KCC000551A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000551A_C01 KCC000551A_c01
GTTAGAAGGAAGCTATCCGTTTTCGCTGTCCTGATTTCTTCTTGGCACAATGGCCCTCTC
TTCTGCTGCCAACGTGGTCCGGTCGGCTGTTCTGCAGCACTTGCGCGTGACTGTGACCTC
CAGCCTTCAATCGAGCTCTCTGCCGACCTTCACCAACATAATCAGCCGTGGCTTTGGTGG
TGGCTTCCTGGACAAGGATTCCGTCACGGAGCGCGTGCTGCACGTCACAAAGCACTTTGA
GAAGATTGATGCATCCAAGGTGAGCCCGGCGGCCTCTTTCGAGAAGGACCTGGGCCTGGA
CAGCCTGGACGTGGTGGAGCTGGTCATGGCATTGGAAGAGGAGTTTGGCCTGGAGATTCC
GGACGCTGAGGCAGATAAGATTGCTTCCGTGGGTGACGCTATCAACTACATCTGCAGCAA
CCCTATGGCAAAGTAGAGCAGCGGCGATGATGGCACGTTGCACGCGATGTGGAGCGCAGG
GCGGCAGGGCGGCAAGGTTTGGCTTATGGCTT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000551A_C01 KCC000551A_c01
         (512 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAQ73138.1| acyl carrier protein 1 [Chlamydomonas reinhardtii]     246  2e-64
ref|NP_176708.1| acyl carrier protein family [Arabidopsis thalia...   123  2e-27
gb|AAM62469.1| acyl carrier protein, putative [Arabidopsis thali...   123  2e-27
gb|AAK96481.1| At2g44620/F16B22.11 [Arabidopsis thaliana] gi|169...   111  6e-24
ref|NP_181990.1| acyl carrier protein (ACP), mitochondrial [Arab...   110  1e-23

>gb|AAQ73138.1| acyl carrier protein 1 [Chlamydomonas reinhardtii]
          Length = 128

 Score =  246 bits (627), Expect = 2e-64
 Identities = 128/128 (100%), Positives = 128/128 (100%)
 Frame = +2

Query: 50  MALSSAANVVRSAVLQHLRVTVTSSLQSSSLPTFTNIISRGFGGGFLDKDSVTERVLHVT 229
           MALSSAANVVRSAVLQHLRVTVTSSLQSSSLPTFTNIISRGFGGGFLDKDSVTERVLHVT
Sbjct: 1   MALSSAANVVRSAVLQHLRVTVTSSLQSSSLPTFTNIISRGFGGGFLDKDSVTERVLHVT 60

Query: 230 KHFEKIDASKVSPAASFEKDLGLDSLDVVELVMALEEEFGLEIPDAEADKIASVGDAINY 409
           KHFEKIDASKVSPAASFEKDLGLDSLDVVELVMALEEEFGLEIPDAEADKIASVGDAINY
Sbjct: 61  KHFEKIDASKVSPAASFEKDLGLDSLDVVELVMALEEEFGLEIPDAEADKIASVGDAINY 120

Query: 410 ICSNPMAK 433
           ICSNPMAK
Sbjct: 121 ICSNPMAK 128

>ref|NP_176708.1| acyl carrier protein family [Arabidopsis thaliana]
           gi|7442279|pir||T02351 probable acyl carrier protein
           T8F5.6 - Arabidopsis thaliana
           gi|3335337|gb|AAC27139.1|AAC27139 Similar to acyl
           carrier protein, mitochondrial precursor (ACP)
           NADH-ubiquinone oxidoreductase 9.6 KD subunit (MYACP-1),
           gb|L23574 from A. thaliana.  ESTs gb|Z30712, gb|Z30713,
           gb|Z26204, gb|N37975 and gb|N96330 come from this gene.
           [Arabidopsis thaliana]
          Length = 126

 Score =  123 bits (308), Expect = 2e-27
 Identities = 69/125 (55%), Positives = 90/125 (71%), Gaps = 7/125 (5%)
 Frame = +2

Query: 80  RSAVLQHLRVTVTSSLQSSS---LPTFTNIISRGFG----GGFLDKDSVTERVLHVTKHF 238
           R A+L++LRV V  ++Q+     LP   +I+ R F     G FLDK  VT+RVL V K+F
Sbjct: 4   RGAMLRYLRVNVNPTIQNPRECVLPF--SILLRRFSEEVRGSFLDKSEVTDRVLSVVKNF 61

Query: 239 EKIDASKVSPAASFEKDLGLDSLDVVELVMALEEEFGLEIPDAEADKIASVGDAINYICS 418
           +K+D SKV+P A+F+ DLGLDSLD VE+VMALEEEFG EIPD EADKI S+  A+++I S
Sbjct: 62  QKVDPSKVTPKANFQNDLGLDSLDSVEVVMALEEEFGFEIPDNEADKIQSIDLAVDFIAS 121

Query: 419 NPMAK 433
           +P AK
Sbjct: 122 HPQAK 126

>gb|AAM62469.1| acyl carrier protein, putative [Arabidopsis thaliana]
          Length = 126

 Score =  123 bits (308), Expect = 2e-27
 Identities = 69/125 (55%), Positives = 90/125 (71%), Gaps = 7/125 (5%)
 Frame = +2

Query: 80  RSAVLQHLRVTVTSSLQSSS---LPTFTNIISRGFG----GGFLDKDSVTERVLHVTKHF 238
           R A+L++LRV V  ++Q+     LP   +I+ R F     G FLDK  VT+RVL V K+F
Sbjct: 4   RGALLRYLRVNVNPTIQNPRECVLPF--SILLRRFSEEVRGSFLDKSEVTDRVLSVVKNF 61

Query: 239 EKIDASKVSPAASFEKDLGLDSLDVVELVMALEEEFGLEIPDAEADKIASVGDAINYICS 418
           +K+D SKV+P A+F+ DLGLDSLD VE+VMALEEEFG EIPD EADKI S+  A+++I S
Sbjct: 62  QKVDPSKVTPKANFQNDLGLDSLDSVEVVMALEEEFGFEIPDNEADKIQSIDLAVDFIAS 121

Query: 419 NPMAK 433
           +P AK
Sbjct: 122 HPQAK 126

>gb|AAK96481.1| At2g44620/F16B22.11 [Arabidopsis thaliana]
           gi|16974477|gb|AAL31242.1| At2g44620/F16B22.11
           [Arabidopsis thaliana]
          Length = 122

 Score =  111 bits (277), Expect = 6e-24
 Identities = 61/119 (51%), Positives = 80/119 (66%), Gaps = 1/119 (0%)
 Frame = +2

Query: 77  VRSAVLQHLRVTV-TSSLQSSSLPTFTNIISRGFGGGFLDKDSVTERVLHVTKHFEKIDA 253
           +R+A+L+HLRV V T  L  S +     I S       L +++V +RVL V K F K+D+
Sbjct: 3   LRNAILRHLRVPVQTLGLNQSKIGFLGTIRSFSSHDDHLSREAVVDRVLDVVKSFPKVDS 62

Query: 254 SKVSPAASFEKDLGLDSLDVVELVMALEEEFGLEIPDAEADKIASVGDAINYICSNPMA 430
           SKV+P   F+ DLGLDSLD VE+VMA+EEEF LEIPD EADKI S   AI Y+ ++PM+
Sbjct: 63  SKVTPEVHFQNDLGLDSLDTVEIVMAIEEEFKLEIPDKEADKIDSCSLAIEYVYNHPMS 121

>ref|NP_181990.1| acyl carrier protein (ACP), mitochondrial [Arabidopsis thaliana]
           gi|1703091|sp|P53665|ACPM_ARATH Acyl carrier protein,
           mitochondrial precursor (ACP) (NADH-ubiquinone
           oxidoreductase 9.6 kDa subunit) (MtACP-1)
           gi|7442278|pir||T01589 acyl carrier protein At2g44620
           [imported] - Arabidopsis thaliana
           gi|903689|gb|AAB96840.1| acyl carrier protein precursor
           [Arabidopsis thaliana] gi|3341682|gb|AAC27464.1| acyl
           carrier protein [Arabidopsis thaliana]
          Length = 122

 Score =  110 bits (275), Expect = 1e-23
 Identities = 61/119 (51%), Positives = 79/119 (66%), Gaps = 1/119 (0%)
 Frame = +2

Query: 77  VRSAVLQHLRVTV-TSSLQSSSLPTFTNIISRGFGGGFLDKDSVTERVLHVTKHFEKIDA 253
           +R+A+L+HLRV V T  L  S +     I S       L +++V +RVL V K F K+D 
Sbjct: 3   LRNAILRHLRVPVQTLGLNQSKIGFLGTIRSFSSHDDHLSREAVVDRVLDVVKSFPKVDP 62

Query: 254 SKVSPAASFEKDLGLDSLDVVELVMALEEEFGLEIPDAEADKIASVGDAINYICSNPMA 430
           SKV+P   F+ DLGLDSLD VE+VMA+EEEF LEIPD EADKI S   AI Y+ ++PM+
Sbjct: 63  SKVTPEVHFQNDLGLDSLDTVEIVMAIEEEFKLEIPDKEADKIDSCSLAIEYVYNHPMS 121



EST assemble image


clone accession position
1 HC080h11_r AV638030 1 499
2 LC057a06_r AV622954 86 580
3 MX002d02_r BP086125 87 468
4 LC070h09_r AV623953 88 590
5 LC039h06_r AV621703 92 582
6 CM050a02_r AV389734 93 430
7 HC081b03_r AV638043 93 564
8 CL41e10_r AV395414 97 605
9 MX006d01_r BP086311 100 582
10 HC080h12_r AV638031 105 581
11 CM094e05_r AV393258 106 605
12 MX062b01_r BP088503 112 467
13 MXL069b10_r BP097047 115 501
14 HC036f03_r AV634694 128 616




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research