KCC000546A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000546A_C01 KCC000546A_c01
cgcaaatcaCTGTCTAATTGCTCACCGCTTCATTCACGGGACCCAGCGCTGTCTGTCGAC
TTTAGCCTTTCCCGATGCTCGCGGCCAGGCAGCTGAGCAGCCACAGGCCAGGCCGGTTCG
GCCATCGTAACCGGGCGGCGCTGAGGATTCAAGCAATTTCAGCACCTGTGACCACTGGCG
AGGGCGAATGCCCGCTGTTCCAGACGCGTGAGGGGAAGATCGTTCCAGCCATGTGTGCGG
ACTACGGCTTCCGCAGCGGCAGCGGGCGGCTGTATCAGGAGGGGTACGGCGAGGTGCCCA
AGGACGTATGGCAGCTGGCCAAGGACAACTACCTGCATGAGTTCACTCAGCTGCGGCGCT
CCACCCGCTACCCGCCCTCCGACATCACGGCGCCGGATGGTGCCGTTGCCAAGGTGCTGC
ACTCAGCGGGCGCAGCGGCGGCCCGCGCGTTCGGGTCTCTGGACAAGGCGTTGGAGAACG
CGGGCGTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000546A_C01 KCC000546A_c01
         (488 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAM12876.1|AF494290_1 quinol-to-oxygen oxidoreductase [Chlamy...    78  5e-14
pir||C34768 ORF2 protein - Orf virus (strain NZ2) gi|332565|gb|A...    40  0.015
ref|ZP_00092697.1| COG1020: Non-ribosomal peptide synthetase mod...    40  0.015
ref|XP_303813.1| hypothetical protein XP_303813 [Homo sapiens]         39  0.034
dbj|BAA90639.1| Similar to Arabidopsis thaliana chromosome II BA...    39  0.044

>gb|AAM12876.1|AF494290_1 quinol-to-oxygen oxidoreductase [Chlamydomonas reinhardtii]
          Length = 471

 Score = 78.2 bits (191), Expect = 5e-14
 Identities = 42/106 (39%), Positives = 61/106 (56%), Gaps = 5/106 (4%)
 Frame = +3

Query: 186 ECPLFQTREGKIVPAMCADYGFRSGSGRLY-QEGYGEVPKDVWQLAKDNYLHEFTQLRRS 362
           EC  F  R+G  +  MC DYGFRSG+ R+Y QE  G +PK+ +QL  DN+  E   LR+S
Sbjct: 81  ECSAFIDRDGDFMEVMCCDYGFRSGASRMYQQENDGRIPKNAFQLGWDNFKSELRSLRQS 140

Query: 363 TRYPP----SDITAPDGAVAKVLHSAGAAAARAFGSLDKALENAGV 488
            R+      S+   P   +++  +S G AA  +  ++D+ALE A V
Sbjct: 141 IRFDDYSTISEANPPRTPMSRAAYSVGQAALDSLDAVDRALEAAQV 186

>pir||C34768 ORF2 protein - Orf virus (strain NZ2) gi|332565|gb|AAA46789.1| ORF2
          Length = 221

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 36/106 (33%), Positives = 40/106 (36%), Gaps = 1/106 (0%)
 Frame = +1

Query: 172 PLARANARCSRRVRGRSFQPCVRTTASAAAAGGCI-RRGTARCPRTYGSWPRTTTCMSSL 348
           P  R  ARC RR R R          +    GGC  RR  AR       W R   C    
Sbjct: 24  PRRRWCARCWRRARARR---------ARTRRGGCRWRRCCARRCAAAARWTRGCRCCWR- 73

Query: 349 SCGAPPATRPPTSRRRMVPLPRCCTQRAQRRPARSGLWTRRWRTRA 486
             GA P  R   +  R      CC +RA+      G W RRWR RA
Sbjct: 74  --GAGPRPRRAPAAARGARRRGCCARRARG----GGGWPRRWRPRA 113

>ref|ZP_00092697.1| COG1020: Non-ribosomal peptide synthetase modules and related
            proteins [Azotobacter vinelandii]
          Length = 4332

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 38/108 (35%), Positives = 46/108 (42%), Gaps = 3/108 (2%)
 Frame = +1

Query: 172  PLARANARCSRR---VRGRSFQPCVRTTASAAAAGGCIRRGTARCPRTYGSWPRTTTCMS 342
            P  RA  R + R   VRG   QP      SAA   G  RRGTA       + PR     +
Sbjct: 1003 PAVRAAGRGAGRRAAVRG-DVQPPAARPGSAAPPAGAARRGTAL------AQPRGQVRPA 1055

Query: 343  SLSCGAPPATRPPTSRRRMVPLPRCCTQRAQRRPARSGLWTRRWRTRA 486
            +   G PP   PP  R R+  + R   +RA RR  R+   T R   RA
Sbjct: 1056 TAQRGGPPGAYPPVFRLRLRTV-RARQRRASRRAFRAPAGTDRREPRA 1102

>ref|XP_303813.1| hypothetical protein XP_303813 [Homo sapiens]
          Length = 615

 Score = 38.9 bits (89), Expect = 0.034
 Identities = 33/124 (26%), Positives = 51/124 (40%), Gaps = 5/124 (4%)
 Frame = +1

Query: 25  PLHSRDPALSVDFSLSRCS-----RPGS*AATGQAGSAIVTGRR*GFKQFQHL*PLARAN 189
           PLH +DP ++    L +       R     AT Q+ +++ +G            P  R  
Sbjct: 73  PLHMQDPLVTCQHVLEKLPLVVVWRQSQGTATPQSLASVPSGS-----------PHPRGQ 121

Query: 190 ARCSRRVRGRSFQPCVRTTASAAAAGGCIRRGTARCPRTYGSWPRTTTCMSSLSCGAPPA 369
           ++CS  +RG + Q      A      G   + TA  P     WP T +   S++ G PPA
Sbjct: 122 SQCSNVLRGDTCQ------ARGLDEVGSSMKPTATDPAPLSPWPPTESEAGSVAQGDPPA 175

Query: 370 TRPP 381
           T+ P
Sbjct: 176 TKGP 179

>dbj|BAA90639.1| Similar to Arabidopsis thaliana chromosome II BAC F9O13 genomic
           sequence, putative non-LTR retroelement reverse
           transcriptase. (AC006248) [Oryza sativa (japonica
           cultivar-group)]
          Length = 1223

 Score = 38.5 bits (88), Expect = 0.044
 Identities = 30/97 (30%), Positives = 39/97 (39%), Gaps = 2/97 (2%)
 Frame = -3

Query: 480 RSPTPCPETRTRGPPLRPLSAAPW--QRHHPAP*CRRAGSGWSAAAE*THAGSCPWPAAI 307
           R+PT   E R + PP    +A  W  +R  P     RA   +  A        C W ++ 
Sbjct: 299 RTPTAAIEPREQEPPAVKFAAGKWNSRRIRPPSMAARASPAFFTAPR-----RCCWSSSR 353

Query: 306 RPWAPRRTPPDTAARCRCGSRSPHTWLERSSPHASGT 196
           RPWA   T     ARC    R P T    S  + +GT
Sbjct: 354 RPWA--TTSASAGARC----RPPSTAARASPAYCAGT 384



EST assemble image


clone accession position
1 MXL069g02_r BP097082 1 363
2 MXL083e09_r BP097919 10 428
3 CL40e09_r AV395349 21 488




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research