KCC000547A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000547A_C01 KCC000547A_c01
TGGATACTACATCATACAATTAGGTACGAAATTTCAGCCGGCCGGACAGGCCAGAGAGGT
CGTGTTTGGCGGGGGGATTAATGGAGTGCTCGAGCCCCTTATTTGCGGCTGCCGTCGCTG
TCGGCAGCATGCTAGAATGCTCGCCAGTGCCGTGCCAACGCCAGCTGTTCGGAGGAGGCT
CCGCGAAAATGGAAGAGGAGTCGCTGTTCGGTCTGTGCAGTCGCGACCGCCAGACACTCG
CGTTCCCGCCGTCCTGCTCGTCAGCGCCAGAGACTTGCAGTGATGTTGGATCATTTGACT
CAGAGAACGAGTCGTCATACTGCTGGATGAACTCATCCTCCACGTTGAAAAGCGAGGAGG
ACCTCTCGCTGCGCCCTGGCTCTCCGGGGCTCTTCTGCGGCGAGGACGATGTGCTGGAAG
ACGACGACGAGGACGCAACTCGCTTTTACCGGCCCGGGACCTTCGTGAGCACGTCCTATA
ATCACGAGGACGCAGAGGAGGCTCTAAGAACGGAGTTCGCCAAGGAGCGCGAGCTGGGGC
CTCACGCATCGCCGCCCATCCTTCCGGAGTATCGTGGAGTACTCGTCGAGTGGATGCGGC
AGTCTTGCGTGCTGCAGGGCTTCGCACCGGCGACATTCTTCACGTCGGCGTCGATCCTCG
ACCGCTTTCTACGCGCCAGTGGCGAGGGGAATGTCCCGCTCTCAGAGTTGCAGATAGCGG
CGCTAACGTGCATGACGCTGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000547A_C01 KCC000547A_c01
         (741 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAQ82688.1| Epa4p [Candida glabrata]                                55  1e-06
gb|AAQ82687.1| Epa5p [Candida glabrata]                                50  4e-05
ref|NP_057417.2| splicing coactivator subunit SRm300; RNA bindin...    49  1e-04
pir||T02345 hypothetical protein KIAA0324 - human (fragment) gi|...    49  1e-04
dbj|BAA83717.1| RNA binding protein [Homo sapiens]                     49  1e-04

>gb|AAQ82688.1| Epa4p [Candida glabrata]
          Length = 1416

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 51/190 (26%), Positives = 83/190 (42%)
 Frame = -3

Query: 643 VKNVAGAKPCSTQDCRIHSTSTPRYSGRMGGDA*GPSSRSLANSVLRASSASS*L*DVLT 464
           +++V    P  +QD    S+S+P  S      +   SS S ++S   +SS+SS      +
Sbjct: 315 IRDVCEPLPTPSQDINSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 374

Query: 463 KVPGR*KRVASSSSSSSTSSSPQKSPGEPGRSERSSSLFNVEDEFIQQYDDSFSESNDPT 284
             P      +SSSSSSS+SSS   SP     S  SSS  +           S S S+  +
Sbjct: 375 PSPS-----SSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 429

Query: 283 SLQVSGADEQDGGNASVWRSRLHRPNSDSSSIFAEPPPNSWRWHGTGEHSSMLPTATAAA 104
           S   S +      ++S   S     +S SSS  + P P+S         SS   ++++++
Sbjct: 430 SPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSS---------SSSSSSSSSSS 480

Query: 103 NKGLEHSINP 74
           +  ++ S  P
Sbjct: 481 SPSIQPSSKP 490

 Score = 42.4 bits (98), Expect = 0.008
 Identities = 36/132 (27%), Positives = 56/132 (42%), Gaps = 1/132 (0%)
 Frame = -3

Query: 436 ASSSSSSSTSSSPQKSPGEPGRSERSSSLFNVEDEFIQQYDDSFSESNDPT-SLQVSGAD 260
           +SSSSSSS+SSS   S      S  SSS  +           S S S+ P+ S   S + 
Sbjct: 344 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSPSPSSSSSSSS 403

Query: 259 EQDGGNASVWRSRLHRPNSDSSSIFAEPPPNSWRWHGTGEHSSMLPTATAAANKGLEHSI 80
                ++S   S     +S SSS  + P P+S     +   SS   +++++++     S 
Sbjct: 404 SSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 463

Query: 79  NPPAKHDLSGLS 44
           +P      S  S
Sbjct: 464 SPSPSSSSSSSS 475

 Score = 41.6 bits (96), Expect = 0.013
 Identities = 48/194 (24%), Positives = 79/194 (39%), Gaps = 9/194 (4%)
 Frame = -3

Query: 724 SAAICNSESGTFPSPLARRKRSRIDADVKNVAGAKPCSTQDCRIHSTST---PRYSGRMG 554
           S++  +S S + PSP +    S   +   + + +   S+      S+S+   P  S    
Sbjct: 381 SSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSS 440

Query: 553 GDA*GPSSRSLANSVLRASSASS*L*DVLTKVPGR*KRVASSSSSSSTSSSPQKSPGEPG 374
             +   SS S ++S   +SS+SS      +  P      +SSSSSSS S  P   P +P 
Sbjct: 441 SSSSSSSSSSSSSSSSSSSSSSS------SPSPSSSSSSSSSSSSSSPSIQPSSKPVDPS 494

Query: 373 RSERSSSLFNVEDEFIQQYDDSFSESNDPTSLQVSGADEQDGGNASV------WRSRLHR 212
            ++ S++  +V    +     + S S    S+        +G   +V             
Sbjct: 495 PADPSNNPSSVNPSSVNPSSINSSPSIISPSVSTKTVTLSNGSTITVTVTVTPTSPNGGN 554

Query: 211 PNSDSSSIFAEPPP 170
            NSDS S F+ PPP
Sbjct: 555 SNSDSDS-FSLPPP 567

 Score = 39.3 bits (90), Expect = 0.065
 Identities = 46/178 (25%), Positives = 69/178 (37%)
 Frame = -3

Query: 724 SAAICNSESGTFPSPLARRKRSRIDADVKNVAGAKPCSTQDCRIHSTSTPRYSGRMGGDA 545
           S++  +S S +  S  +    S   +   + +   P S+      S+S+   S      +
Sbjct: 342 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSPSPSSSSSS 401

Query: 544 *GPSSRSLANSVLRASSASS*L*DVLTKVPGR*KRVASSSSSSSTSSSPQKSPGEPGRSE 365
              SS S ++S   +SS+SS      +  P      +SSSSSSS+SSS   S      S 
Sbjct: 402 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSP-SSSSSSSSSSSSSSSSSSSSSSSSSSS 460

Query: 364 RSSSLFNVEDEFIQQYDDSFSESNDPTSLQVSGADEQDGGNASVWRSRLHRPNSDSSS 191
            SSS              S S S  P+S  V  +      N S        P+S +SS
Sbjct: 461 SSSSPSPSSSSSSSSSSSSSSPSIQPSSKPVDPSPADPSNNPSSVNPSSVNPSSINSS 518

>gb|AAQ82687.1| Epa5p [Candida glabrata]
          Length = 1218

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 49/180 (27%), Positives = 77/180 (42%), Gaps = 1/180 (0%)
 Frame = -3

Query: 643 VKNVAGAKPCSTQDCRIHSTSTPRYSGRMGGDA*GPSSRSLANSVLRASSASS*L*DVLT 464
           +++V    P  +QD    S+S+P  S      +   SS S ++S   +SS+SS      +
Sbjct: 315 IRDVCEPLPTPSQDINSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 374

Query: 463 KVPGR*KRVASSSSSSSTSSSPQKSPGEPGRSERSSSLFNVEDEFIQQYDDSFSESNDPT 284
             P      +SSSSSSS+SSS   SP     S  SSS  +           S S S+  +
Sbjct: 375 PSPSS----SSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 430

Query: 283 SLQVS-GADEQDGGNASVWRSRLHRPNSDSSSIFAEPPPNSWRWHGTGEHSSMLPTATAA 107
           S   S         ++S   S     +S SSS  + P P+S     +   SS   +++++
Sbjct: 431 SSSPSPSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSS 490

 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 46/173 (26%), Positives = 70/173 (39%)
 Frame = -3

Query: 709 NSESGTFPSPLARRKRSRIDADVKNVAGAKPCSTQDCRIHSTSTPRYSGRMGGDA*GPSS 530
           NS S + PSP +    S   +   + + +   S+      S+S+          +   SS
Sbjct: 330 NSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSS 389

Query: 529 RSLANSVLRASSASS*L*DVLTKVPGR*KRVASSSSSSSTSSSPQKSPGEPGRSERSSSL 350
            S ++S   +SS+SS      +         +SSSSSSS+SSS   SP     S  SSS 
Sbjct: 390 SSSSSSPSPSSSSSS---SSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSRSSSSSSSS 446

Query: 349 FNVEDEFIQQYDDSFSESNDPTSLQVSGADEQDGGNASVWRSRLHRPNSDSSS 191
            +           S S S+ P+    S +      ++S   S    P+S SSS
Sbjct: 447 SSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSPSPSSSSSS 499

 Score = 40.4 bits (93), Expect = 0.029
 Identities = 49/191 (25%), Positives = 78/191 (40%), Gaps = 6/191 (3%)
 Frame = -3

Query: 724 SAAICNSESGTFPSPLARRKRSRIDADVKNVAGAKPCSTQDCRIHSTSTPRYSGRMGGDA 545
           S++  +S S + PSP     RS   +   + + +   S+      S+S+P          
Sbjct: 422 SSSSSSSSSSSSPSP----SRSSSSSSSSSSSSSSSSSSSSSSSSSSSSP---------- 467

Query: 544 *GPSSRSLANSVLRASSASS*L*DVLTKVPGR*KRVASSSSSSSTSSSPQKSPGEPGRSE 365
             PSS S ++S   +SS+SS      +  P      +SSSSSSS S  P   P +P  ++
Sbjct: 468 -SPSSSSSSSSSSSSSSSSS---SSSSPSPSSSSSSSSSSSSSSPSIQPSSKPVDPSPAD 523

Query: 364 RSSSLFNVEDEFIQQYDDSFSESNDPTSLQVSGADEQDGGNASV------WRSRLHRPNS 203
            S++  +V    +     + S S    S+        +G   +V              NS
Sbjct: 524 PSNNPSSVNPSSVNPSSINSSPSIISPSVSTKTVTLSNGSTITVTVTVTPTSPNGGNSNS 583

Query: 202 DSSSIFAEPPP 170
           DS S F+ PPP
Sbjct: 584 DSDS-FSLPPP 593

 Score = 39.7 bits (91), Expect = 0.050
 Identities = 44/183 (24%), Positives = 72/183 (39%)
 Frame = -3

Query: 724 SAAICNSESGTFPSPLARRKRSRIDADVKNVAGAKPCSTQDCRIHSTSTPRYSGRMGGDA 545
           S++  +S S + PSP +    S   +   + +   P S+      S+S+   S      +
Sbjct: 363 SSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSSSSSSSSSSSSS 422

Query: 544 *GPSSRSLANSVLRASSASS*L*DVLTKVPGR*KRVASSSSSSSTSSSPQKSPGEPGRSE 365
              SS S ++S   + S+SS      +         +SSSSSSS S S   S      S 
Sbjct: 423 SSSSSSSSSSSPSPSRSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPSSSSSSSSSSSSS 482

Query: 364 RSSSLFNVEDEFIQQYDDSFSESNDPTSLQVSGADEQDGGNASVWRSRLHRPNSDSSSIF 185
            SSS  +           S S S+ P+    S   +    + S   S ++  + + SSI 
Sbjct: 483 SSSSSSSSPSPSSSSSSSSSSSSSSPSIQPSSKPVDPSPADPSNNPSSVNPSSVNPSSIN 542

Query: 184 AEP 176
           + P
Sbjct: 543 SSP 545

>ref|NP_057417.2| splicing coactivator subunit SRm300; RNA binding protein; AT-rich
            element binding factor [Homo sapiens]
            gi|5821153|dbj|BAA83718.1| RNA binding protein [Homo
            sapiens]
          Length = 2752

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 58/185 (31%), Positives = 80/185 (42%), Gaps = 3/185 (1%)
 Frame = +1

Query: 163  SCSEEAPRKWKRSRCSVCAVATARHSRSRRPARQRQRLAVMLDHLTQRTSRHTAG*THPP 342
            S S  +P  WKRSR S  + AT R SRSR P   R+R       +++R SR     T   
Sbjct: 1852 SRSRTSPAPWKRSR-SRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVT--- 1907

Query: 343  R*KARRTSRCALALRGSSAARTM-CWKTTTRTQLAFTGPGPS*ARPIITRTQRRL*ERSS 519
              + R  SR +   R  S +RT    +  +R++   T        P +TR + R   R+ 
Sbjct: 1908 --RRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSR--SRTP 1963

Query: 520  PRSASWGLTHRRPSFRS--IVEYSSSGCGSLACCRASHRRHSSRRRRSSTAFYAPVARGM 693
            P      +T RR   R+  I    S    S    R S  R S   RR S +  +PV R  
Sbjct: 1964 P------VTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRR 2017

Query: 694  SRSQS 708
            SRS++
Sbjct: 2018 SRSRT 2022

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 62/235 (26%), Positives = 85/235 (35%), Gaps = 17/235 (7%)
 Frame = -1

Query: 708  TLRAGHSPRHWRVESGRGSTPT*RMSPVRSPAAR----------------KTAASTRRVL 577
            T R   S    R    R  TP  R S  RSP  R                +T A   R  
Sbjct: 600  TRRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSPARRSGRSRSRTPARRGRSR 659

Query: 576  HDTPEGWAAMR-EAPARAPWRTPFLEPPLRPRDYRTCSRRSRAGKSELRPRRRLPAHRPR 400
              TP      R   PAR   R+    P  R R      RR R+    L  R R  +  P+
Sbjct: 660  SRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGRSHSRTPQ 719

Query: 399  RRRAPESQGAARGPPRFSTWRMSSSSSMTTRSLSQMIQHHCKSLALTSRTAGTRVSGGRD 220
            RR    S    +   R S  R  S+SS   +  S++     +SL+     A +R+S  R 
Sbjct: 720  RRGRSGSSSERKNKSRTSQRRSRSNSSPEMKK-SRISSRRSRSLSSPRSKAKSRLSLRRS 778

Query: 219  CTDRTATPLPFSRSLLRTAGVGTALASILACCRQRRQPQIRGSSTPLIPPPNTTS 55
             +  +  P   S++  R +  G++     +    RR    R SS+   PPP   S
Sbjct: 779  LSGSSPCPKQKSQTPPRRSRSGSSQPKAKSRTPPRRS---RSSSS---PPPKQKS 827

 Score = 40.0 bits (92), Expect = 0.038
 Identities = 64/233 (27%), Positives = 92/233 (39%), Gaps = 27/233 (11%)
 Frame = -1

Query: 660  RGSTPT*RMSPVRSPAARKTAAST----RRVLHDTPEGWAAMREAPARAPWRTPFLEPPL 493
            R  TPT R S  R+PA R  + S     RR    +P    +   +PAR   R+    P  
Sbjct: 595  RSRTPTRRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSPARRSGRSRSRTPAR 654

Query: 492  RPRDY-RTCSRRSRA-----GKSELRPRRRLPAHRPRRRRAPESQGAARGPP-------- 355
            R R   RT +RR R+      +   R R R PA R R R     +G +R           
Sbjct: 655  RGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRGRSRSRSLVRRGRSH 714

Query: 354  -RFSTWRMSSSSSMTTRSLSQMIQHHCKSLALTSRTAGTRVSGGRDCTDRTATPLPFSRS 178
             R    R  S SS   ++ S+  Q   +S + +     +R+S  R  +  +      SR 
Sbjct: 715  SRTPQRRGRSGSSSERKNKSRTSQRRSRSNS-SPEMKKSRISSRRSRSLSSPRSKAKSRL 773

Query: 177  LLRTAGVGTALASILACCRQRRQPQIR----GSSTP----LIPPPNTTSLACP 43
             LR +  G++      C +Q+ Q   R    GSS P      PP  + S + P
Sbjct: 774  SLRRSLSGSS-----PCPKQKSQTPPRRSRSGSSQPKAKSRTPPRRSRSSSSP 821

 Score = 39.3 bits (90), Expect = 0.065
 Identities = 47/189 (24%), Positives = 74/189 (38%), Gaps = 23/189 (12%)
 Frame = -1

Query: 675  RVESGRGSTPT*RMSPVRSPAARKTAASTRRVLHDTPEGWAAMREAPARAPW-------- 520
            R +SG  S+P  +    R+   R  + S+ +    +PEG ++   +P   P         
Sbjct: 1613 RAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGS 1672

Query: 519  ------RTPFLEPPLRPRDYRT---------CSRRSRAGKSELRPRRRLPAHRPRRRRAP 385
                  +T    PP R R  R+          SRRSR+  S    R R P   PR RR+P
Sbjct: 1673 RSSPEPKTKSRTPP-RRRSSRSSPELTRKARLSRRSRSASSSPETRSRTP---PRHRRSP 1728

Query: 384  ESQGAARGPPRFSTWRMSSSSSMTTRSLSQMIQHHCKSLALTSRTAGTRVSGGRDCTDRT 205
                        S+ R  S+SS  T++ S+      +  + + +  G + S  R   ++T
Sbjct: 1729 SVSSPEPAEKSRSSRRRRSASSPRTKTTSR------RGRSPSPKPRGLQRSRSRSRREKT 1782

Query: 204  ATPLPFSRS 178
             T     RS
Sbjct: 1783 RTTRRRDRS 1791

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 39/121 (32%), Positives = 51/121 (41%), Gaps = 7/121 (5%)
 Frame = -1

Query: 669  ESGRGSTPT*RMSP-VRSPA-ARKTAASTRRVLHDTPEGWAAMREAPARAPWRTPFLEPP 496
            E+   + P  R SP V SP  A K+ +S RR    +P      R   + +P         
Sbjct: 1715 ETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSR 1774

Query: 495  LRPR--DYRTCSRRSRAGKSELRPRRRLPAH---RPRRRRAPESQGAARGPPRFSTWRMS 331
             R R    RT  RR R+G S+   RRR  +    R  RRR   S   +R P R  + R S
Sbjct: 1775 SRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTS 1834

Query: 330  S 328
            S
Sbjct: 1835 S 1835

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 41/183 (22%), Positives = 71/183 (38%), Gaps = 1/183 (0%)
 Frame = -1

Query: 621  SPAARKTAASTRRVLH-DTPEGWAAMREAPARAPWRTPFLEPPLRPRDYRTCSRRSRAGK 445
            SP  +K+  S+RR     +P   A  R +  R+   +     P   +  +T  RRSR+G 
Sbjct: 746  SPEMKKSRISSRRSRSLSSPRSKAKSRLSLRRSLSGSS----PCPKQKSQTPPRRSRSGS 801

Query: 444  SELRPRRRLPAHRPRRRRAPESQGAARGPPRFSTWRMSSSSSMTTRSLSQMIQHHCKSLA 265
            S+ + + R P  R R   +P  +  ++ P      R S SSS     +         S+ 
Sbjct: 802  SQPKAKSRTPPRRSRSSSSPPPKQKSKTPS-----RQSHSSSSPHPKVKSGTPPRQGSIT 856

Query: 264  LTSRTAGTRVSGGRDCTDRTATPLPFSRSLLRTAGVGTALASILACCRQRRQPQIRGSST 85
                   +     R C + +  P   SR+  R +  G++   + +    R+ P    S  
Sbjct: 857  SPQANEQSVTPQRRSCFESSPDPELKSRTPSRHSCSGSSPPRVKSSTPPRQSPSRSSSPQ 916

Query: 84   PLI 76
            P +
Sbjct: 917  PKV 919

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 47/206 (22%), Positives = 84/206 (39%), Gaps = 1/206 (0%)
 Frame = -3

Query: 688  PSPLARRKRSR-IDADVKNVAGAKPCSTQDCRIHSTSTPRYSGRMGGDA*GPSSRSLANS 512
            P P A   +SR + A    VAG++  S+      ++S   ++G +   A G     +   
Sbjct: 2450 PVPSAFSDQSRCLIAQTTPVAGSQSLSSGAVATTTSSAGDHNGMLSVPAPGVPHSDVGEP 2509

Query: 511  VLRASSASS*L*DVLTKVPGR*KRVASSSSSSSTSSSPQKSPGEPGRSERSSSLFNVEDE 332
               AS+ +     +    P + +R +SSSSSSS+SSS   S      S  SSS  +    
Sbjct: 2510 P--ASTGAQQPSALAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSS 2567

Query: 331  FIQQYDDSFSESNDPTSLQVSGADEQDGGNASVWRSRLHRPNSDSSSIFAEPPPNSWRWH 152
               Q + +      PT         ++G       ++  R +S SSS  +    +S    
Sbjct: 2568 LPVQPEVALKRVPSPTPAPKEAV--REGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSS 2625

Query: 151  GTGEHSSMLPTATAAANKGLEHSINP 74
             +   SS   +++++++     S +P
Sbjct: 2626 SSSSSSSSSSSSSSSSSSSSSSSPSP 2651

 Score = 32.3 bits (72), Expect = 8.0
 Identities = 52/212 (24%), Positives = 82/212 (38%), Gaps = 6/212 (2%)
 Frame = -1

Query: 690  SPRHWRVESGRGSTPT*RMSPVRSPAARKTAAST---RRVLHDTPEGWAAMREAPARAPW 520
            SP+  +V     S+P     P  +P + +  +S+   +   H   +   +    P+R   
Sbjct: 424  SPQPTKVSRHASSSPE-SPKPAPAPGSHREISSSPTSKNRSHGRAKRDKSHSHTPSRRMG 482

Query: 519  RTPFLEPPLRPRDY-RTCSRRSRAGKSELRPRRRLPAHRPRRRRAPESQGAARGPPRFST 343
            R+       R R   RT ++R  +     + RR   A R  R R+P+ +G +R P R   
Sbjct: 483  RSRSPATAKRGRSRSRTPTKRGHSRSRSPQWRRSRSAQRWGRSRSPQRRGRSRSPQR-PG 541

Query: 342  WRMSSSSSMTTRSLS-QMIQHHCKSLALTSRTAGTRVSGGRDCTDRTATPLPFSRSLLRT 166
            W  S ++    RS S +  + H +S A   R+             R+ TP    RS  RT
Sbjct: 542  WSRSRNTQRRGRSRSARRGRSHSRSPATRGRS-------------RSRTPARRGRSRSRT 588

Query: 165  AGVGTALASILACCRQR-RQPQIRGSSTPLIP 73
                 + +      R R R P  RG S    P
Sbjct: 589  PARRRSRSRTPTRRRSRSRTPARRGRSRSRTP 620

>pir||T02345 hypothetical protein KIAA0324 - human (fragment)
            gi|2996650|gb|AAC08453.1| KIAA0324 [Homo sapiens]
          Length = 1791

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 58/185 (31%), Positives = 80/185 (42%), Gaps = 3/185 (1%)
 Frame = +1

Query: 163  SCSEEAPRKWKRSRCSVCAVATARHSRSRRPARQRQRLAVMLDHLTQRTSRHTAG*THPP 342
            S S  +P  WKRSR S  + AT R SRSR P   R+R       +++R SR     T   
Sbjct: 884  SRSRTSPAPWKRSR-SRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVT--- 939

Query: 343  R*KARRTSRCALALRGSSAARTM-CWKTTTRTQLAFTGPGPS*ARPIITRTQRRL*ERSS 519
              + R  SR +   R  S +RT    +  +R++   T        P +TR + R   R+ 
Sbjct: 940  --RRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSR--SRTP 995

Query: 520  PRSASWGLTHRRPSFRS--IVEYSSSGCGSLACCRASHRRHSSRRRRSSTAFYAPVARGM 693
            P      +T RR   R+  I    S    S    R S  R S   RR S +  +PV R  
Sbjct: 996  P------VTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRR 1049

Query: 694  SRSQS 708
            SRS++
Sbjct: 1050 SRSRT 1054

 Score = 39.3 bits (90), Expect = 0.065
 Identities = 47/189 (24%), Positives = 74/189 (38%), Gaps = 23/189 (12%)
 Frame = -1

Query: 675  RVESGRGSTPT*RMSPVRSPAARKTAASTRRVLHDTPEGWAAMREAPARAPW-------- 520
            R +SG  S+P  +    R+   R  + S+ +    +PEG ++   +P   P         
Sbjct: 645  RAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGS 704

Query: 519  ------RTPFLEPPLRPRDYRT---------CSRRSRAGKSELRPRRRLPAHRPRRRRAP 385
                  +T    PP R R  R+          SRRSR+  S    R R P   PR RR+P
Sbjct: 705  RSSPEPKTKSRTPP-RRRSSRSSPELTRKARLSRRSRSASSSPETRSRTP---PRHRRSP 760

Query: 384  ESQGAARGPPRFSTWRMSSSSSMTTRSLSQMIQHHCKSLALTSRTAGTRVSGGRDCTDRT 205
                        S+ R  S+SS  T++ S+      +  + + +  G + S  R   ++T
Sbjct: 761  SVSSPEPAEKSRSSRRRRSASSPRTKTTSR------RGRSPSPKPRGLQRSRSRSRREKT 814

Query: 204  ATPLPFSRS 178
             T     RS
Sbjct: 815  RTTRRRDRS 823

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 39/121 (32%), Positives = 51/121 (41%), Gaps = 7/121 (5%)
 Frame = -1

Query: 669  ESGRGSTPT*RMSP-VRSPA-ARKTAASTRRVLHDTPEGWAAMREAPARAPWRTPFLEPP 496
            E+   + P  R SP V SP  A K+ +S RR    +P      R   + +P         
Sbjct: 747  ETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSR 806

Query: 495  LRPR--DYRTCSRRSRAGKSELRPRRRLPAH---RPRRRRAPESQGAARGPPRFSTWRMS 331
             R R    RT  RR R+G S+   RRR  +    R  RRR   S   +R P R  + R S
Sbjct: 807  SRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTS 866

Query: 330  S 328
            S
Sbjct: 867  S 867

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 47/206 (22%), Positives = 84/206 (39%), Gaps = 1/206 (0%)
 Frame = -3

Query: 688  PSPLARRKRSR-IDADVKNVAGAKPCSTQDCRIHSTSTPRYSGRMGGDA*GPSSRSLANS 512
            P P A   +SR + A    VAG++  S+      ++S   ++G +   A G     +   
Sbjct: 1482 PVPSAFSDQSRCLIAQTTPVAGSQSLSSGAVATTTSSAGDHNGMLSVPAPGVPHSDVGEP 1541

Query: 511  VLRASSASS*L*DVLTKVPGR*KRVASSSSSSSTSSSPQKSPGEPGRSERSSSLFNVEDE 332
               AS+ +     +    P + +R +SSSSSSS+SSS   S      S  SSS  +    
Sbjct: 1542 P--ASTGAQQPSALAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSS 1599

Query: 331  FIQQYDDSFSESNDPTSLQVSGADEQDGGNASVWRSRLHRPNSDSSSIFAEPPPNSWRWH 152
               Q + +      PT         ++G       ++  R +S SSS  +    +S    
Sbjct: 1600 LPVQPEVALKRVPSPTPAPKEAV--REGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSS 1657

Query: 151  GTGEHSSMLPTATAAANKGLEHSINP 74
             +   SS   +++++++     S +P
Sbjct: 1658 SSSSSSSSSSSSSSSSSSSSSSSPSP 1683

>dbj|BAA83717.1| RNA binding protein [Homo sapiens]
          Length = 1275

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 58/185 (31%), Positives = 80/185 (42%), Gaps = 3/185 (1%)
 Frame = +1

Query: 163 SCSEEAPRKWKRSRCSVCAVATARHSRSRRPARQRQRLAVMLDHLTQRTSRHTAG*THPP 342
           S S  +P  WKRSR S  + AT R SRSR P   R+R       +++R SR     T   
Sbjct: 375 SRSRTSPAPWKRSR-SRASPATHRRSRSRTPLISRRRSRSRTSPVSRRRSRSRTSVT--- 430

Query: 343 R*KARRTSRCALALRGSSAARTM-CWKTTTRTQLAFTGPGPS*ARPIITRTQRRL*ERSS 519
             + R  SR +   R  S +RT    +  +R++   T        P +TR + R   R+ 
Sbjct: 431 --RRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSR--SRTP 486

Query: 520 PRSASWGLTHRRPSFRS--IVEYSSSGCGSLACCRASHRRHSSRRRRSSTAFYAPVARGM 693
           P      +T RR   R+  I    S    S    R S  R S   RR S +  +PV R  
Sbjct: 487 P------VTRRRSRSRTSPITRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRRR 540

Query: 694 SRSQS 708
           SRS++
Sbjct: 541 SRSRT 545

 Score = 39.3 bits (90), Expect = 0.065
 Identities = 47/189 (24%), Positives = 74/189 (38%), Gaps = 23/189 (12%)
 Frame = -1

Query: 675 RVESGRGSTPT*RMSPVRSPAARKTAASTRRVLHDTPEGWAAMREAPARAPW-------- 520
           R +SG  S+P  +    R+   R  + S+ +    +PEG ++   +P   P         
Sbjct: 136 RAQSGSDSSPEPKAPAPRALPRRSRSGSSSKGRGPSPEGSSSTESSPEHPPKSRTARRGS 195

Query: 519 ------RTPFLEPPLRPRDYRT---------CSRRSRAGKSELRPRRRLPAHRPRRRRAP 385
                 +T    PP R R  R+          SRRSR+  S    R R P   PR RR+P
Sbjct: 196 RSSPEPKTKSRTPP-RRRSSRSSPELTRKARLSRRSRSASSSPETRSRTP---PRHRRSP 251

Query: 384 ESQGAARGPPRFSTWRMSSSSSMTTRSLSQMIQHHCKSLALTSRTAGTRVSGGRDCTDRT 205
                       S+ R  S+SS  T++ S+      +  + + +  G + S  R   ++T
Sbjct: 252 SVSSPEPAEKSRSSRRRRSASSPRTKTTSR------RGRSPSPKPRGLQRSRSRSRREKT 305

Query: 204 ATPLPFSRS 178
            T     RS
Sbjct: 306 RTTRRRDRS 314

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 39/121 (32%), Positives = 51/121 (41%), Gaps = 7/121 (5%)
 Frame = -1

Query: 669 ESGRGSTPT*RMSP-VRSPA-ARKTAASTRRVLHDTPEGWAAMREAPARAPWRTPFLEPP 496
           E+   + P  R SP V SP  A K+ +S RR    +P      R   + +P         
Sbjct: 238 ETRSRTPPRHRRSPSVSSPEPAEKSRSSRRRRSASSPRTKTTSRRGRSPSPKPRGLQRSR 297

Query: 495 LRPR--DYRTCSRRSRAGKSELRPRRRLPAH---RPRRRRAPESQGAARGPPRFSTWRMS 331
            R R    RT  RR R+G S+   RRR  +    R  RRR   S   +R P R  + R S
Sbjct: 298 SRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGYHSRSPARQESSRTS 357

Query: 330 S 328
           S
Sbjct: 358 S 358

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 47/206 (22%), Positives = 84/206 (39%), Gaps = 1/206 (0%)
 Frame = -3

Query: 688  PSPLARRKRSR-IDADVKNVAGAKPCSTQDCRIHSTSTPRYSGRMGGDA*GPSSRSLANS 512
            P P A   +SR + A    VAG++  S+      ++S   ++G +   A G     +   
Sbjct: 973  PVPSAFSDQSRCLIAQTTPVAGSQSLSSGAVATTTSSAGDHNGMLSVPAPGVPHSDVGEP 1032

Query: 511  VLRASSASS*L*DVLTKVPGR*KRVASSSSSSSTSSSPQKSPGEPGRSERSSSLFNVEDE 332
               AS+ +     +    P + +R +SSSSSSS+SSS   S      S  SSS  +    
Sbjct: 1033 P--ASTGAQQPSALAALQPAKERRSSSSSSSSSSSSSSSSSSSSSSSSSGSSSSDSEGSS 1090

Query: 331  FIQQYDDSFSESNDPTSLQVSGADEQDGGNASVWRSRLHRPNSDSSSIFAEPPPNSWRWH 152
               Q + +      PT         ++G       ++  R +S SSS  +    +S    
Sbjct: 1091 LPVQPEVALKRVPSPTPAPKEAV--REGRPPEPTPAKRKRRSSSSSSSSSSSSSSSSSSS 1148

Query: 151  GTGEHSSMLPTATAAANKGLEHSINP 74
             +   SS   +++++++     S +P
Sbjct: 1149 SSSSSSSSSSSSSSSSSSSSSSSPSP 1174



EST assemble image


clone accession position
1 CL40f07_r AV395374 1 564
2 CL43b04_r AV395553 103 617
3 MXL070c10_r BP097112 103 528
4 LCL017a05_r AV626869 103 427
5 MXL031d06_r BP094870 113 517
6 HCL049f12_r AV642321 426 847




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research