KCC000549A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000549A_C01 KCC000549A_c01
ccagccattggggtgtcccagccgctggtgccgctggtggatgagtttgcgcggcgcctg
ttcgccgagttggactacgtGCAGGAGGGCCACAACTGCGAGCGCTTCCAGGCGCTGTAC
GGCTCCATGCCCCGCGTGCGCACACCCAAGATCTACTGGCAGCACACCAGCCGGAGGGTG
CTGACCATGGAGTGGATCGAGGGAGTCAAGCTCACCAACCAGGCAGCCATGGATGAGGCG
GGTCTGAGTGTGGTAGACTTTGTGGACGTGGGCATTGAGTGCACGCTGCGGCAGCTGTTG
GAGCACGGCTACTTCCACGCGGACCCACACCCAGGCAACCTGCTGGCCACGCGCGGCGGC
GACCTGGTGTACCTGGACTTCGGCATGATGAGCGAGGCGCCGCAGTACGCCCGGTATGCC
ATTATGGCCCACGTGGTGCACCTGGTCAACAGGGACTATGAGGCGATGTGCAAGGACTAC
TACACCCTGCAGTTCATGGACCCCTCCGTGGACACCACCCCCATCGCGCCCGCCCTGGCC
GCCTTCTTCGACGACGTGCTCGACAGCTCCGTGTCCACCCTCAACTTCAAGGCCATCGTG
GACGGGCTGGGTGAGGTGCTGTTCCAGTACCCCTTCCGTGTGCCCGCCTACTACGCCCTC
ATCCTGCGCAGCCTCACAGTGCTGGAGGGGCTGGCGCTGCAGGCCGACCCTAACTACAAG
CTGCTGGCCAAGGCCTACCCCTACATGGCCAAACGCCTGCTCACCGACCCGGCCCCCGAG
CTGAGGGAGAGCTTCGAGGACCTCATACTCAAGGACGGGCAGTTC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000549A_C01 KCC000549A_c01
         (825 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAK63973.1| At1g79600/F20B17_3 [Arabidopsis thaliana]              365  e-100
ref|NP_565214.1| expressed protein [Arabidopsis thaliana] gi|771...   365  e-100
ref|ZP_00073834.1| COG0661: Predicted unusual protein kinase [Tr...   343  2e-93
ref|NP_681740.1| ORF_ID:tll0950~hypothetical protein [Thermosyne...   331  1e-89
ref|NP_489000.1| hypothetical protein [Nostoc sp. PCC 7120] gi|2...   327  1e-88

>gb|AAK63973.1| At1g79600/F20B17_3 [Arabidopsis thaliana]
          Length = 569

 Score =  365 bits (938), Expect = e-100
 Identities = 172/271 (63%), Positives = 212/271 (77%)
 Frame = +1

Query: 13  VSQPLVPLVDEFARRLFAELDYVQEGHNCERFQALYGSMPRVRTPKIYWQHTSRRVLTME 192
           ++  ++ L+DEFA R++ EL+YVQE  N  RF+ LY     V  P I+W +TSR+VLTME
Sbjct: 134 ITTDVLTLIDEFACRVYQELNYVQEAQNARRFKKLYADKADVLVPDIFWDYTSRKVLTME 193

Query: 193 WIEGVKLTNQAAMDEAGLSVVDFVDVGIECTLRQLLEHGYFHADPHPGNLLATRGGDLVY 372
           W+EG KL  Q A++  GL V+D V+ GI+C+LRQLLE+G+FHADPHPGNLLAT  G L +
Sbjct: 194 WVEGTKLNEQLAIESQGLKVLDLVNTGIQCSLRQLLEYGFFHADPHPGNLLATPDGKLAF 253

Query: 373 LDFGMMSEAPQYARYAIMAHVVHLVNRDYEAMCKDYYTLQFMDPSVDTTPIAPALAAFFD 552
           LDFGMMSE P+ AR+AI+ HVVHLVNRDYEAM +DYY L+F+ P VD TPI PAL  FFD
Sbjct: 254 LDFGMMSETPEEARFAIIGHVVHLVNRDYEAMARDYYALKFLSPDVDVTPIIPALRDFFD 313

Query: 553 DVLDSSVSTLNFKAIVDGLGEVLFQYPFRVPAYYALILRSLTVLEGLALQADPNYKLLAK 732
           D L+ +VS LNFK +VDGLG V +QYPF VP YYALILRSLTVLEGLAL ADPN+K+LA 
Sbjct: 314 DALNYTVSELNFKTLVDGLGAVFYQYPFNVPPYYALILRSLTVLEGLALYADPNFKVLAA 373

Query: 733 AYPYMAKRLLTDPAPELRESFEDLILKDGQF 825
           +YPY AKRLLTDP P LR++  +L+ KDG+F
Sbjct: 374 SYPYFAKRLLTDPNPYLRDALIELLFKDGKF 404

>ref|NP_565214.1| expressed protein [Arabidopsis thaliana]
            gi|7715610|gb|AAF68128.1|AC010793_23 F20B17.3
            [Arabidopsis thaliana] gi|18086325|gb|AAL57626.1|
            At1g79600/F20B17_3 [Arabidopsis thaliana]
            gi|22655328|gb|AAM98256.1| At1g79600/F20B17_3
            [Arabidopsis thaliana]
          Length = 711

 Score =  365 bits (938), Expect = e-100
 Identities = 172/271 (63%), Positives = 212/271 (77%)
 Frame = +1

Query: 13   VSQPLVPLVDEFARRLFAELDYVQEGHNCERFQALYGSMPRVRTPKIYWQHTSRRVLTME 192
            ++  ++ L+DEFA R++ EL+YVQE  N  RF+ LY     V  P I+W +TSR+VLTME
Sbjct: 276  ITTDVLTLIDEFACRVYQELNYVQEAQNARRFKKLYADKADVLVPDIFWDYTSRKVLTME 335

Query: 193  WIEGVKLTNQAAMDEAGLSVVDFVDVGIECTLRQLLEHGYFHADPHPGNLLATRGGDLVY 372
            W+EG KL  Q A++  GL V+D V+ GI+C+LRQLLE+G+FHADPHPGNLLAT  G L +
Sbjct: 336  WVEGTKLNEQLAIESQGLKVLDLVNTGIQCSLRQLLEYGFFHADPHPGNLLATPDGKLAF 395

Query: 373  LDFGMMSEAPQYARYAIMAHVVHLVNRDYEAMCKDYYTLQFMDPSVDTTPIAPALAAFFD 552
            LDFGMMSE P+ AR+AI+ HVVHLVNRDYEAM +DYY L+F+ P VD TPI PAL  FFD
Sbjct: 396  LDFGMMSETPEEARFAIIGHVVHLVNRDYEAMARDYYALKFLSPDVDVTPIIPALRDFFD 455

Query: 553  DVLDSSVSTLNFKAIVDGLGEVLFQYPFRVPAYYALILRSLTVLEGLALQADPNYKLLAK 732
            D L+ +VS LNFK +VDGLG V +QYPF VP YYALILRSLTVLEGLAL ADPN+K+LA 
Sbjct: 456  DALNYTVSELNFKTLVDGLGAVFYQYPFNVPPYYALILRSLTVLEGLALYADPNFKVLAA 515

Query: 733  AYPYMAKRLLTDPAPELRESFEDLILKDGQF 825
            +YPY AKRLLTDP P LR++  +L+ KDG+F
Sbjct: 516  SYPYFAKRLLTDPNPYLRDALIELLFKDGKF 546

>ref|ZP_00073834.1| COG0661: Predicted unusual protein kinase [Trichodesmium erythraeum
            IMS101]
          Length = 684

 Score =  343 bits (880), Expect = 2e-93
 Identities = 156/267 (58%), Positives = 202/267 (75%)
 Frame = +1

Query: 25   LVPLVDEFARRLFAELDYVQEGHNCERFQALYGSMPRVRTPKIYWQHTSRRVLTMEWIEG 204
            LV ++DEF  R+F E+DY QEG N E+F+ LYG +  +  PKIYW +T RRVLTMEWI G
Sbjct: 241  LVAIMDEFGTRIFEEMDYTQEGRNAEKFKELYGHLKDIYIPKIYWLYTGRRVLTMEWITG 300

Query: 205  VKLTNQAAMDEAGLSVVDFVDVGIECTLRQLLEHGYFHADPHPGNLLATRGGDLVYLDFG 384
             KLTN  A+ E  +     +++G++C+LRQLLEHG+FHADPHPGNLLA+  G LVYLDFG
Sbjct: 301  TKLTNLEAIKEKNIDAKYLIEIGVQCSLRQLLEHGFFHADPHPGNLLASPDGKLVYLDFG 360

Query: 385  MMSEAPQYARYAIMAHVVHLVNRDYEAMCKDYYTLQFMDPSVDTTPIAPALAAFFDDVLD 564
            MMSE   Y RY ++  +VHLVNRD+E + +DY  L+F+ P  D TPI PAL   F++ L 
Sbjct: 361  MMSEVKPYQRYGLLEAIVHLVNRDFEGLAQDYVKLEFLTPETDLTPIIPALTGVFNNALG 420

Query: 565  SSVSTLNFKAIVDGLGEVLFQYPFRVPAYYALILRSLTVLEGLALQADPNYKLLAKAYPY 744
            +SV+ LNFK+I D L  ++++YPFRVPAYYALI+RSL  LEG+A+  DPN+K+L+KAYPY
Sbjct: 421  ASVAELNFKSITDQLSALMYEYPFRVPAYYALIIRSLVTLEGIAINVDPNFKVLSKAYPY 480

Query: 745  MAKRLLTDPAPELRESFEDLILKDGQF 825
            +AKRLLTD +PELR S +DL+ KDG F
Sbjct: 481  VAKRLLTDTSPELRNSLKDLLFKDGNF 507

>ref|NP_681740.1| ORF_ID:tll0950~hypothetical protein [Thermosynechococcus elongatus
            BP-1] gi|22294673|dbj|BAC08502.1|
            ORF_ID:tll0950~hypothetical protein [Thermosynechococcus
            elongatus BP-1]
          Length = 648

 Score =  331 bits (848), Expect = 1e-89
 Identities = 158/271 (58%), Positives = 196/271 (72%)
 Frame = +1

Query: 13   VSQPLVPLVDEFARRLFAELDYVQEGHNCERFQALYGSMPRVRTPKIYWQHTSRRVLTME 192
            +   LV ++DEFA RLF E+DY QEG N ERF  LYG +  V  PKIYW++T RRVLTME
Sbjct: 215  IRSDLVAILDEFASRLFEEMDYTQEGRNAERFARLYGHLTDVYIPKIYWKYTRRRVLTME 274

Query: 193  WIEGVKLTNQAAMDEAGLSVVDFVDVGIECTLRQLLEHGYFHADPHPGNLLATRGGDLVY 372
            W+ GVKL     +   G+     V VG++C+LRQLLEHG+FHADPHPGNLLA   G L Y
Sbjct: 275  WVTGVKLNQPQQIQALGIDPRYMVYVGVQCSLRQLLEHGFFHADPHPGNLLAMPSGKLAY 334

Query: 373  LDFGMMSEAPQYARYAIMAHVVHLVNRDYEAMCKDYYTLQFMDPSVDTTPIAPALAAFFD 552
            LDFGMMSE     RY ++  +VH+VNR+YE++  DY  L F+ P  D  PI PALA  F+
Sbjct: 335  LDFGMMSEIAPEQRYGLLNAIVHIVNREYESLAYDYVRLGFLTPDTDVKPIIPALALVFE 394

Query: 553  DVLDSSVSTLNFKAIVDGLGEVLFQYPFRVPAYYALILRSLTVLEGLALQADPNYKLLAK 732
            D L +SVS LN + I D L EV+++YPF+VPAYYALI+RSL  +EG+A+  DPN+K+L+ 
Sbjct: 395  DALGASVSELNIQRIFDRLSEVMYEYPFQVPAYYALIVRSLLTMEGIAMGVDPNFKVLSA 454

Query: 733  AYPYMAKRLLTDPAPELRESFEDLILKDGQF 825
            AYPY+AKRLLTDPAPELR S   L+LKDGQF
Sbjct: 455  AYPYIAKRLLTDPAPELRTSLASLLLKDGQF 485

>ref|NP_489000.1| hypothetical protein [Nostoc sp. PCC 7120] gi|25534796|pir||AH2425
            hypothetical protein all4960 [imported] - Nostoc sp.
            (strain PCC 7120) gi|17134098|dbj|BAB76659.1|
            ORF_ID:all4960~hypothetical protein [Nostoc sp. PCC 7120]
          Length = 670

 Score =  327 bits (838), Expect = 1e-88
 Identities = 152/271 (56%), Positives = 194/271 (71%)
 Frame = +1

Query: 13   VSQPLVPLVDEFARRLFAELDYVQEGHNCERFQALYGSMPRVRTPKIYWQHTSRRVLTME 192
            V   LV ++DE   R+F E+DY+ EG N ERF  LYG M  V  P+IYW++T+RRVLTME
Sbjct: 236  VRSDLVGILDELGDRIFEEMDYIHEGENAERFFQLYGHMQDVYVPRIYWEYTNRRVLTME 295

Query: 193  WIEGVKLTNQAAMDEAGLSVVDFVDVGIECTLRQLLEHGYFHADPHPGNLLATRGGDLVY 372
            WI G KLT    +   G+     ++VG++C+LRQLLEHG+FHADPHPGNLLAT  G L Y
Sbjct: 296  WINGTKLTQTEEISSQGIDARYLIEVGVQCSLRQLLEHGFFHADPHPGNLLATPDGKLAY 355

Query: 373  LDFGMMSEAPQYARYAIMAHVVHLVNRDYEAMCKDYYTLQFMDPSVDTTPIAPALAAFFD 552
            LDFGMMSE     RY ++  +VH+VNRD+E + KDY  L F+ P  D TPI PA    F 
Sbjct: 356  LDFGMMSEIKPPQRYGLIEAIVHVVNRDFEGLAKDYVKLDFLSPETDLTPIIPAFGKVFA 415

Query: 553  DVLDSSVSTLNFKAIVDGLGEVLFQYPFRVPAYYALILRSLTVLEGLALQADPNYKLLAK 732
            +   +SV+  N K+I D L E++++YPFRVP YYALI+RSL  LEG+A+  DPN+K+L++
Sbjct: 416  NAQGASVAEFNIKSITDELSELMYEYPFRVPPYYALIIRSLVTLEGIAIYIDPNFKVLSE 475

Query: 733  AYPYMAKRLLTDPAPELRESFEDLILKDGQF 825
            AYPY+AKRLLTDPAPELR S  DL+ KDG+F
Sbjct: 476  AYPYVAKRLLTDPAPELRISLRDLLFKDGRF 506



EST assemble image


clone accession position
1 CL41c06_r AV395438 1 470
2 MXL023f02_r BP094472 335 825




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research