KCC000552A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000552A_C01 KCC000552A_c01
CTAGCTCTTACACCTGAGCTCCACTATTTTATAGCACAATGGCCATGCTGTCCTCCCGCC
GTGTGGCCGCCCCGGCCAAGGCTTCGGCCATTCGCCGCTCGCGCGTTATGCCGGTGGTGC
GCGCTGCCGCTGCCTCGTCGGAGGTGCCCGACATGAACAAGCGCAACATCATGAACCTGA
TCCTGGCTGGTGGCGCTGGTCTGCCCATCACCACCCTGGCCTCTGGGCCTACGGTGCCTT
CTTCGTGCCCCCCAGCTCTGGCTGGTGTGCGGCTGGTGGCCAGGTGCGCTAAGGACGCTC
TGGGCAACGACATCAAGGCCGGGGCAGTGGCTGAAGACCCACCTGGGCTGGTGACCGCTC
GCTGTCCCAGGGCCTGAAGGGTGACCCCACCTACCTGATCGTCACCGCCGACAGCACCAT
CGAGAAGTACGGCCTGAACGCCGTGTGCACTCACCTGGGCTGCGTCGTGCCTTGGGTGGC
GGCCGAGAACAAGTTCAAGTGCCCTTGCCACGGCTCTCAGTACAACGCTGAGGGCAAGGT
GGTCCGTGGCCCCGCTCCCCTGTCGCTGGCCCTGGCCCACTGCGACGTGGCTGAGTCTGG
CCTGGTCACCTTCTCCACCTGGACGGAGACTGACTTCCGTACCGGCCTGGAGCCCTGGTG
GGCGTAAATCCGCTCCTGCTACTGCCGCGTTTTGACGGCGCAGCTGCTACAGCCGCGGCC
CGCGTGTTGATTGTCTCTCTCAGCCAGGCCGCTTCGGCGGCGGCCACGTTCGCTGCTGGT
GAAGCAGTGGACGCGGGGGCGGGAGGCCGGAGCGTGGAGCTGCGGCGGCAGCAGCAGCGG
CGCCAGGCAGTGCTGGGCGTGTCGCTTGTACGTTGTTGCTGATGAGTGGAGGAGATGACA
AGGGCGGGAGCAGAGCAGGAGGGCCTGGGGGCAGCGTCTGCCGGCCGTGCGCACCGGACC
CTGGCCGCCACGGAGGAAGTTTTGGTTCCGGGCGCCGTCGCGCTCTTACGCGCGGGCGCC
TTTTCTGTGGCGTACCCAGGGGAATTTTTAGCGTGCCGCGGTCTGGTGCATAGGGGCGCG
TGTGGGGCGCTAGCGCGTCCCGTGGCGGCGGGCCGAATGGCCGTGTCGCCCACCCGCAGC
GCTCCTTTGCCAGGGTGTGCCGACCCGGCACGCGGGCGTGTTACGTTTCGGGCTCTGAGC
GGGCGGTTGCTGTGTCGGTGTGGGTTTGGCACCGGACGTAGCGGCGTGGCACTGGGCGTC
GCGATGAGGGAGAGTGGAGAAGACTTCAGAGATTATTGCGTTAGTGCATTTGATGCAAAT
TAAGAGTCGATGCCTCTCGGGCGGCGGGCCTGGTGCTGCCGCCGGGGGCGGGTGCCATGT
GAATGCTGCGCCGTGCCCGCGGCGGACGCATGCGCCTGTAACTCGgaagaacc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000552A_C01 KCC000552A_c01
         (1433 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P49728|UCRI_CHLRE Cytochrome B6-F complex iron-sulfur subunit...   245  2e-63
sp|Q9SBN3|UCRI_VOLCA Cytochrome B6-F complex iron-sulfur subunit...   234  3e-60
gb|AAC04807.1| cytochrome B6-F complex iron-sulfur subunit precu...   189  1e-46
gb|AAC78103.1| Rieske Fe-S precursor protein [Oryza sativa]           183  8e-45
emb|CAC03598.1| Rieske FeS protein [Arabidopsis thaliana]             181  2e-44

>sp|P49728|UCRI_CHLRE Cytochrome B6-F complex iron-sulfur subunit, chloroplast precursor
           (Rieske iron-sulfur protein) (RISP)
           gi|541541|pir||A53412 probable plastoquinol-plastocyanin
           reductase (EC 1.10.99.1) Rieske iron-sulfur protein -
           Chlamydomonas reinhardtii gi|510968|emb|CAA53947.1|
           rieske iron-sulfur protein of cytochrome B6/F complex
           [Chlamydomonas reinhardtii] gi|2381483|dbj|BAA22147.1|
           chloroplast Rieske Fe-S precursor protein [Chlamydomonas
           reinhardtii]
          Length = 206

 Score =  245 bits (625), Expect = 2e-63
 Identities = 122/145 (84%), Positives = 124/145 (85%)
 Frame = +2

Query: 230 YGAFFVPPSSGWCAAGGQVR*GRSGQRHQGRGSG*RPTWAGDRSLSQGLKGDPTYLIVTA 409
           YGAFFVPPSSG    GGQ      G   +  G   +   AGDRSLSQGLKGDPTYLIVTA
Sbjct: 64  YGAFFVPPSSGG-GGGGQAAKDALGNDIKA-GEWLKTHLAGDRSLSQGLKGDPTYLIVTA 121

Query: 410 DSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDV 589
           DSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDV
Sbjct: 122 DSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDV 181

Query: 590 AESGLVTFSTWTETDFRTGLEPWWA 664
           AESGLVTFSTWTETDFRTGLEPWWA
Sbjct: 182 AESGLVTFSTWTETDFRTGLEPWWA 206

 Score =  131 bits (330), Expect = 3e-29
 Identities = 76/95 (80%), Positives = 79/95 (83%)
 Frame = +3

Query: 39  MAMLSSRRVAAPAKASAIRRSRVMPVVRAAAASSEVPDMNKRNIMNLILAGGAGLPITTL 218
           MAMLSSRRVAAPAKASAIRRSRVMPVVRAAAASSEVPDMNKRNIMNLILAGGAGLPITTL
Sbjct: 1   MAMLSSRRVAAPAKASAIRRSRVMPVVRAAAASSEVPDMNKRNIMNLILAGGAGLPITTL 60

Query: 219 ASGPTVPSSCPPALAGVRLVARCAKDALGNDIKAG 323
           A G    +   P  +G     + AKDALGNDIKAG
Sbjct: 61  ALG--YGAFFVPPSSGGGGGGQAAKDALGNDIKAG 93

>sp|Q9SBN3|UCRI_VOLCA Cytochrome B6-F complex iron-sulfur subunit, chloroplast precursor
           (Rieske iron-sulfur protein) (RISP)
           gi|5902590|gb|AAD55565.1|AF110783_1 rieske iron-sulfur
           protein precursor [Volvox carteri f. nagariensis]
          Length = 206

 Score =  234 bits (597), Expect = 3e-60
 Identities = 117/150 (78%), Positives = 120/150 (80%), Gaps = 5/150 (3%)
 Frame = +2

Query: 230 YGAFFVPPSSGWCAAGGQVR*GRSGQRHQGRGSG*RPTWA-----GDRSLSQGLKGDPTY 394
           YGAFFVPPSSG   +GGQ      G   +         W      GDRSLSQGLKGDPTY
Sbjct: 64  YGAFFVPPSSGG-GSGGQAAKDALGNDIKANA------WLATHQKGDRSLSQGLKGDPTY 116

Query: 395 LIVTADSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLAL 574
           LIVTAD TIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLAL
Sbjct: 117 LIVTADGTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLAL 176

Query: 575 AHCDVAESGLVTFSTWTETDFRTGLEPWWA 664
           AHCDV E GLVTFSTW+ETDFRTGLEPWWA
Sbjct: 177 AHCDVQEDGLVTFSTWSETDFRTGLEPWWA 206

 Score =  109 bits (273), Expect = 1e-22
 Identities = 63/96 (65%), Positives = 70/96 (72%)
 Frame = +3

Query: 39  MAMLSSRRVAAPAKASAIRRSRVMPVVRAAAASSEVPDMNKRNIMNLILAGGAGLPITTL 218
           MAM++SRR AAP KA A RRSRVM VVRAAA SSEVPDMNKRNIMNLIL GGA LP+ +L
Sbjct: 1   MAMITSRRAAAPCKAQATRRSRVMSVVRAAAVSSEVPDMNKRNIMNLILLGGASLPVGSL 60

Query: 219 ASGPTVPSSCPPALAGVRLVARCAKDALGNDIKAGA 326
           A G    +   P  +G     + AKDALGNDIKA A
Sbjct: 61  ALG--YGAFFVPPSSGGGSGGQAAKDALGNDIKANA 94

>gb|AAC04807.1| cytochrome B6-F complex iron-sulfur subunit precursor [Fritillaria
           agrestis]
          Length = 230

 Score =  189 bits (479), Expect = 1e-46
 Identities = 91/145 (62%), Positives = 105/145 (71%)
 Frame = +2

Query: 230 YGAFFVPPSSGWCAAGGQVR*GRSGQRHQGRGSG*RPTWAGDRSLSQGLKGDPTYLIVTA 409
           YGAFFVPPSSG    GG V     G       +  +    GDR+L+QGL+GDPTYL+V  
Sbjct: 88  YGAFFVPPSSGG-GGGGIVAKDAVGNDIVA-AAWLKTHGPGDRTLAQGLRGDPTYLVVEN 145

Query: 410 DSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDV 589
           D ++  YG+NAVCTHLGCVVPW  AENKF CPCHGSQYN +GKVVRGPAPLSLAL+HCD+
Sbjct: 146 DRSLATYGINAVCTHLGCVVPWNKAENKFLCPCHGSQYNNQGKVVRGPAPLSLALSHCDI 205

Query: 590 AESGLVTFSTWTETDFRTGLEPWWA 664
           +E G V F  W ETDFRTG  PWW+
Sbjct: 206 SEEGKVVFVPWVETDFRTGENPWWS 230

 Score = 41.6 bits (96), Expect = 0.035
 Identities = 30/79 (37%), Positives = 38/79 (47%), Gaps = 3/79 (3%)
 Frame = +3

Query: 99  SRVMPVVRAAAASSEVPDMNKRNIMNLILAGGAGLPITTLASGPTVPSSC---PPALAGV 269
           SR +     +  +  VPDM KR  MNL+L G   LP     +G  +P      PP+  G 
Sbjct: 45  SRKVTCQATSIPADRVPDMGKRQTMNLLLLGALSLP----TAGMLIPYGAFFVPPSSGGG 100

Query: 270 RLVARCAKDALGNDIKAGA 326
                 AKDA+GNDI A A
Sbjct: 101 G-GGIVAKDAVGNDIVAAA 118

>gb|AAC78103.1| Rieske Fe-S precursor protein [Oryza sativa]
          Length = 225

 Score =  183 bits (464), Expect = 8e-45
 Identities = 92/145 (63%), Positives = 103/145 (70%)
 Frame = +2

Query: 230 YGAFFVPPSSGWCAAGGQVR*GRSGQRHQGRGSG*RPTWAGDRSLSQGLKGDPTYLIVTA 409
           YGAFF+P  SG  A GGQV   + G          +     DR+L+QGLKGDPTYL+V A
Sbjct: 84  YGAFFIPAGSG-NAGGGQVAKDKLGNDVLAE-EWLKTHGPNDRTLTQGLKGDPTYLVVEA 141

Query: 410 DSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDV 589
           D T+  YG+NAVCTHLGCVVPW AAENKF CPCHGSQYN +G+VVRGPAPLSLAL H DV
Sbjct: 142 DKTLATYGINAVCTHLGCVVPWNAAENKFICPCHGSQYNNQGRVVRGPAPLSLALVHADV 201

Query: 590 AESGLVTFSTWTETDFRTGLEPWWA 664
            + G V F  W ETDFRTG  PWWA
Sbjct: 202 -DDGKVLFVPWVETDFRTGDNPWWA 225

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 38/104 (36%), Positives = 45/104 (42%), Gaps = 9/104 (8%)
 Frame = +3

Query: 36  TMAMLSSRRVAAPAKASAIRRSRV---MPVVRAAAASS----EVPDMNKRNIMNLILAGG 194
           T    S   +  P K     R RV      +   AASS     VPDM KR +MNL+L G 
Sbjct: 13  TQLCRSRASLGKPVKGLGFGRERVPRTATTITCQAASSIPADRVPDMGKRQLMNLLLLGA 72

Query: 195 AGLPITTLASGPTVPSSC--PPALAGVRLVARCAKDALGNDIKA 320
             LP      G  VP      PA +G     + AKD LGND+ A
Sbjct: 73  ISLPTV----GMLVPYGAFFIPAGSGNAGGGQVAKDKLGNDVLA 112

>emb|CAC03598.1| Rieske FeS protein [Arabidopsis thaliana]
          Length = 229

 Score =  181 bits (460), Expect = 2e-44
 Identities = 86/145 (59%), Positives = 99/145 (67%)
 Frame = +2

Query: 230 YGAFFVPPSSGWCAAGGQVR*GRSGQRHQGRGSG*RPTWAGDRSLSQGLKGDPTYLIVTA 409
           Y  FFVPP +G    G   +               +    GDR+L+QGLKGDPTYL+V  
Sbjct: 87  YATFFVPPGTGGGGGGTPAKDALGNDVVAAEWL--KTHGPGDRTLTQGLKGDPTYLVVEN 144

Query: 410 DSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDV 589
           D T+  YG+NAVCTHLGCVVPW  AENKF CPCHGSQYNA+G+VVRGPAPLSLALAH D+
Sbjct: 145 DKTLATYGINAVCTHLGCVVPWNKAENKFLCPCHGSQYNAQGRVVRGPAPLSLALAHADI 204

Query: 590 AESGLVTFSTWTETDFRTGLEPWWA 664
            E+G V F  W ETDFRTG  PWW+
Sbjct: 205 DEAGKVLFVPWVETDFRTGDAPWWS 229

 Score = 41.6 bits (96), Expect = 0.035
 Identities = 34/101 (33%), Positives = 46/101 (44%), Gaps = 5/101 (4%)
 Frame = +3

Query: 33  STMAMLSSRRVAAPAKAS--AIRRSRVMPVVRAAAAS---SEVPDMNKRNIMNLILAGGA 197
           S +  +SS     P K +   +R+ ++   +   A+S     VPDM KR  +NL+L G  
Sbjct: 17  SALMAMSSGLFVKPTKMNHQMVRKEKIGLRIACQASSIPADRVPDMEKRKTLNLLLLGAL 76

Query: 198 GLPITTLASGPTVPSSCPPALAGVRLVARCAKDALGNDIKA 320
            LP T     P      PP   G       AKDALGND+ A
Sbjct: 77  SLP-TGYMLVPYATFFVPPGTGGGG-GGTPAKDALGNDVVA 115



EST assemble image


clone accession position
1 MX218d02_r BP090070 1 556
2 MX241f07_r BP091610 6 658
3 HC070c05_r AV637215 8 488
4 HC099d01_r AV639435 11 552
5 MX050b02_r BP088045 12 656
6 HC041b02_r AV635036 14 563
7 HC059f01_r AV636445 14 622
8 LC048d09_r AV622345 18 657
9 HCL076c11_r AV643802 18 631
10 HC028a11_r AV634010 31 674
11 HC045b04_r AV635339 41 657
12 MX024f09_r BP087081 62 593
13 CM048h09_r AV389126 99 487
14 CM070a05_r AV391267 101 781
15 HC050a06_r AV635720 107 683
16 MX250h10_r BP092195 108 710
17 LC006d02_r AV619301 110 685
18 LCL053h12_r AV629192 110 669
19 MX213f10_r BP089776 111 435
20 HC011c02_r AV632678 111 659
21 MX052d01_r BP088128 111 633
22 HC030g12_r AV634232 113 669
23 HC002a03_r AV631942 113 568
24 MX226h12_r BP090645 113 518
25 HC076h08_r AV637742 113 655
26 CM051e06_r AV389873 113 665
27 MXL016d02_r BP093966 113 653
28 HC006c07_r AV632283 113 652
29 MX063a06_r BP088548 113 492
30 HC064b12_r AV636791 113 683
31 MX217g08_r BP090031 113 445
32 HC006e04_r AV632302 113 633
33 MX053f07_r BP088188 113 589
34 MXL040c02_r BP095341 113 644
35 HC087a09_r AV638491 113 549
36 MXL074d09_r BP097358 113 609
37 HC067h09_r AV637044 113 685
38 HC096b07_r AV639191 114 685
39 MX252g12_r BP092337 114 651
40 LC026b09_r AV620736 114 698
41 MX056c09_r BP088283 114 506
42 MX259e05_r BP092812 114 651
43 CM003c04_r AV386556 115 716
44 HC091c06_r AV638821 115 566
45 CM005b06_r AV386865 115 653
46 MX234c10_r BP091135 117 409
47 HC042f03_r AV635155 117 493
48 HC015e02_r AV633003 117 675
49 MX036g01_r BP087535 119 534
50 MX206h03_r BP089419 119 656
51 LC070g10_r AV623945 119 682
52 MX030e11_r BP087282 120 544
53 HC041f06_r AV635081 120 675
54 LCL085d06_r AV630864 120 398
55 HC046a03_r AV635405 120 669
56 HC086c11_r AV638433 120 673
57 HC067g12_r AV637037 120 623
58 HC080g11_r AV638023 120 574
59 HC061f03_r AV636595 120 613
60 HC085b03_r AV638336 120 552
61 CM005d06_r AV386873 120 728
62 HC079c08_r AV637912 120 603
63 HC013e02_r AV632853 120 651
64 HC088c03_r AV638585 120 600
65 HC039c03_r AV634883 120 632
66 MX213f02_r BP089768 120 441
67 MX220c02_r BP090190 120 445
68 CM044b03_r AV389561 120 709
69 HC022e02_r AV633574 120 657
70 HC082h07_r AV638178 120 589
71 MX202c03_r BP089176 120 502
72 HC083b02_r AV638193 120 580
73 MX051d02_r BP088093 120 503
74 CM006a11_r AV387194 120 653
75 HC017e09_r AV633166 120 655
76 HC035e08_r AV634608 120 620
77 HC087a11_r AV638493 120 621
78 LC046f02_r AV622209 120 710
79 MX017f07_r BP086823 120 554
80 HC051d09_r AV635823 120 723
81 HC053b02_r AV635944 120 542
82 MX248c11_r BP092011 121 703
83 HC036a10_r AV634652 122 621
84 HC019f11_r AV633342 122 679
85 HC073c12_r AV637453 124 608
86 HC054h11_r AV636082 125 634
87 HC084f04_r AV638301 125 540
88 MX064c01_r BP088582 125 472
89 HC052e10_r AV635909 127 439
90 HC009a01_r AV632496 127 604
91 HC089h09_r AV638722 127 570
92 HC069c02_r AV637136 128 585
93 LC093h12_r AV625515 129 610
94 CM076f07_r AV391714 130 783
95 HC099f11_r AV639462 131 669
96 CM005b02_r AV386850 132 653
97 HC068h11_r AV637117 133 669
98 MX228d05_r BP090740 134 455
99 MX243g12_r BP091755 134 644
100 HC070b12_r AV637210 137 442
101 HC076h05_r AV637739 137 677
102 CM078c05_r AV391817 137 687
103 LC048g10_r AV622373 137 685
104 MX002e08_r BP086134 137 632
105 HC074d12_r AV637546 141 617
106 HC080g10_r AV638022 142 467
107 LC057a11_r AV622959 142 727
108 HCL024b07_r AV640887 147 657
109 HC070h08_r AV637270 150 642
110 LC010b04_r AV619567 174 760
111 HC084h02_r AV638315 202 683
112 MX010f12_r BP086525 208 627
113 HC041f02_r BP086525 217 461
114 HC097c02_r AV639273 233 700
115 HC060h01_r AV636543 240 741
116 MXL029h09_r BP094802 300 766
117 MXL079g04_r BP097690 309 733
118 HC037e11_r AV634762 309 820
119 HC030c06_r AV634185 338 871
120 HC072c12_r AV637375 342 914
121 MXL027c02_r BP094682 355 681
122 MX103d09_r BP088982 360 874
123 HC026b06_r AV633855 360 876
124 MX103g01_r BP089006 361 873
125 HC082g12_r AV638171 364 817
126 MX024d08_r BP087068 369 833
127 HC094h08_r AV639093 383 803
128 CM052g01_r AV390494 406 948
129 MXL095g02_r BP098574 425 852
130 LC035d11_r AV621395 430 955
131 LC096e01_r AV625687 435 883
132 HC072a12_r AV637354 448 912
133 MX101d05_r BP088813 452 1003
134 MX102c02_r BP088887 461 898
135 CM005h01_r AV386866 461 960
136 MX101h10_r BP088859 461 905
137 HC017c07_r AV633143 479 953
138 MX037h11_r BP087583 492 869
139 MXL063e05_r BP096710 500 999
140 HC073a04_r AV637424 519 1040
141 HC083f10_r AV638239 530 969
142 LC011b07_r AV619641 567 1090
143 CM098e06_r AV392931 578 1060
144 CM049e08_r AV389592 598 904
145 HC013a03_r AV632818 919 1413
146 CM071a05_r AV391353 980 1576
147 CL43h11_r AV395532 1028 1488
148 CL58a08_r AV396208 1057 1577
149 CM040g12_r AV389222 1068 1585
150 LC064f03_r AV623492 1098 1583
151 LC028b05_r AV620885 1118 1623
152 LC063h05_r AV623444 1120 1583
153 LC018c01_r AV620147 1124 1626
154 HC018c02_r AV633222 1129 1585




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research