positives = 47/104 (45%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y  P   PP Y  P   PP Y  P   PP Y PP   PP Y+PP   PP Y  P   PP 
Sbjct: 191 YGTPKCGPPEYGTPEYGPPEYGTPEYGPPKYGPPEYGPPEYRPPEYGPPEYGTPEYGPPK 250

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           Y P    PP Y PP Y PP Y  P    P Y PP   PP   PP
Sbjct: 251 YGPLECGPPEYGPPEYGPPEYGTPEYGTPEYGPPECGPPECGPP 294

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 48/124 (38%), Positives = 51/124 (41%), Gaps = 15/124 (12%)
 Frame = +3

Query: 6   YKPPVEKPPVYKP---------------PVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 140
           Y+PP   PP Y P               P   PP Y PP    P Y  P   PP Y PP 
Sbjct: 56  YRPPEYGPPEYGPLEYGTPEYGPLEYGTPEYGPPEYGPPEYGTPEYGTPESGPPEYGPPE 115

Query: 141 EKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPV 320
              P Y PP    P Y+PP    P Y PP Y PP Y  P   PP Y  P   PP Y  P 
Sbjct: 116 YGTPEYGPPEYGTPEYRPPEYGTPEYGPPEYGPPKYGTPECGPPEYGTPEYGPPEYGTPE 175

Query: 321 EKPP 332
            +PP
Sbjct: 176 YRPP 179

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 45/104 (43%), Positives = 46/104 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y  P   PP Y P    PP Y PP   PP Y  P    P Y PP   PP   PP    P 
Sbjct: 241 YGTPEYGPPKYGPLECGPPEYGPPEYGPPEYGTPEYGTPEYGPPECGPPECGPPEYGTPE 300

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           Y PP   PP Y PP Y PP Y PP  + P Y  P   PP Y  P
Sbjct: 301 YGPPEYGPPEYGPPEYGPPEYGPPEYETPKYGTPECGPPEYGAP 344

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 45/104 (43%), Positives = 46/104 (44%)
 Frame = +3

Query: 6   YKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPV 185
           Y P    PP Y PP   PP Y  P    P Y PP   PP   PP    P Y PP   PP 
Sbjct: 251 YGPLECGPPEYGPPEYGPPEYGTPEYGTPEYGPPECGPPECGPPEYGTPEYGPPEYGPPE 310

Query: 186 YKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPP 317
           Y PP   PP Y PP Y+ P Y  P   PP Y  P    P Y PP
Sbjct: 311 YGPPEYGPPEYGPPEYETPKYGTPECGPPEYGAPEYGTPEYGPP 354

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 34/77 (44%), Positives = 35/77 (45%)
 Frame = +3

Query: 87  PPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEK 266
           P  Y PP   PP Y PP  +PP Y PP   P  Y  P   P  Y  P Y PP Y PP   
Sbjct: 38  PTGYGPPEYGPPEYGPPEYRPPEYGPPEYGPLEYGTPEYGPLEYGTPEYGPPEYGPPEYG 97

Query: 267 PPVYKPPVEKPPVYKPP 317
            P Y  P   PP Y PP
Sbjct: 98  TPEYGTPESGPPEYGPP 114

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 31/72 (43%), Positives = 32/72 (44%)
 Frame = +3

Query: 117 PPVYKPPVEKPPVYKPPVEKPPVYKPPAEKPPVYKPPVYKPPVYKPPVEKPPVYKPPVEK 296
           P  Y PP   PP Y PP  +PP Y PP   P  Y  P Y P  Y  P   PP Y PP   
Sbjct: 38  PTGYGPPEYGPPEYGPPEYRPPEYGPPEYGPLEYGTPEYGPLEYGTPEYGPPEYGPPEYG 97

Query: 297 PPVYKPPVEKPP 332
            P Y  P   PP
Sbjct: 98  TPEYGTPESGPP 109

[143][TOP]
>UniRef100_UPI0001985C48 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera
           RepID=UPI0001985C48
          Length = 533

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 59/116 (50%), Positives = 66/116 (56%), Gaps = 8/116 (6%)
 Frame = +3

Query: 9   KPPVEKPPVYKPPVEKPPVYKPP----VEKPPVYKPP-VEKPPVYKPP-VEKPPVYKPP- 167
           KPP  K P+   P + PP  KPP      KPP  KPP V  PPV +PP V KPPV  PP 
Sbjct: 334 KPPKVKHPLPPLPPKHPPHVKPPHTPMPPKPPAVKPPYVPNPPVVEPPYVPKPPVLNPPH 393

Query: 168 VEKPPVYKPPAEKPP-VYKPPVYKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
           V KPP+ +PP  KPP V KPPV +PP   PPV  PP   PP   PP   PP  +PP
Sbjct: 394 VPKPPIVRPPVVKPPYVPKPPVVQPP--PPPVVHPP--PPPTPCPPPPPPPKGRPP 445

 Score = 93.2 bits (230), Expect = 8e-18
 Identities = 56/111 (50%), Positives = 62/111 (55%), Gaps = 4/111 (3%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP-VEKPPV 185
           P   KPP  K P+   P   PP  KPP + P   KPP  KPP V  PPV +PP V KPPV
Sbjct: 330 PTPPKPPKVKHPLPPLPPKHPPHVKPP-HTPMPPKPPAVKPPYVPNPPVVEPPYVPKPPV 388

Query: 186 YKPP-AEKPPVYKPPVYKPP-VYKPPVEKPPVYKPPVEKPPVYKPPVEKPP 332
             PP   KPP+ +PPV KPP V KPPV +PP   PPV  PP    P   PP
Sbjct: 389 LNPPHVPKPPIVRPPVVKPPYVPKPPVVQPP--PPPVVHPPPPPTPCPPPP 437

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 52/103 (50%), Positives = 61/103 (59%), Gaps = 8/103 (7%)
 Frame = +3

Query: 12  PPVEKPPVYKPPVEKPPVYKPP-VEKPPVYKPP-VEKPPVYKPP-VEKPPVYKPPVEKPP 182
           PP  KPP + P   KPP  KPP V  PPV +PP V KPPV  PP V KPP+ +PPV KPP
Sbjct: 350 PPHVKPP-HTPMPPKPPAVKPPYVPNPPVVEPPYVPKPPVLNPPHVPKPPIVRPPVVKPP 408

Query: 183 -VYKPPAEKPP----VYKPPVYKPPVYKPPVEKPPVYKPPVEK 296
            V KPP  +PP    V+ PP   PP   PP   PP  +PP ++
Sbjct: 409 YVPKPPVVQPPPPPVVHPPP---PPTPCPPPPPPPKGRPPPQQ 448

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 49/90 (54%), Positives = 56/90 (62%), Gaps = 4/90 (4%)
 Frame = +3

Query: 9   KPPVEKPP-VYKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPVYKPP-VEKPPVYKPPVEK 176
           KPP  KPP V  PPV +PP V KPPV  PP V KPP+ +PPV KPP V KPPV +PP   
Sbjct: 363 KPPAVKPPYVPNPPVVEPPYVPKPPVLNPPHVPKPPIVRPPVVKPPYVPKPPVVQPP--P 420

Query: 177 PPVYKPPAEKPPVYKPPVYKPPVYKPPVEK 266
           PPV  PP   PP   PP   PP  +PP ++
Sbjct: 421 PPVVHPPP--PPTPCPPPPPPPKGRPPPQQ 448

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/78 (55%), Positives = 48/78 (61%), Gaps = 3/78 (3%)
 Frame = +3

Query: 3   VYKPPVEKPP-VYKPPVEKPP-VYKPPVEKPPVYKPP-VEKPPVYKPPVEKPPVYKPPVE 173
           V  PPV +PP V KPPV  PP V KPP+ +PPV KPP V KPPV +PP   PPV  PP  
Sbjct: 372 VPNPPVVEPPYVPKPPVLNPPHVPKPPIVRPPVVKPPYVPKPPVVQPP--PPPVVHPP-- 427

Query: 174 KPPVYKPPAEKPPVYKPP 227
            PP   PP   PP  +PP
Sbjct: 428 PPPTPCPPPPPPPKGRPP 445

 Score = 65.1 bits (157), Expect = 2e-09
 I