KCC000548A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000548A_C01 KCC000548A_c01
CATTGATTCGTTGTTACAGCGCCCATGGACACGGCGGCACCCAACCGCTCATGTGCACCA
GTCCGATGGCCCCGTGCGCGATCACCCCCACACTCAATGGAATCTTCTCAGGGCAAATCC
AATCCATCCATGCCAGTTCACGAGGAGAGCACCCGCTTCCAGCGCTCCCCAACTTAAACT
ACGAAGGAGAAGCGCCCACGACAAACGATTCTATGTACCGGTATCCGAGTAGCACAGCCG
CAAGGGCCACATCCTCTTGCTCCGTTCAGTACCTCCGGCACACACACGAACACACCAACC
CACACGCAGACCGCTTTCCCGCCTTCGCATACGCGCCGTCCTCCCGCCTTCGCCGCCAGG
AAGAGGGTGCACCGCTGCGTCACTTCTGCCGGCCGACGTTGAGCCACTTGCCCGCATCTG
ACAGCGC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000548A_C01 KCC000548A_c01
         (427 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAC44888.1| unknown [Nannocystis exedens]                           38  0.028
dbj|BAB64631.1| OSJNBa0083M16.32 [Oryza sativa (japonica cultiva...    38  0.037
prf||1814452C Hyp-rich glycoprotein                                    37  0.083
ref|NP_406242.1| conserved hypothetical protein [Yersinia pestis...    37  0.083
ref|NP_668872.1| hypothetical [Yersinia pestis KIM] gi|21958341|...    37  0.083

>gb|AAC44888.1| unknown [Nannocystis exedens]
          Length = 290

 Score = 38.1 bits (87), Expect = 0.028
 Identities = 26/111 (23%), Positives = 46/111 (41%), Gaps = 1/111 (0%)
 Frame = +1

Query: 16  TAPMDTAAPNRSCAPVRWPRARSPPHSMESSQGKSNPSMPVHEESTRFQR-SPT*TTKEK 192
           T+P   +  +   + VRWP +R+PP    +S    +P  P      R  R +PT +   +
Sbjct: 29  TSPSSASRRSSPSSAVRWPCSRTPPTWSATSPPSRSPCSPPSSRCVRPCRVAPTGSPAPR 88

Query: 193 RPRQTILCTGIRVAQPQGPHPLAPFSTSGTHTNTPTHTQTAFPPSHTRRPP 345
              ++      R   P      +P S + T T+ P    ++ PP+ +   P
Sbjct: 89  PSARSPTPCSSRSRAPSSSTARSPASAAATPTSNPNPCWSSAPPASSSTSP 139

>dbj|BAB64631.1| OSJNBa0083M16.32 [Oryza sativa (japonica cultivar-group)]
          Length = 505

 Score = 37.7 bits (86), Expect = 0.037
 Identities = 38/115 (33%), Positives = 44/115 (38%)
 Frame = +2

Query: 56  HQSDGPVRDHPHTQWNLLRANPIHPCQFTRRAPASSAPQLKLRRRSAHDKRFYVPVSE*H 235
           H+  GP R  P T W LLR +P  P      A AS  P L  R+R     R   P  +  
Sbjct: 90  HRRSGP-RPPPPTIWPLLRPSPARP-----PAAASPHPTLVNRKREKERGRLKKPPGQEQ 143

Query: 236 SRKGHILLLRSVPPAHTRTHQPTRRPLSRLRIRAVLPPSPPGRGCTAASLLPADV 400
           +  G      S  P   R   P   PLSR       PP P      A +LLP  V
Sbjct: 144 ASGGPESSSCSASPTAARRASP---PLSR------APPLPAAGTPAAPALLPCRV 189

>prf||1814452C Hyp-rich glycoprotein
          Length = 349

 Score = 36.6 bits (83), Expect = 0.083
 Identities = 27/112 (24%), Positives = 38/112 (33%)
 Frame = +1

Query: 16  TAPMDTAAPNRSCAPVRWPRARSPPHSMESSQGKSNPSMPVHEESTRFQRSPT*TTKEKR 195
           T P  T AP     P   P    P ++         P+ P +  S +   +   T K   
Sbjct: 107 TPPTYTPAPTPKPTPTPKPTPTPPTYTPSPKPPTPKPTPPTYAPSPKPPATKPPTPKPTP 166

Query: 196 PRQTILCTGIRVAQPQGPHPLAPFSTSGTHTNTPTHTQTAFPPSHTRRPPAF 351
           P  T         +P  P P  P  T       PT+T +  PP+    PP +
Sbjct: 167 PTYT------PSPKPPTPKPTPPTYTPSPKPTPPTYTPSPKPPTPKPTPPTY 212

>ref|NP_406242.1| conserved hypothetical protein [Yersinia pestis]
            gi|25510874|pir||AE0332 conserved hypothetical protein
            YPO2725 [imported] - Yersinia pestis (strain CO92)
            gi|15980703|emb|CAC92964.1| conserved hypothetical
            protein [Yersinia pestis CO92]
          Length = 921

 Score = 36.6 bits (83), Expect = 0.083
 Identities = 34/114 (29%), Positives = 47/114 (40%), Gaps = 4/114 (3%)
 Frame = +1

Query: 16   TAPMDTAAPNRSCAPVRWPRARSPPHSMESSQGKSNPSMPVHEESTRFQRSPT*TTKEKR 195
            TAP +T AP  + AP   P   +PP +    +  + P      E+T    +P  TT    
Sbjct: 820  TAPPETTAPPETTAP---PETTAPPETTAPPETTAPPETTAPPETT----APPETTA--- 869

Query: 196  PRQTILCTGIRVAQPQGPHPLAPFSTSGTHTNTPTHT----QTAFPPSHTRRPP 345
            P +T        A P+   P  P +T+   T  P  T    +T  PP  TR PP
Sbjct: 870  PPET-------TAPPETTAP--PETTAPPETTAPPETTAPPETTAPPEPTRTPP 914

>ref|NP_668872.1| hypothetical [Yersinia pestis KIM]
            gi|21958341|gb|AAM85123.1|AE013759_1 hypothetical
            [Yersinia pestis KIM]
          Length = 861

 Score = 36.6 bits (83), Expect = 0.083
 Identities = 34/114 (29%), Positives = 47/114 (40%), Gaps = 4/114 (3%)
 Frame = +1

Query: 16   TAPMDTAAPNRSCAPVRWPRARSPPHSMESSQGKSNPSMPVHEESTRFQRSPT*TTKEKR 195
            TAP +T AP  + AP   P   +PP +    +  + P      E+T    +P  TT    
Sbjct: 760  TAPPETTAPPETTAP---PETTAPPETTAPPETTAPPETTAPPETT----APPETTA--- 809

Query: 196  PRQTILCTGIRVAQPQGPHPLAPFSTSGTHTNTPTHT----QTAFPPSHTRRPP 345
            P +T        A P+   P  P +T+   T  P  T    +T  PP  TR PP
Sbjct: 810  PPET-------TAPPETTAP--PETTAPPETTAPPETTAPPETTAPPEPTRTPP 854



EST assemble image


clone accession position
1 HCL069g09_r AV643444 1 278
2 HC084e11_r AV638299 1 387
3 CL40g08_r AV395366 10 427




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research