KCC000550A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000550A_C01 KCC000550A_c01
cCAAACCAGTATATTTGCGTATACAATAGCATACTGTTTGCCCCTGCTCGCTCCTCACAA
GGGCTTACCAACGTTGTTCATTTTTAGCAAGAGCAGTGCTGGCGCCCCACAGGTGGGGGC
CGTGCCCCCGGTAGCAGAGTAGTTTCGTTTCTAGGGCTGCCCCGCAACCCCTGCTGTCGC
TATCGGCTTGGTTTAGGGCGCCATGGGCTGCGCTCAGTCGACCCCGGCGGACCAAGGCGC
CAAGCCTCCCGCAAACACCAACGGGCATTCGACTGCACGAGCAGCTCCAGCAGCTAGCGC
TGAGGCACCCCCGGCGGCGAATGGAAACGGCGCGACTACGCCATCGCCACTCTATGCTGC
TCCGCCATCGAGCGCGCAGACCCAGCAGCAACCGGCACCAGCGCCCGCAGCGCCTCCTGT
AGTGCATCCGCCTGGATCTCAGGCTGCAGTAAACCAAAGCCTCAAGTCGCTCAGCGCAAA
CGAGGCAAACGCAGTGCAGGCGACACTGCTGAAGGTCAGCATGCTCATCCAAA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000550A_C01 KCC000550A_c01
         (533 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_311129.1| ENSANGP00000004749 [Anopheles gambiae] gi|30178...    52  6e-06
ref|XP_327024.1| hypothetical protein [Neurospora crassa] gi|288...    51  1e-05
pir||SKXLAG dermal gland protein APEG precursor - African clawed...    50  2e-05
sp|P17437|XP2_XENLA Skin secretory protein xP2 precursor (APEG p...    50  2e-05
emb|CAA56558.1| pprB [Pseudomonas putida]                              49  3e-05

>ref|XP_311129.1| ENSANGP00000004749 [Anopheles gambiae] gi|30178092|gb|EAA06612.2|
           ENSANGP00000004749 [Anopheles gambiae str. PEST]
          Length = 633

 Score = 51.6 bits (122), Expect = 6e-06
 Identities = 33/95 (34%), Positives = 43/95 (44%), Gaps = 1/95 (1%)
 Frame = +2

Query: 158 CPATPAVAIGLV*GAMGC-AQSTPADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGA 334
           CP +P+ A        GC  +S P+   A  PA      TARA P  S  APP+ +  G 
Sbjct: 529 CPTSPSAA-----RPSGCPGRSPPSAPPAARPAGPPAACTARAPPGRSRSAPPSRSSAGP 583

Query: 335 TTPSPLYAAPPSSAQTQQQPAPAPAAPPVVHPPGS 439
              S   + P  SA    +P  +PAAP    PPG+
Sbjct: 584 AVASGCGSPPDCSASCAARPPASPAAPRSSAPPGA 618

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 39/137 (28%), Positives = 50/137 (36%), Gaps = 6/137 (4%)
 Frame = +2

Query: 68  PTLFIFSKSSAGAPQVGAVPPVAE*FRF*GCPATPAVAIGLV*GAMGCAQSTPADQGAKP 247
           P +   + ++A AP   AV P +        P TP+           CA + P    A  
Sbjct: 496 PGVVAAAAAAAAAPAAVAVRPAS--------PCTPSP----------CAAACPTSPSAAR 537

Query: 248 PANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQQQPAPAPAAPP--- 418
           P+   G S   A PAA    PPAA       P    +APPS +      A    +PP   
Sbjct: 538 PSGCPGRSPPSAPPAARPAGPPAA-CTARAPPGRSRSAPPSRSSAGPAVASGCGSPPDCS 596

Query: 419 ---VVHPPGSQAAVNQS 460
                 PP S AA   S
Sbjct: 597 ASCAARPPASPAAPRSS 613

 Score = 33.1 bits (74), Expect = 2.3
 Identities = 31/95 (32%), Positives = 38/95 (39%), Gaps = 18/95 (18%)
 Frame = +2

Query: 239 AKPPANTNGHSTARAAPAASAEAPPAANGNGAT--TPSPLYAAPPSSAQTQQQ------- 391
           A+PP+         AA AA+A AP A     A+  TPSP  AA P+S    +        
Sbjct: 486 ARPPSAQAAGPGVVAAAAAAAAAPAAVAVRPASPCTPSPCAAACPTSPSAARPSGCPGRS 545

Query: 392 -----PAPAPAAPPV----VHPPGSQAAVNQSLKS 469
                PA  PA PP       PPG   +   S  S
Sbjct: 546 PPSAPPAARPAGPPAACTARAPPGRSRSAPPSRSS 580

>ref|XP_327024.1| hypothetical protein [Neurospora crassa] gi|28881367|emb|CAD70409.1|
            related to SEC31 protein [Neurospora crassa]
            gi|28925193|gb|EAA34274.1| hypothetical protein
            [Neurospora crassa]
          Length = 1256

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 42/126 (33%), Positives = 53/126 (41%), Gaps = 4/126 (3%)
 Frame = +2

Query: 107  PQVGAVPPVAE*FRF*GCPATPAVAIGLV*GAMGCAQSTPADQGA---KPPANTNGHSTA 277
            P   A PP     R+   PAT     G      G   + P   GA    PPA +  ++ A
Sbjct: 1044 PPSAAAPPAN---RYAPAPATQQYTQG---PPSGSGIAPPPASGAYTPAPPAASQQYAAA 1097

Query: 278  RAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQQQPAPAPAAPPVV-HPPGSQAAVN 454
               P A   APP A+      P P   APP      QQ AP PAAPP   +PPG ++ + 
Sbjct: 1098 PPPPRAGFSAPPPASRPPGGGPPPAAGAPP------QQQAPPPAAPPKPRYPPGDRSNIP 1151

Query: 455  QSLKSL 472
            +  K L
Sbjct: 1152 EHAKEL 1157

 Score = 35.8 bits (81), Expect = 0.36
 Identities = 31/84 (36%), Positives = 38/84 (44%), Gaps = 13/84 (15%)
 Frame = +2

Query: 224  PADQGAKPPANTNGHSTA-----RAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQQ 388
            P    A PPAN    + A     +  P+ S  APP A+G  A TP     APP+++Q   
Sbjct: 1043 PPPSAAAPPANRYAPAPATQQYTQGPPSGSGIAPPPASG--AYTP-----APPAASQ--- 1092

Query: 389  QPAPAP--------AAPPVVHPPG 436
            Q A AP        A PP   PPG
Sbjct: 1093 QYAAAPPPPRAGFSAPPPASRPPG 1116

 Score = 34.7 bits (78), Expect = 0.80
 Identities = 35/134 (26%), Positives = 48/134 (35%), Gaps = 2/134 (1%)
 Frame = +2

Query: 53   PHKGLPTLFIFSKSSAGAPQVGAVPPVAE*FRF*GCPATPAVAIGLV*GAMGCAQSTPAD 232
            P +  P++   +    G P + + PP     +  G P  P                 P  
Sbjct: 946  PRRNTPSVAPLTSPFPGQPGIASPPPAGPFQQ--GAPTPP-----------------PPP 986

Query: 233  QGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQQQPA--PAP 406
            +G+ PP N         AP      P + + N AT P   YA PP +A  Q      PAP
Sbjct: 987  KGSAPPRNVG-------APPTGPPRPSSVSSN-ATNP---YAPPPPAAGLQPTYGVPPAP 1035

Query: 407  AAPPVVHPPGSQAA 448
                  +PP S AA
Sbjct: 1036 RTASPYNPPPSAAA 1049

 Score = 33.5 bits (75), Expect = 1.8
 Identities = 36/96 (37%), Positives = 39/96 (40%), Gaps = 11/96 (11%)
 Frame = +2

Query: 245  PPANTNGHSTARAAPAASAE-----APPAANGNGATTPSPLYAAPPSSAQTQQQPAPA-- 403
            PPA T  +    A   A A+     A PA  G   TT S   AAP    Q    PAPA  
Sbjct: 775  PPAETARNRVRLATQKAGAQTAVRQATPA--GRTTTTTSSRTAAPVGYQQPSLVPAPANP 832

Query: 404  ----PAAPPVVHPPGSQAAVNQSLKSLSANEANAVQ 499
                P APP V  P S AA N     L+   A A Q
Sbjct: 833  SSLNPYAPP-VPAPVSAAASNPYAPPLAPVSAAASQ 867

>pir||SKXLAG dermal gland protein APEG precursor - African clawed frog
           (fragment) gi|1334643|emb|CAA35759.1| APEG precursor
           protein [Xenopus laevis]
          Length = 416

 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 47/140 (33%), Positives = 57/140 (40%), Gaps = 8/140 (5%)
 Frame = +2

Query: 50  APHKGLPTLFIFSKSSAGAPQVGAVPPVAE*FRF*GCPATPAVAIGLV*GAMGCAQSTPA 229
           AP +G+        + A AP  G  P  AE     G PA PA A G        A+  PA
Sbjct: 28  APAEGVAPAPAEGGAPAPAPAEGEAPAPAEG----GAPA-PAPAEG--------AEPAPA 74

Query: 230 DQGAKPPANTNGHSTARAAPAASAEAPPAANGN-------GATTPSPLYAAPPSSAQTQ- 385
           D GA  PA   G + A A     A AP  A G        GA  P+P     P+ A  + 
Sbjct: 75  DGGAPAPAPAEGGAPAPAPAEGGAPAPAPAEGGAPAPAEGGAPAPAPAEGEAPAPAPAEG 134

Query: 386 QQPAPAPAAPPVVHPPGSQA 445
           + PAPAPA      P   +A
Sbjct: 135 EAPAPAPAEGEAPAPAEGEA 154

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 48/139 (34%), Positives = 58/139 (41%), Gaps = 16/139 (11%)
 Frame = +2

Query: 41  PLLAPHKGLPTLFIFSKSSAGAPQVGAVPPVAE*FRF*GCPATPAVAIGLV*GAMGCAQS 220
           P  AP +G         + A AP  GA P  A+     G PA PA A G      G    
Sbjct: 43  PAPAPAEGEAPAPAEGGAPAPAPAEGAEPAPADG----GAPA-PAPAEG------GAPAP 91

Query: 221 TPADQGAKPPANTNGHSTARA-----APA-ASAEAPPAANGNG-ATTPSPLYAAPPSSAQ 379
            PA+ GA  PA   G + A A     APA A  EAP  A   G A  P+P     P+ A+
Sbjct: 92  APAEGGAPAPAPAEGGAPAPAEGGAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAE 151

Query: 380 TQ---------QQPAPAPA 409
            +         + PAPAPA
Sbjct: 152 GEAPAPAPAEVEAPAPAPA 170

 Score = 39.7 bits (91), Expect = 0.025
 Identities = 43/135 (31%), Positives = 52/135 (37%), Gaps = 3/135 (2%)
 Frame = +2

Query: 98  AGAPQVGAVPPVAE*FRF*GCPATPAVAIGLV*GAMGCAQSTPADQGAK--PPANTNGHS 271
           A AP  G  P  AE     G PA PA A G            PA   A+   PA   G +
Sbjct: 100 APAPAEGGAPAPAEG----GAPA-PAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAEGEA 154

Query: 272 TARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQ-QQPAPAPAAPPVVHPPGSQAA 448
            A A     A AP  A G  A  P+P     P+ A  + + PAPAPA      P  + A 
Sbjct: 155 PAPAPAEVEAPAPAPAEGE-APAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAPAE 213

Query: 449 VNQSLKSLSANEANA 493
                 + +  EA A
Sbjct: 214 GEAPAPAPAEGEAPA 228

 Score = 39.3 bits (90), Expect = 0.033
 Identities = 25/64 (39%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNG-ATTPSPLYAAPPSSAQTQ-QQPA 397
           PA+  A  PA   G + A A   A  EAP  A   G A  P+P     P+ A  + + PA
Sbjct: 189 PAEGEAPAPAPAEGEAPAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPA 248

Query: 398 PAPA 409
           PAPA
Sbjct: 249 PAPA 252

 Score = 38.5 bits (88), Expect = 0.056
 Identities = 26/75 (34%), Positives = 33/75 (43%), Gaps = 1/75 (1%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQ-QQPAP 400
           PA+  A  PA   G + A A     A AP  A G  A  P+P     P+ A  + + PAP
Sbjct: 221 PAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGE-APAPAPAEGEAPAPAPAEGEAPAP 279

Query: 401 APAAPPVVHPPGSQA 445
           APA      P   +A
Sbjct: 280 APAEGEAPAPAEGEA 294

 Score = 37.7 bits (86), Expect = 0.095
 Identities = 24/63 (38%), Positives = 30/63 (47%), Gaps = 1/63 (1%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQ-QQPAP 400
           PA+  A  PA   G + A A     A AP  A G  A  P+P     P+ A  + + PAP
Sbjct: 211 PAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGE-APAPAPAEGEAPAPAPAEGEAPAP 269

Query: 401 APA 409
           APA
Sbjct: 270 APA 272

 Score = 35.8 bits (81), Expect = 0.36
 Identities = 24/64 (37%), Positives = 29/64 (44%), Gaps = 2/64 (3%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNG-ATTPSPLYAAPPSSAQTQ-QQPA 397
           PA+  A  PA       A A   A  EAP  A   G A  P+P     P+ A  + + PA
Sbjct: 199 PAEGEAPAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPA 258

Query: 398 PAPA 409
           PAPA
Sbjct: 259 PAPA 262

 Score = 35.8 bits (81), Expect = 0.36
 Identities = 23/63 (36%), Positives = 29/63 (45%), Gaps = 1/63 (1%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQ-QQPAP 400
           PA+  A  PA   G + A A     A AP  A G     P+P     P+ A  + + PAP
Sbjct: 251 PAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEA---PAPAEGEAPAPAPAEGEAPAP 307

Query: 401 APA 409
           APA
Sbjct: 308 APA 310

 Score = 35.4 bits (80), Expect = 0.47
 Identities = 42/128 (32%), Positives = 52/128 (39%), Gaps = 5/128 (3%)
 Frame = +2

Query: 41  PLLAPHKGLPTLFIFSKSSAGAPQVGAVPPVAE*FRF*GCPATPAVAIGLV*GAMGCAQS 220
           P  AP +G       ++  A AP  G  P           PA   V       A G A +
Sbjct: 127 PAPAPAEGEAPAPAPAEGEAPAPAEGEAP----------APAPAEVEAPAPAPAEGEAPA 176

Query: 221 -TPADQGAKPPANTNGHSTARAAPA---ASAEAPPAANGNGATTPSPLYAAPPSSAQTQ- 385
             PA+  A  PA   G + A  APA   A A AP  A G  A  P+P     P+ A  + 
Sbjct: 177 PAPAEGEAPAPAPAEGEAPA-PAPAEGEAPAPAPAPAEGE-APAPAPAEGEAPAPAPAEG 234

Query: 386 QQPAPAPA 409
           + PAPAPA
Sbjct: 235 EAPAPAPA 242

 Score = 35.0 bits (79), Expect = 0.61
 Identities = 23/63 (36%), Positives = 28/63 (43%), Gaps = 1/63 (1%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQQ-QPAP 400
           PA    + PA   G + A A     A AP  A G     PSP     P++A  +   PAP
Sbjct: 279 PAPAEGEAPAPAEGEAPAPAPAEGEAPAPAPAEGGA---PSPAEGGAPAAAPAEGGAPAP 335

Query: 401 APA 409
           APA
Sbjct: 336 APA 338

 Score = 34.3 bits (77), Expect = 1.0
 Identities = 24/75 (32%), Positives = 31/75 (41%), Gaps = 1/75 (1%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQ-QQPAP 400
           PA+  A  PA   G + A  APA      PA     A  P+P     P+ A  + + PAP
Sbjct: 231 PAEGEAPAPAPAEGEAPA-PAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPAP 289

Query: 401 APAAPPVVHPPGSQA 445
           A    P   P   +A
Sbjct: 290 AEGEAPAPAPAEGEA 304

 Score = 33.1 bits (74), Expect = 2.3
 Identities = 26/73 (35%), Positives = 33/73 (44%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQQQPAPA 403
           PA+  A  PA   G + A A     A AP  A G     PSP     P++A   +  APA
Sbjct: 281 PAEGEA--PAPAEGEAPAPAPAEGEAPAPAPAEGG---APSPAEGGAPAAAPA-EGGAPA 334

Query: 404 PAAPPVVHPPGSQ 442
           PA  PV   P ++
Sbjct: 335 PAPAPVEVGPKTE 347

 Score = 32.7 bits (73), Expect = 3.1
 Identities = 24/70 (34%), Positives = 30/70 (42%), Gaps = 1/70 (1%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQ-QQPAP 400
           PA+  A  PA   G + A A   A  EAP  A G  A  P+P     P+ A  +   P+P
Sbjct: 261 PAEGEAPAPAPAEGEAPAPAP--AEGEAPAPAEGE-APAPAPAEGEAPAPAPAEGGAPSP 317

Query: 401 APAAPPVVHP 430
           A    P   P
Sbjct: 318 AEGGAPAAAP 327

>sp|P17437|XP2_XENLA Skin secretory protein xP2 precursor (APEG protein)
          Length = 439

 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 47/140 (33%), Positives = 57/140 (40%), Gaps = 8/140 (5%)
 Frame = +2

Query: 50  APHKGLPTLFIFSKSSAGAPQVGAVPPVAE*FRF*GCPATPAVAIGLV*GAMGCAQSTPA 229
           AP +G+        + A AP  G  P  AE     G PA PA A G        A+  PA
Sbjct: 30  APAEGVAPAPAEGGAPAPAPAEGEAPAPAEG----GAPA-PAPAEG--------AEPAPA 76

Query: 230 DQGAKPPANTNGHSTARAAPAASAEAPPAANGN-------GATTPSPLYAAPPSSAQTQ- 385
           D GA  PA   G + A A     A AP  A G        GA  P+P     P+ A  + 
Sbjct: 77  DGGAPAPAPAEGGAPAPAPAEGGAPAPAPAEGGAPAPAEGGAPAPAPAEGEAPAPAPAEG 136

Query: 386 QQPAPAPAAPPVVHPPGSQA 445
           + PAPAPA      P   +A
Sbjct: 137 EAPAPAPAEGEAPAPAEGEA 156

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 48/139 (34%), Positives = 58/139 (41%), Gaps = 16/139 (11%)
 Frame = +2

Query: 41  PLLAPHKGLPTLFIFSKSSAGAPQVGAVPPVAE*FRF*GCPATPAVAIGLV*GAMGCAQS 220
           P  AP +G         + A AP  GA P  A+     G PA PA A G      G    
Sbjct: 45  PAPAPAEGEAPAPAEGGAPAPAPAEGAEPAPADG----GAPA-PAPAEG------GAPAP 93

Query: 221 TPADQGAKPPANTNGHSTARA-----APA-ASAEAPPAANGNG-ATTPSPLYAAPPSSAQ 379
            PA+ GA  PA   G + A A     APA A  EAP  A   G A  P+P     P+ A+
Sbjct: 94  APAEGGAPAPAPAEGGAPAPAEGGAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAE 153

Query: 380 TQ---------QQPAPAPA 409
            +         + PAPAPA
Sbjct: 154 GEAPAPAPAEVEAPAPAPA 172

 Score = 39.7 bits (91), Expect = 0.025
 Identities = 43/135 (31%), Positives = 52/135 (37%), Gaps = 3/135 (2%)
 Frame = +2

Query: 98  AGAPQVGAVPPVAE*FRF*GCPATPAVAIGLV*GAMGCAQSTPADQGAK--PPANTNGHS 271
           A AP  G  P  AE     G PA PA A G            PA   A+   PA   G +
Sbjct: 102 APAPAEGGAPAPAEG----GAPA-PAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAEGEA 156

Query: 272 TARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQ-QQPAPAPAAPPVVHPPGSQAA 448
            A A     A AP  A G  A  P+P     P+ A  + + PAPAPA      P  + A 
Sbjct: 157 PAPAPAEVEAPAPAPAEGE-APAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAPAE 215

Query: 449 VNQSLKSLSANEANA 493
                 + +  EA A
Sbjct: 216 GEAPAPAPAEGEAPA 230

 Score = 39.3 bits (90), Expect = 0.033
 Identities = 25/64 (39%), Positives = 31/64 (48%), Gaps = 2/64 (3%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNG-ATTPSPLYAAPPSSAQTQ-QQPA 397
           PA+  A  PA   G + A A   A  EAP  A   G A  P+P     P+ A  + + PA
Sbjct: 191 PAEGEAPAPAPAEGEAPAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPA 250

Query: 398 PAPA 409
           PAPA
Sbjct: 251 PAPA 254

 Score = 38.5 bits (88), Expect = 0.056
 Identities = 26/75 (34%), Positives = 33/75 (43%), Gaps = 1/75 (1%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQ-QQPAP 400
           PA+  A  PA   G + A A     A AP  A G  A  P+P     P+ A  + + PAP
Sbjct: 223 PAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGE-APAPAPAEGEAPAPAPAEGEAPAP 281

Query: 401 APAAPPVVHPPGSQA 445
           APA      P   +A
Sbjct: 282 APAEGEAPAPAEGEA 296

 Score = 37.7 bits (86), Expect = 0.095
 Identities = 24/63 (38%), Positives = 30/63 (47%), Gaps = 1/63 (1%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQ-QQPAP 400
           PA+  A  PA   G + A A     A AP  A G  A  P+P     P+ A  + + PAP
Sbjct: 213 PAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGE-APAPAPAEGEAPAPAPAEGEAPAP 271

Query: 401 APA 409
           APA
Sbjct: 272 APA 274

 Score = 35.8 bits (81), Expect = 0.36
 Identities = 24/64 (37%), Positives = 29/64 (44%), Gaps = 2/64 (3%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNG-ATTPSPLYAAPPSSAQTQ-QQPA 397
           PA+  A  PA       A A   A  EAP  A   G A  P+P     P+ A  + + PA
Sbjct: 201 PAEGEAPAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPA 260

Query: 398 PAPA 409
           PAPA
Sbjct: 261 PAPA 264

 Score = 35.8 bits (81), Expect = 0.36
 Identities = 23/63 (36%), Positives = 29/63 (45%), Gaps = 1/63 (1%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQ-QQPAP 400
           PA+  A  PA   G + A A     A AP  A G     P+P     P+ A  + + PAP
Sbjct: 253 PAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEA---PAPAEGEAPAPAPAEGEAPAP 309

Query: 401 APA 409
           APA
Sbjct: 310 APA 312

 Score = 35.4 bits (80), Expect = 0.47
 Identities = 42/128 (32%), Positives = 52/128 (39%), Gaps = 5/128 (3%)
 Frame = +2

Query: 41  PLLAPHKGLPTLFIFSKSSAGAPQVGAVPPVAE*FRF*GCPATPAVAIGLV*GAMGCAQS 220
           P  AP +G       ++  A AP  G  P           PA   V       A G A +
Sbjct: 129 PAPAPAEGEAPAPAPAEGEAPAPAEGEAP----------APAPAEVEAPAPAPAEGEAPA 178

Query: 221 -TPADQGAKPPANTNGHSTARAAPA---ASAEAPPAANGNGATTPSPLYAAPPSSAQTQ- 385
             PA+  A  PA   G + A  APA   A A AP  A G  A  P+P     P+ A  + 
Sbjct: 179 PAPAEGEAPAPAPAEGEAPA-PAPAEGEAPAPAPAPAEGE-APAPAPAEGEAPAPAPAEG 236

Query: 386 QQPAPAPA 409
           + PAPAPA
Sbjct: 237 EAPAPAPA 244

 Score = 35.0 bits (79), Expect = 0.61
 Identities = 23/63 (36%), Positives = 28/63 (43%), Gaps = 1/63 (1%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQQ-QPAP 400
           PA    + PA   G + A A     A AP  A G     PSP     P++A  +   PAP
Sbjct: 281 PAPAEGEAPAPAEGEAPAPAPAEGEAPAPAPAEGGA---PSPAEGGAPAAAPAEGGAPAP 337

Query: 401 APA 409
           APA
Sbjct: 338 APA 340

 Score = 34.3 bits (77), Expect = 1.0
 Identities = 24/75 (32%), Positives = 31/75 (41%), Gaps = 1/75 (1%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQ-QQPAP 400
           PA+  A  PA   G + A  APA      PA     A  P+P     P+ A  + + PAP
Sbjct: 233 PAEGEAPAPAPAEGEAPA-PAPAEGEAPAPAPAEGEAPAPAPAEGEAPAPAPAEGEAPAP 291

Query: 401 APAAPPVVHPPGSQA 445
           A    P   P   +A
Sbjct: 292 AEGEAPAPAPAEGEA 306

 Score = 33.1 bits (74), Expect = 2.3
 Identities = 26/73 (35%), Positives = 33/73 (44%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQQQPAPA 403
           PA+  A  PA   G + A A     A AP  A G     PSP     P++A   +  APA
Sbjct: 283 PAEGEA--PAPAEGEAPAPAPAEGEAPAPAPAEGG---APSPAEGGAPAAAPA-EGGAPA 336

Query: 404 PAAPPVVHPPGSQ 442
           PA  PV   P ++
Sbjct: 337 PAPAPVEVGPKTE 349

 Score = 32.7 bits (73), Expect = 3.1
 Identities = 24/70 (34%), Positives = 30/70 (42%), Gaps = 1/70 (1%)
 Frame = +2

Query: 224 PADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQ-QQPAP 400
           PA+  A  PA   G + A A   A  EAP  A G  A  P+P     P+ A  +   P+P
Sbjct: 263 PAEGEAPAPAPAEGEAPAPAP--AEGEAPAPAEGE-APAPAPAEGEAPAPAPAEGGAPSP 319

Query: 401 APAAPPVVHP 430
           A    P   P
Sbjct: 320 AEGGAPAAAP 329

>emb|CAA56558.1| pprB [Pseudomonas putida]
          Length = 298

 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 37/112 (33%), Positives = 45/112 (40%)
 Frame = +2

Query: 170 PAVAIGLV*GAMGCAQSTPADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSP 349
           PA        A       PA   AKP A      TA A PAA   A PAA    A   + 
Sbjct: 156 PAARTAAKPAAKAATAKAPAKAAAKPAAAKAPAKTAAAKPAAKPAAKPAAGKAPAKAAAA 215

Query: 350 LYAAPPSSAQTQQQPAPAPAAPPVVHPPGSQAAVNQSLKSLSANEANAVQAT 505
             AA P++A+    PA A AA P   P  ++A    + K  +A  A    AT
Sbjct: 216 KPAAKPAAAKA---PAKAAAAKPAAKPAAAKAPAKPAAKPAAAKPAETKPAT 264

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 28/98 (28%), Positives = 39/98 (39%)
 Frame = +2

Query: 212 AQSTPADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQQQ 391
           A++      AKP A       A  APA +A A PAA    A  P+   AA P++     +
Sbjct: 184 AKAPAKTAAAKPAAKPAAKPAAGKAPAKAAAAKPAAKPAAAKAPAKAAAAKPAAKPAAAK 243

Query: 392 PAPAPAAPPVVHPPGSQAAVNQSLKSLSANEANAVQAT 505
               PAA P    P        +  + +A   +A  AT
Sbjct: 244 APAKPAAKPAAAKPAETKPATAATSTPAAATNSAAPAT 281

 Score = 40.4 bits (93), Expect = 0.015
 Identities = 28/93 (30%), Positives = 36/93 (38%)
 Frame = +2

Query: 215 QSTPADQGAKPPANTNGHSTARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQQQP 394
           Q   A + AKP A       A   PAA   A PAA    A  P+   A P ++    +  
Sbjct: 132 QRAVAVKAAKPAAAKAPAKAAATKPAARTAAKPAAKAATAKAPAKAAAKPAAAKAPAKTA 191

Query: 395 APAPAAPPVVHPPGSQAAVNQSLKSLSANEANA 493
           A  PAA P   P   +A    +    +A  A A
Sbjct: 192 AAKPAAKPAAKPAAGKAPAKAAAAKPAAKPAAA 224

 Score = 36.2 bits (82), Expect = 0.28
 Identities = 33/109 (30%), Positives = 43/109 (39%), Gaps = 1/109 (0%)
 Frame = +2

Query: 92  SSAGAP-QVGAVPPVAE*FRF*GCPATPAVAIGLV*GAMGCAQSTPADQGAKPPANTNGH 268
           ++A AP +  A  P A+          PA A      A   A   PA   A  PA     
Sbjct: 182 AAAKAPAKTAAAKPAAKPAAKPAAGKAPAKAAAAKPAAKPAAAKAPAKAAAAKPAAKPAA 241

Query: 269 STARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQQQPAPAPAAP 415
           + A A PAA     PAA     T P+    + P++A     PA A +AP
Sbjct: 242 AKAPAKPAAK----PAAAKPAETKPATAATSTPAAATNSAAPATAASAP 286

 Score = 33.5 bits (75), Expect = 1.8
 Identities = 35/108 (32%), Positives = 43/108 (39%), Gaps = 3/108 (2%)
 Frame = +2

Query: 98  AGAPQVGAVPPVAE*FRF*GCPAT---PAVAIGLV*GAMGCAQSTPADQGAKPPANTNGH 268
           A  P  G  P  A   +    PA    PA A      A   A   PA   AKP A     
Sbjct: 200 AAKPAAGKAPAKAAAAKPAAKPAAAKAPAKAAAAKPAAKPAAAKAPAKPAAKPAAA---- 255

Query: 269 STARAAPAASAEAPPAANGNGATTPSPLYAAPPSSAQTQQQPAPAPAA 412
             A   PA +A + PAA  N A  P+   +AP S+      PA AP++
Sbjct: 256 KPAETKPATAATSTPAAATNSA-APATAASAPAST------PAQAPSS 296



EST assemble image


clone accession position
1 MXL080c07_r BP097721 1 371
2 CL41e07_r AV395429 2 533
3 MXL042e11_r BP095482 40 422




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research