KCC000545A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000545A_C01 KCC000545A_c01
cgggcagcagcggctcgggtgccgcggcagcggcgccgccagcgccgcaacggcggcctg
tgcgtgaggagctgcggcgcCTGGGGCTGTCGGAGTCGCGCTTCGCCGAGGCCGCGCTGG
GGCTGCTAGGCGGCGAGTGCCCAGCGGCCGTGTCATATGTCCTTGAAGACATGGCGCCGC
AGCGCAACCCCCAAGCACCGCACCCGCAGGGCCGCCTGCATGCACACGCAGGCAGCAGCG
CCATGGCCGCAGCAGCCGGGCCGCTCGGCGCGCCCGAGGTGGTGCTTGAAGAGGAGATTG
GGGGCGCGGGTGAAGCTGGGCCGTCGCCACCGCCGCAGCAGCAGCAGCCGTGGCACCAGC
ATGAGGCGGCCACCGACCTGACGCCGCTGCAGCTCTCTCGGCTGGAGCTTGTGGACTTGC
GTGCCGACATGGGGTTGCCAGCCTCTCCCGTCTCCCCTGCCGACCTCCCCTCCCCATCCT
CCTTGCCTGCCGCGTCGCCAGCAGCCGCCGCGGCCGCATCCTCAGCTGCCTCTCCCCCGG
GGTCCTCAGCCTGCTCTGGCACCTCCTCAGCCTTCTCCGCGAGCGGCATATCAACCCCAC
GCTGGAGCGCCGCCTCGGCCGCCCCGGGCTCGGCAGGCGGCGCTGCTGATGAGAAAACTC
CTGGCACCCTCGTGCCGTCATGCCTATCGCTGCGCTGGCGCTCGGCCCGGCGCCGGGCGC
TG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000545A_C01 KCC000545A_c01
         (722 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|ZP_00057775.1| COG1205: Distinct helicase family with a uniq...    64  2e-09
ref|XP_346988.1| protein tyrosine phosphatase, receptor type, F ...    64  2e-09
ref|NP_851896.1| very large tegument protein [Cercopithecine her...    64  3e-09
dbj|BAC58076.2| large tegument protein [Cercopithecine herpesvir...    62  1e-08
pir||T31328 fibroin - Chinese oak silkmoth gi|3450883|gb|AAC3260...    49  1e-08

>ref|ZP_00057775.1| COG1205: Distinct helicase family with a unique C-terminal domain
           including a metal-binding cysteine cluster [Thermobifida
           fusca]
          Length = 1958

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 80/238 (33%), Positives = 90/238 (37%), Gaps = 23/238 (9%)
 Frame = -3

Query: 705 PSASAAIGMTARGCQE---FSHQQRRLPS-----PGRPRRRSSVGLICRSRRRLRRCQSR 550
           P   AA+    RG +      H++ R P+     PGRP R    G     RRR R C   
Sbjct: 67  PRGGAALPGPRRGGRRRPAARHRRDRRPAVAGRGPGRPARLRRRG----PRRRRRLCPRP 122

Query: 549 LRTPGERQLRMRPRRLLATRQARRMGRGGRQGRRERLATPCR--HASPQAPAERAAAASG 376
            RTP  R  R R RR    RQ     R  R GRR    TP R  H     PA  AAA  G
Sbjct: 123 RRTPRHRAARPRLRRTGPRRQRPHPHR-QRPGRR----TPARPGHRGRGGPAVAAAARRG 177

Query: 375 R------------WPPHAGATAAAAAAVATAQLHPRPQSPLQAPPRARRAARLLRPWRCC 232
           R             P  A A A   A  A AQL  R ++      R  R  R LR  R  
Sbjct: 178 RPGHQRPAAPHPHRPRPAAARARRTAGGAGAQLRARRRATAGRRRRPARPRRPLRRLRRT 237

Query: 231 LRVHA-GGPAGAVLGGCAAAPCLQGHMTRPLGTRRLAAPARPRRSATPTAPGAAAPHA 61
            R HA G   G V G  + AP   G      G  R    A+  R+A    PG   P A
Sbjct: 238 PRPHARGSGQGRVAGRRSGAPGAAGRRQPLPGRPRPVRGAQQHRAAQGALPGGHRPEA 295

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 73/236 (30%), Positives = 85/236 (35%), Gaps = 25/236 (10%)
 Frame = -3

Query: 708 GPSASAAIGMTARGCQEFSHQQRRLPSPGRPR------RRSSVGLICRSRRRLRRCQSRL 547
           GP+ +AA      G     HQ+   P P RPR      RR++ G   + R R R    R 
Sbjct: 167 GPAVAAAARRGRPG-----HQRPAAPHPHRPRPAAARARRTAGGAGAQLRARRRATAGRR 221

Query: 546 RTPGERQLRMRPRRLLATRQARRMGRGGRQGRRERL--ATPCRHASPQAP-----AERAA 388
           R P   +  +R  R      AR  G+G   GRR     A   R   P  P     A++  
Sbjct: 222 RRPARPRRPLRRLRRTPRPHARGSGQGRVAGRRSGAPGAAGRRQPLPGRPRPVRGAQQHR 281

Query: 387 AASGRWP----PHAGATAAAAAAVATAQLHPRPQSPLQAPPR-ARRAARLLRPWRCCLRV 223
           AA G  P    P A       A         RP    Q PPR AR  AR  RP R     
Sbjct: 282 AAQGALPGGHRPEADRRGVRPAPRRLPDSGTRPDR--QPPPRPARVLARPARPVRRAGHR 339

Query: 222 HAGGPAG----AVLGGCAAAPCLQGHMTRPLGTRRLAAPAR--PRRSAT-PTAPGA 76
              G  G       GG   A         P   RR   P R  PRR+ T PT  GA
Sbjct: 340 RPPGRPGRGRLPTAGGALPAGVGGTGRRGPRPRRRRPRPRRTHPRRNRTRPTVQGA 395

 Score = 38.5 bits (88), Expect = 0.11
 Identities = 81/300 (27%), Positives = 94/300 (31%), Gaps = 60/300 (20%)
 Frame = +1

Query: 1   RAAAARVPRQRRRQRRNGGLCVRSCGAWGCRSRASP-------------------RPRWG 123
           R    R P  R R+ R   +  R  G      R  P                   RPR  
Sbjct: 77  RRGGRRRPAARHRRDRRPAVAGRGPGRPARLRRRGPRRRRRLCPRPRRTPRHRAARPRLR 136

Query: 124 C*AASAQRPCHMSLKTWRRS-ATPKHR----------TRRAACMHTQAAAPWPQQPGRSA 270
                 QRP     +  RR+ A P HR           RR    H + AAP P +P    
Sbjct: 137 RTGPRRQRPHPHRQRPGRRTPARPGHRGRGGPAVAAAARRGRPGHQRPAAPHPHRP---- 192

Query: 271 RPRWCLKRRL--GARVKLGRRHRRSSSSRGTSMRRPPT*RRCSSLGWSLWTCVPTWGCQP 444
           RP     RR   GA  +L  R R ++  R    RRP   RR                  P
Sbjct: 193 RPAAARARRTAGGAGAQLRARRRATAGRR----RRPARPRR------------------P 230

Query: 445 LPSPLPTSPPH----------------PPCLPRRQQ-PPRPHP----------QLPLPRG 543
           L     T  PH                P    RRQ  P RP P          Q  LP G
Sbjct: 231 LRRLRRTPRPHARGSGQGRVAGRRSGAPGAAGRRQPLPGRPRPVRGAQQHRAAQGALPGG 290

Query: 544 PQPALAPPQPSPRAAYQPHAGA-PPRPPRARQAALLMRKLLAPSCRHAYRCAGARPGAGR 720
            +P        P     P +G  P R P  R A +L R    P  R  +R    RPG GR
Sbjct: 291 HRPEADRRGVRPAPRRLPDSGTRPDRQPPPRPARVLARP-ARPVRRAGHRRPPGRPGRGR 349

 Score = 35.4 bits (80), Expect = 0.90
 Identities = 51/161 (31%), Positives = 61/161 (37%), Gaps = 20/161 (12%)
 Frame = +1

Query: 235 AAPWPQQPG---RSARPRWCLKRRLGARVKLGRRH--RRSSSSRGTSMRRPPT*RRCSSL 399
           A P  +QP    R+ RPR  L+R  G     G R   RR  ++R    RRP    R    
Sbjct: 46  ARPARRQPAHLPRARRPR--LRRPRGGAALPGPRRGGRRRPAARHRRDRRPAVAGRGPGR 103

Query: 400 GWSLWTCVPTWGCQPLPSPLPTSPPHPPCLPR------RQQPPRPHPQLPLPRGPQ---- 549
              L    P    +  P P  T P H    PR      R+Q P PH Q P  R P     
Sbjct: 104 PARLRRRGPRRRRRLCPRPRRT-PRHRAARPRLRRTGPRRQRPHPHRQRPGRRTPARPGH 162

Query: 550 -----PALAPPQPSPRAAYQPHAGAPPRPPRARQAALLMRK 657
                PA+A      R  +Q    A P P R R AA   R+
Sbjct: 163 RGRGGPAVAAAARRGRPGHQ--RPAAPHPHRPRPAAARARR 201

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 41/137 (29%), Positives = 50/137 (35%), Gaps = 18/137 (13%)
 Frame = +3

Query: 6   SSGSGAAAAAPPAPQR-RPVREELRRLGLSESRFAEAALGLLGGECPAAVSYVLEDMAPQ 182
           S   GAA    P P R RPVR      G  + R A+ AL   GG  P A    +   AP+
Sbjct: 255 SGAPGAAGRRQPLPGRPRPVR------GAQQHRAAQGALP--GGHRPEADRRGVRP-APR 305

Query: 183 RNPQA---------PHPQGRLHAHAGSSAMAAAAGPLGAPEV--------VLEEEIGGAG 311
           R P +         P P   L   A     A    P G P           L   +GG G
Sbjct: 306 RLPDSGTRPDRQPPPRPARVLARPARPVRRAGHRRPPGRPGRGRLPTAGGALPAGVGGTG 365

Query: 312 EAGPSPPPQQQQPWHQH 362
             GP P  ++ +P   H
Sbjct: 366 RRGPRPRRRRPRPRRTH 382

>ref|XP_346988.1| protein tyrosine phosphatase, receptor type, F [Rattus norvegicus]
          Length = 197

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 54/196 (27%), Positives = 83/196 (41%)
 Frame = -2

Query: 589 MPLAEKAEEVPEQAEDPGGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKST 410
           M L + A +    A  P G AA  AAAAAA  AA      G +A     AG   +A  +T
Sbjct: 1   MKLLQLAVQAAAGAAAPAGTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAAT 60

Query: 409 SSSRESCSGVRSVAASCWCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAAMALLP 230
           +++  + +G  + A      G        G A+ A   + ++ T+ A +G AAAA A   
Sbjct: 61  TAAAAAAAGAAATA------GAAAAAAAAGAAATAAAAAGAAATAEAAAGAAAAAAAAAG 114

Query: 229 ACACRRPCGCGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRR 50
           A          A      A ++    TAA  +  +S +AA+A   +++P   + +     
Sbjct: 115 AAEASEAAAGAAAAAAAAAAAAGATATAAAAAGAASAAAAAAGA-AEAPAAAAGAAAAAA 173

Query: 49  CGAGGAAAAAPEPLLP 2
             A  AAAAA    +P
Sbjct: 174 AAAAAAAAAAATAAVP 189

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 43/153 (28%), Positives = 57/153 (37%)
 Frame = -2

Query: 652 SSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAEDPGGEAAEDAAAAAAGDAAGKEDG 473
           ++AA  A   AA  A   G     A         A      A   AAAAAAG AA     
Sbjct: 33  AAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGAAAAAAAAGAAATAAAA 92

Query: 472 EGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASCWCHGCCCCGGGDGPASPAPPIS 293
            G +A  T EA    +A  + ++     S   + AA+         G     A+ A   S
Sbjct: 93  AGAAA--TAEAAAGAAAAAAAAAGAAEASEAAAGAAAAAAAAAAAAGATATAAAAAGAAS 150

Query: 292 SSSTTSGAPSGPAAAAMALLPACACRRPCGCGA 194
           +++  +GA   PAAAA A   A A        A
Sbjct: 151 AAAAAAGAAEAPAAAAGAAAAAAAAAAAAAAAA 183

 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 45/136 (33%), Positives = 52/136 (38%), Gaps = 1/136 (0%)
 Frame = +2

Query: 17  GCRGSGAASAATAACA*GAAAPGAVG-VALRRGRAGAARRRVPSGRVICP*RHGAAAQPP 193
           G   + AA+AA AA A  AAA GA    A   G A AA     +           A    
Sbjct: 19  GTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGAAA 78

Query: 194 STAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*GGH 373
           + A AG  A          ++ AA  A   A         S A A AAAAAA A A  G 
Sbjct: 79  AAAAAGAAATAAAAAGAAATAEAAAGAAAAAAAAAGAAEASEAAAGAAAAAAAAAAAAGA 138

Query: 374 RPDAAAALSAGACGLA 421
              AAAA  A +   A
Sbjct: 139 TATAAAAAGAASAAAA 154

 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 40/131 (30%), Positives = 49/131 (36%)
 Frame = +2

Query: 29  SGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTAPA 208
           + AA+A TAA A  A A    G A     AGAA     +          A A   + A A
Sbjct: 54  AAAAAATTAAAAAAAGAAATAGAAAAAAAAGAAATAAAAAGAAATAEAAAGAAAAAAAAA 113

Query: 209 GPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*GGHRPDAA 388
           G    +        ++ AA  A G         G + A A AA AA    A  G    AA
Sbjct: 114 GAAEASEAAAGAAAAAAAAAAAAGATATAAAAAGAASAAAAAAGAAEAPAAAAGAAAAAA 173

Query: 389 AALSAGACGLA 421
           AA +A A   A
Sbjct: 174 AAAAAAAAAAA 184

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 45/144 (31%), Positives = 63/144 (43%)
 Frame = -2

Query: 652 SSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAEDPGGEAAEDAAAAAAGDAAGKEDG 473
           ++A   A  GAA AA   G     A  A      AE   G AA  AAAAAAG A   E  
Sbjct: 66  AAAGAAATAGAAAAAAAAGA-AATAAAAAGAAATAEAAAGAAA--AAAAAAGAAEASEAA 122

Query: 472 EGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASCWCHGCCCCGGGDGPASPAPPIS 293
            G +A     A     A    +++  + +G  S AA+         G  + PA+ A   +
Sbjct: 123 AGAAAAAAAAA-----AAAGATATAAAAAGAASAAAAA-------AGAAEAPAAAAG--A 168

Query: 292 SSSTTSGAPSGPAAAAMALLPACA 221
           +++  + A +  AAAA A +PA A
Sbjct: 169 AAAAAAAAAAAAAAAATAAVPAGA 192

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 44/138 (31%), Positives = 52/138 (36%), Gaps = 2/138 (1%)
 Frame = +2

Query: 2   GQQRLGCRGSGAASAATAACA*GAAAP--GAVGVALRRGRAGAARRRVPSGRVICP*RHG 175
           G        + AA+AA AA A GAAA    A G A     A  A     +G         
Sbjct: 19  GTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGAAA 78

Query: 176 AAAQPPSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVA 355
           AAA   + A A   A           + AA  A  GA         + A A AAAAAA A
Sbjct: 79  AAAAAGAAATAAAAAGAAATAEAAAGAAAAAAAAAGAAEASEAAAGAAAAAAAAAAAAGA 138

Query: 356 PA*GGHRPDAAAALSAGA 409
            A       AA+A +A A
Sbjct: 139 TATAAAAAGAASAAAAAA 156

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 39/127 (30%), Positives = 46/127 (35%)
 Frame = +2

Query: 29  SGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTAPA 208
           + A +AATA  A  AAA GA   A     A A                GAA    + A A
Sbjct: 66  AAAGAAATAGAAAAAAAAGAAATAAAAAGAAATAEAAAGAAAAAAAAAGAAEASEAAAGA 125

Query: 209 GPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*GGHRPDAA 388
              A          ++ AA      A     G   + A A  AAAAA A A       A 
Sbjct: 126 AAAAAAAAAAAGATATAAAAAGAASAAAAAAGAAEAPAAAAGAAAAAAAAAAAAAAAAAT 185

Query: 389 AALSAGA 409
           AA+ AGA
Sbjct: 186 AAVPAGA 192

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 43/139 (30%), Positives = 52/139 (36%)
 Frame = +2

Query: 26  GSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTAP 205
           G+ AA+AA AA A  AAA  A G A     A  A                AAA   + A 
Sbjct: 19  GTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAA------------AAATTAAAAA 66

Query: 206 AGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*GGHRPDA 385
           A   A T        ++ AA  A   A     G   +   A  AAAAA A A      +A
Sbjct: 67  AAGAAATAGAAAAAAAAGAAATAAAAA-----GAAATAEAAAGAAAAAAAAAGAAEASEA 121

Query: 386 AAALSAGACGLACRHGVAS 442
           AA  +A A   A   G  +
Sbjct: 122 AAGAAAAAAAAAAAAGATA 140

 Score = 41.2 bits (95), Expect = 0.016
 Identities = 40/142 (28%), Positives = 60/142 (42%)
 Frame = +3

Query: 222 AHAGSSAMAAAAGPLGAPEVVLEEEIGGAGEAGPSPPPQQQQPWHQHEAATDLTPLQLSR 401
           A AG++A AAAA    A          GA  A  +             AAT         
Sbjct: 48  AAAGAAAAAAAATTAAAAAAAGAAATAGAAAAAAAAGAAATAAAAAGAAAT--------- 98

Query: 402 LELVDLRADMGLPASPVSPADLPSPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSA 581
               +  A     A+  + A   S ++  AA+ AAAAAA++ A+   ++A    S+A +A
Sbjct: 99  ---AEAAAGAAAAAAAAAGAAEASEAAAGAAAAAAAAAAAAGATATAAAAAGAASAAAAA 155

Query: 582 SGISTPRWSAASAAPGSAGGAA 647
           +G +    +AA AA  +A  AA
Sbjct: 156 AGAAEAPAAAAGAAAAAAAAAA 177

 Score = 40.8 bits (94), Expect = 0.021
 Identities = 50/207 (24%), Positives = 73/207 (35%)
 Frame = -2

Query: 652 SSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAEDPGGEAAEDAAAAAAGDAAGKEDG 473
           + AA PA   AA AA         A  A      A      AA  AAAAAA   A     
Sbjct: 12  AGAAAPAGTAAAAAAAAAAA----AAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAA 67

Query: 472 EGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASCWCHGCCCCGGGDGPASPAPPIS 293
            G +A     A    +   +T+++    +     AA              G A+ A   +
Sbjct: 68  AGAAATAGAAAAAAAAGAAATAAAAAGAAATAEAAA--------------GAAAAAAAAA 113

Query: 292 SSSTTSGAPSGPAAAAMALLPACACRRPCGCGAWGLRCGAMSSRTYDTAAGHSPPSSPSA 113
            ++  S A +G AAAA A   A          A     GA S+      A  +P ++  A
Sbjct: 114 GAAEASEAAAGAAAAAAAAAAAAGATATAAAAA-----GAASAAAAAAGAAEAPAAAAGA 168

Query: 112 ASAKRDSDSPRRRSSSRTGRRCGAGGA 32
           A+A   + +    +++      GA  A
Sbjct: 169 AAAAAAAAAAAAAAAATAAVPAGAASA 195

 Score = 40.0 bits (92), Expect = 0.036
 Identities = 42/162 (25%), Positives = 64/162 (38%)
 Frame = +3

Query: 162 LEDMAPQRNPQAPHPQGRLHAHAGSSAMAAAAGPLGAPEVVLEEEIGGAGEAGPSPPPQQ 341
           L  +A Q    A  P G   A A ++A AAAA    A              A  +     
Sbjct: 3   LLQLAVQAAAGAAAPAGTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTA 62

Query: 342 QQPWHQHEAATDLTPLQLSRLELVDLRADMGLPASPVSPADLPSPSSLPAASPAAAAAAS 521
                   AAT                A     A+  + A   + ++  AA+ AAAAAA+
Sbjct: 63  AAAAAAGAAAT-----------AGAAAAAAAAGAAATAAAAAGAAATAEAAAGAAAAAAA 111

Query: 522 SAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
           +A +   S A +G ++A +A+  +    + A+AA G+A  AA
Sbjct: 112 AAGAAEASEAAAGAAAAAAAAAAAAGATATAAAAAGAASAAA 153

 Score = 38.5 bits (88), Expect = 0.11
 Identities = 23/79 (29%), Positives = 44/79 (55%)
 Frame = +3

Query: 429 MGLPASPVSPADLPSPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWS 608
           + + A+  + A   + ++  AA+ AAAAAA++AA+   ++  +   +A +A+  +T   +
Sbjct: 6   LAVQAAAGAAAPAGTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAA 65

Query: 609 AASAAPGSAGGAADEKTPG 665
           AA+ A  +AG AA     G
Sbjct: 66  AAAGAAATAGAAAAAAAAG 84

 Score = 35.8 bits (81), Expect = 0.69
 Identities = 21/69 (30%), Positives = 38/69 (54%)
 Frame = +3

Query: 441 ASPVSPADLPSPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASA 620
           A+    A+    ++  AA+ AAAAAA+ A +   ++A + +++A +A     P  +A +A
Sbjct: 110 AAAAGAAEASEAAAGAAAAAAAAAAAAGATATAAAAAGAASAAAAAAGAAEAPAAAAGAA 169

Query: 621 APGSAGGAA 647
           A  +A  AA
Sbjct: 170 AAAAAAAAA 178

 Score = 33.5 bits (75), Expect = 3.4
 Identities = 51/216 (23%), Positives = 77/216 (35%), Gaps = 4/216 (1%)
 Frame = +3

Query: 9   SGSGAAAAAPPAPQRRPVREELRRLGLSESRFAEAALGLLGGECPAAVSYVLEDMAPQRN 188
           + +GAAA A  A               + +  A A      G   AA +      A    
Sbjct: 10  AAAGAAAPAGTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAG 69

Query: 189 PQAPHPQGRLHAHAGSSAMAAAAGPLGAPEVVLEEEIGGAGEAGPSPPPQQQQPWHQHEA 368
             A        A AG++A AAAA    A     E   G A  A  +    +       EA
Sbjct: 70  AAATAGAAAAAAAAGAAATAAAAAGAAA---TAEAAAGAAAAAAAAAGAAEAS-----EA 121

Query: 369 ATDLTPLQLSRLELVDLRADMGLPASPVSPADLPSPSSLPAASPAAAAAASSAASPPGS- 545
           A                    G  A+  + A   + +   A + AAA AAS+AA+  G+ 
Sbjct: 122 AA-------------------GAAAAAAAAA---AAAGATATAAAAAGAASAAAAAAGAA 159

Query: 546 ---SACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
              +A +G ++A +A+  +    +A +A P  A  A
Sbjct: 160 EAPAAAAGAAAAAAAAAAAAAAAAATAAVPAGAASA 195

 Score = 32.0 bits (71), Expect = 9.9
 Identities = 41/181 (22%), Positives = 61/181 (33%)
 Frame = +3

Query: 15  SGAAAAAPPAPQRRPVREELRRLGLSESRFAEAALGLLGGECPAAVSYVLEDMAPQRNPQ 194
           +G AAAA  A             G + +  A A           A +      A      
Sbjct: 18  AGTAAAAAAAAAAAAAAAAAAATGAAATTAAAAGAAAAAAAATTAAAAAAAGAAATAGAA 77

Query: 195 APHPQGRLHAHAGSSAMAAAAGPLGAPEVVLEEEIGGAGEAGPSPPPQQQQPWHQHEAAT 374
           A        A A ++A AAA     A          GA EA  +             AA 
Sbjct: 78  AAAAAAGAAATAAAAAGAAATAEAAAGAAAAAAAAAGAAEASEAAAGAAAAAAAAAAAAG 137

Query: 375 DLTPLQLSRLELVDLRADMGLPASPVSPADLPSPSSLPAASPAAAAAASSAASPPGSSAC 554
                  +        A  G   +P + A   + ++  AA+ AAAAAA++AA P G+++ 
Sbjct: 138 ATATAAAAAGAASAAAAAAGAAEAPAAAAGAAAAAA--AAAAAAAAAAATAAVPAGAASA 195

Query: 555 S 557
           +
Sbjct: 196 T 196

>ref|NP_851896.1| very large tegument protein [Cercopithecine herpesvirus 1]
            gi|30844278|gb|AAP41454.1| very large tegument protein
            [Cercopithecine herpesvirus 1]
          Length = 3288

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 66/207 (31%), Positives = 74/207 (34%), Gaps = 3/207 (1%)
 Frame = -3

Query: 636  LPSPGRPR--RRSSVGLICRSRRRLRRCQSRLRTPGERQLRMRPRRLLATRQARRMGRGG 463
            +P+P RPR  R  + G +   RR      SR   P       RPRR  A           
Sbjct: 2749 VPAPERPRDDRAPAPGRVSLPRRA-----SRQGRPAPSSPLQRPRRRAARPAV------- 2796

Query: 462  RQGRRERLATPCRHASPQAPAERAAAASGRWPPHAGATAAAAAAVATAQLHP-RPQSPLQ 286
              G    LA P     P+ P   +  A+    PHA   +A  A    A   P RP SP  
Sbjct: 2797 --GSLTNLADP-HPPGPETPTPTSPTAN----PHATTASATPAPPPVAATGPTRPTSPAT 2849

Query: 285  APPRARRAARLLRPWRCCLRVHAGGPAGAVLGGCAAAPCLQGHMTRPLGTRRLAAPARPR 106
              P    A R   P           PA        AAP        P      AAPA P 
Sbjct: 2850 PTPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPA 2909

Query: 105  RSATPTAPGAAAPHAQAAVAALAAPLP 25
              A P AP  AAP A AA AA AAP P
Sbjct: 2910 APAAPAAP--AAPAAPAAPAAPAAPAP 2934

 Score = 41.6 bits (96), Expect = 0.013
 Identities = 56/232 (24%), Positives = 80/232 (34%), Gaps = 15/232 (6%)
 Frame = +3

Query: 36   PPAPQRRPVREELRRLGLSESRFAEAALGLLGGECPAAVSYVLEDMAPQRN----PQAPH 203
            PP P  RP       LG  E+  A +A      +   A     +D AP       P+   
Sbjct: 2719 PPDPSPRP-----NELGGGETAAAPSAPDPPPPQTVPAPERPRDDRAPAPGRVSLPRRAS 2773

Query: 204  PQGRLHAHAGSSAMAAAAGPLGAPEVVLEEEIGGAGEAGPSPPPQQQQPWHQHEAATDLT 383
             QGR    A SS +         P V     +      GP  P       + H      T
Sbjct: 2774 RQGR---PAPSSPLQRPRRRAARPAVGSLTNLADPHPPGPETPTPTSPTANPHATTASAT 2830

Query: 384  PLQLSRLELVDLRADMGLPASPVSP---------ADLPSPSSLPAA--SPAAAAAASSAA 530
            P           R     P SP +P         A  P   + PAA  +PAA AA ++ A
Sbjct: 2831 PAPPPVAATGPTR-----PTSPATPTPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAPA 2885

Query: 531  SPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAADEKTPGTLVPSCL 686
            +P   +A +  ++  + +  + P   AA AAP +    A    P    P+ +
Sbjct: 2886 APAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAV 2937

 Score = 40.4 bits (93), Expect = 0.028
 Identities = 43/140 (30%), Positives = 52/140 (36%), Gaps = 5/140 (3%)
 Frame = -3

Query: 417  SPQAPAERAAAASGRWPPHAGATAAAAAAVATAQLHPRPQSPLQAPPRARRAAR-LLRPW 241
            +P+ P +  A A GR          +    A+ Q  P P SPLQ P   RRAAR  +   
Sbjct: 2751 APERPRDDRAPAPGR---------VSLPRRASRQGRPAPSSPLQRP--RRRAARPAVGSL 2799

Query: 240  RCCLRVHAGGPAGAVLGGCAAAPCLQGHMTRPLGTRRLAAPARPRRSAT----PTAPGAA 73
                  H  GP           P        P  T   A PA P  +AT    PT+P   
Sbjct: 2800 TNLADPHPPGPE---------TPTPTSPTANPHATTASATPAPPPVAATGPTRPTSPATP 2850

Query: 72   APHAQAAVAALAAPLPRHPS 13
             P   AA  A A P P  P+
Sbjct: 2851 TPTVAAAGRASAPPAPAAPA 2870

 Score = 39.3 bits (90), Expect = 0.062
 Identities = 45/190 (23%), Positives = 63/190 (32%), Gaps = 31/190 (16%)
 Frame = +3

Query: 186  NPQAPHPQGRLHAHAGSSAMAAAAGP-------LGAPE------------VVLEEEIGGA 308
            +P  P P  R +   G    AA + P       + APE            V L       
Sbjct: 2716 DPPPPDPSPRPNELGGGETAAAPSAPDPPPPQTVPAPERPRDDRAPAPGRVSLPRRASRQ 2775

Query: 309  GEAGPSPPPQQQQPWHQHEAATDLT------------PLQLSRLELVDLRADMGLPASPV 452
            G   PS P Q+ +      A   LT            P   S             PA P 
Sbjct: 2776 GRPAPSSPLQRPRRRAARPAVGSLTNLADPHPPGPETPTPTSPTANPHATTASATPAPPP 2835

Query: 453  SPADLPSPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGS 632
              A  P+  + PA      AAA  A++PP  +A +  ++  + +  + P   AA AAP +
Sbjct: 2836 VAATGPTRPTSPATPTPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAA 2895

Query: 633  AGGAADEKTP 662
                A    P
Sbjct: 2896 PAAPAAPAAP 2905

 Score = 39.3 bits (90), Expect = 0.062
 Identities = 43/143 (30%), Positives = 46/143 (32%), Gaps = 7/143 (4%)
 Frame = -3

Query: 432  PCRHASPQAPAERAAAASGRWPPHAGATAAAAAAVATAQLHPRPQSPLQAPPRARRAARL 253
            P R  SP  P    AAA     P A A  AA AA A       P +P      A  AA  
Sbjct: 2841 PTRPTSPATPTPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAA-- 2898

Query: 252  LRPWRCCLRVHAGGPAGAVLGGCAAAPCLQGHMTRPLGTRRLAAPAR-------PRRSAT 94
                          PA        AAP        P      AAPA        P  +AT
Sbjct: 2899 -----------PAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPVVVPAPTAT 2947

Query: 93   PTAPGAAAPHAQAAVAALAAPLP 25
             TA    +P A AA  A   P P
Sbjct: 2948 LTATTTTSP-APAATPASPVPTP 2969

 Score = 38.9 bits (89), Expect = 0.081
 Identities = 24/61 (39%), Positives = 26/61 (42%)
 Frame = +1

Query: 448  PSPLPTSPPHPPCLPRRQQPPRPHPQLPLPRGPQPALAPPQPSPRAAYQPHAGAPPRPPR 627
            PS LP SPP P   P    PP P P+     G + A AP  P P       A   PR  R
Sbjct: 2700 PSTLPPSPPPPAPHPPDPPPPDPSPRPNELGGGETAAAPSAPDPPPPQTVPAPERPRDDR 2759

Query: 628  A 630
            A
Sbjct: 2760 A 2760

 Score = 38.9 bits (89), Expect = 0.081
 Identities = 44/145 (30%), Positives = 51/145 (34%), Gaps = 37/145 (25%)
 Frame = +1

Query: 298 LGARVKLGRRHRRSSSSRG----------------TSMRRPPT*RRCSSLGWSLWTCVPT 429
           L  R +   RH  +  SRG                T   RPPT     + G       PT
Sbjct: 377 LPTRTRRSARHAATPFSRGSGGDEQTRPAAGPRPPTPASRPPTPGAPPTPG-----APPT 431

Query: 430 WGCQPLPSPLPT--------SPPHPPCLPRR--QQPPRP--------HPQLPLPRGPQPA 555
            G  P P   PT        S P  P  P     +PP P         P  P  R P PA
Sbjct: 432 PGAPPTPGAPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGPTTASSEPPTPAGRPPTPA 491

Query: 556 LAPPQP-SPRAAYQP--HAGAPPRP 621
             PP P +P A+ +P   AG PP P
Sbjct: 492 GRPPTPANPTASSEPPTPAGRPPTP 516

 Score = 38.1 bits (87), Expect = 0.14
 Identities = 59/223 (26%), Positives = 81/223 (35%), Gaps = 7/223 (3%)
 Frame = +3

Query: 33   APPAPQRRPVREELRRLGLSESRFAEAALGLLGGECPAAVSYVLEDMAPQ--RNPQAPHP 206
            AP +P +RP R           R A  A+G L           L D  P     P    P
Sbjct: 2779 APSSPLQRPRR-----------RAARPAVGSLTN---------LADPHPPGPETPTPTSP 2818

Query: 207  QGRLHAHAGSSAMA----AAAGPLGAPEVVLEEE-IGGAGEAGPSPPPQQQQPWHQHEAA 371
                HA   S+  A    AA GP            +  AG A  S PP    P      A
Sbjct: 2819 TANPHATTASATPAPPPVAATGPTRPTSPATPTPTVAAAGRA--SAPPAPAAPAAPAAPA 2876

Query: 372  TDLTPLQLSRLELVDLRADMGLPASPVSPADLPSPSSLPAASPAAAAAASSAASPPGSSA 551
                P   +        A    PA+P +PA   +P++  A +  AA AA +A + P  +A
Sbjct: 2877 APAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAA 2936

Query: 552  CSGTSSAFSASGISTPRWSAASAAPGSAGGAADEKTPGTLVPS 680
                  A +A+  +T   S A AA      A+   TP + +P+
Sbjct: 2937 VPVVVPAPTATLTATTTTSPAPAAT----PASPVPTPTSSLPT 2975

 Score = 36.6 bits (83), Expect = 0.40
 Identities = 21/72 (29%), Positives = 28/72 (38%), Gaps = 8/72 (11%)
 Frame = +1

Query: 445  LPSPLPTSPPHPPCLPRRQQPPRPHPQLPLPRGPQP--------ALAPPQPSPRAAYQPH 600
            +P P P   P  P +  R + P   PQ   PR P+         +  PP P P A + P 
Sbjct: 2657 VPPPRPAPRPSEPAVQSRARRPDAPPQSARPRTPRDDPGPPAAPSTLPPSPPPPAPHPPD 2716

Query: 601  AGAPPRPPRARQ 636
               P   PR  +
Sbjct: 2717 PPPPDPSPRPNE 2728

 Score = 36.6 bits (83), Expect = 0.40
 Identities = 21/64 (32%), Positives = 27/64 (41%)
 Frame = +1

Query: 424 PTWGCQPLPSPLPTSPPHPPCLPRRQQPPRPHPQLPLPRGPQPALAPPQPSPRAAYQPHA 603
           PT   +P     PT+   PP    R  PP P  + P P  P  +  PP P+P  A  P +
Sbjct: 488 PTPAGRPPTPANPTASSEPPTPAGR--PPTPAGRPPTPANPTASSEPPTPNPEGAPAPSS 545

Query: 604 GAPP 615
              P
Sbjct: 546 NEQP 549

 Score = 35.8 bits (81), Expect = 0.69
 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 8/62 (12%)
 Frame = +1

Query: 460  PTSPPHPPCLPRRQQPPRPHPQLPLPRGPQPALAPPQPSPR--------AAYQPHAGAPP 615
            P   P PP  P    PP P P  P P  P P   PP PSPR         A  P A  PP
Sbjct: 2690 PRDDPGPPAAPSTL-PPSPPP--PAPHPPDP--PPPDPSPRPNELGGGETAAAPSAPDPP 2744

Query: 616  RP 621
             P
Sbjct: 2745 PP 2746

 Score = 35.4 bits (80), Expect = 0.90
 Identities = 44/170 (25%), Positives = 58/170 (33%), Gaps = 10/170 (5%)
 Frame = +1

Query: 133  ASAQRPCHMSLKTWRRSATPKHRTRRAACMHTQAAAPWPQQPGRSARPRWCLKRRL--GA 306
            A A  P  +   T   +AT       AA   +    P    P   ++P    +  L  G 
Sbjct: 2933 APAAVPVVVPAPTATLTATTTTSPAPAATPASPVPTPTSSLPTPPSKPPAFFQPSLATGG 2992

Query: 307  RVKLGRRHRRSSSSRGTSM-----RRPPT*RRCS---SLGWSLWTCVPTWGCQPLPSPLP 462
             V  G   RR + SR T+       RPP  R      S     +   P    +P     P
Sbjct: 2993 SVAPGGDFRRRAPSRPTAAVPAAPSRPPARRLARPAVSRSTESFALPPDELARPRTPEAP 3052

Query: 463  TSPPHPPCLPRRQQPPRPHPQLPLPRGPQPALAPPQPSPRAAYQPHAGAP 612
              P      P  ++P  P P    P+G  P+ A P   P AA  P  G P
Sbjct: 3053 APPTETEEAPVAERPAPPEP----PQGRPPSPAAPDAGPAAASGPSGGVP 3098

 Score = 35.0 bits (79), Expect = 1.2
 Identities = 17/45 (37%), Positives = 23/45 (50%), Gaps = 3/45 (6%)
 Frame = +1

Query: 505  PPRPHPQLPLPRGPQPALAPPQPSPR---AAYQPHAGAPPRPPRA 630
            PP P P    P  P  ++ PP+P+PR    A Q  A  P  PP++
Sbjct: 2640 PPPPLPPAARPAAPDRSVPPPRPAPRPSEPAVQSRARRPDAPPQS 2684

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 46/170 (27%), Positives = 55/170 (32%), Gaps = 24/170 (14%)
 Frame = -3

Query: 438  ATPCRHASPQAPAERAAAASGRWPPHAGATAAAAAAVATAQLHPRPQSPLQAPPRARRAA 259
            A P   A+P APA  AA A+   P    A AA AA  A     P   +P   P       
Sbjct: 2891 AAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAA-----PAAPAPAAVPVVVPAPT 2945

Query: 258  RLLRPWRCCLRVHAGGPAGAVLGGCAAAP-------------CLQGHMTRPLGTRRLAAP 118
              L          A  PA  V    ++ P                G    P G  R  AP
Sbjct: 2946 ATLTATTTTSPAPAATPASPVPTPTSSLPTPPSKPPAFFQPSLATGGSVAPGGDFRRRAP 3005

Query: 117  ARPRRSATPTAPG------AAAPHAQAAVAALAAP-----LPRHPSRCCP 1
            +RP  +A P AP        A P    +  + A P      PR P    P
Sbjct: 3006 SRP-TAAVPAAPSRPPARRLARPAVSRSTESFALPPDELARPRTPEAPAP 3054

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 23/67 (34%), Positives = 29/67 (42%), Gaps = 1/67 (1%)
 Frame = +1

Query: 424 PTWGCQPLPSPL-PTSPPHPPCLPRRQQPPRPHPQLPLPRGPQPALAPPQPSPRAAYQPH 600
           PT      P+P  PT+    P  P  + PP P  + P P  P  +  PP P+ R      
Sbjct: 460 PTTASSEPPTPAGPTTASSEPPTPAGR-PPTPAGRPPTPANPTASSEPPTPAGRP--PTP 516

Query: 601 AGAPPRP 621
           AG PP P
Sbjct: 517 AGRPPTP 523

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 46/194 (23%), Positives = 65/194 (32%), Gaps = 10/194 (5%)
 Frame = +3

Query: 114 ALGLLGGECPAAVSYVLEDMAPQRNPQAPHPQGRLHAHAGSSAMAAAAGPLGAP------ 275
           A+G   G  PAA         P +   AP P G   A    +A+A A   L AP      
Sbjct: 260 AVGEEAGRAPAAARKAPPQTPPPK-AAAPEPAGAADAGVWGAALAGAPLALPAPAPSDSA 318

Query: 276 --EVVLEEEIGGAGEAGPSPPPQQQQP--WHQHEAATDLTPLQLSRLELVDLRADMGLPA 443
             +   ++E G      P P P Q  P  + +    T   P  L  L             
Sbjct: 319 GGDDAEDDEDGAMEVVSPLPRPNQHYPLGFSKRRRPTWTPPSSLEDLS------------ 366

Query: 444 SPVSPADLPSPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAA 623
              +    P  +SLP  +  +A  A++    P S    G      A+G   P  ++    
Sbjct: 367 ---AGRHHPKRASLPTRTRRSARHAAT----PFSRGSGGDEQTRPAAGPRPPTPASRPPT 419

Query: 624 PGSAGGAADEKTPG 665
           PG+        TPG
Sbjct: 420 PGAPPTPGAPPTPG 433

 Score = 33.5 bits (75), Expect = 3.4
 Identities = 25/70 (35%), Positives = 30/70 (42%), Gaps = 3/70 (4%)
 Frame = +1

Query: 427  TW--GCQPLPSPLPTSPPHPPCLPRRQQPPRPHPQLPLPR-GPQPALAPPQPSPRAAYQP 597
            TW  G + L S     PP P  LP   +P  P   +P PR  P+P+    Q   R    P
Sbjct: 2624 TWIRGLEELASDDAGDPPPP--LPPAARPAAPDRSVPPPRPAPRPSEPAVQSRARRPDAP 2681

Query: 598  HAGAPPRPPR 627
               A PR PR
Sbjct: 2682 PQSARPRTPR 2691

 Score = 33.5 bits (75), Expect = 3.4
 Identities = 47/179 (26%), Positives = 65/179 (36%), Gaps = 7/179 (3%)
 Frame = +3

Query: 15   SGAAAAAPPAPQRRPVREELRRLGLSESRFAEAALGLLGGECPAAVSYVL--EDMAPQRN 188
            S   AA P AP R P R  L R  +S S                  S+ L  +++A  R 
Sbjct: 3006 SRPTAAVPAAPSRPPARR-LARPAVSRS----------------TESFALPPDELARPRT 3048

Query: 189  PQAPHPQGRLHAHAGSSAMAAAAGPLGAPEVVLEEEIGGAGEAGPS---PPPQQQQPWHQ 359
            P+AP P         +   A    P G P      + G A  +GPS   P P+       
Sbjct: 3049 PEAPAPPTETEEAPVAERPAPPEPPQGRPPSPAAPDAGPAAASGPSGGVPAPR------- 3101

Query: 360  HEAATDLTPLQLSRLELVDLRADMGLPASPVSPADLPSPSSLPAAS--PAAAAAASSAA 530
                  L  L   R+ +   +        P  P ++P+PS  P  S  P  ++ ASS A
Sbjct: 3102 ------LGALVPGRVAVPRRQI-----PPPAPPREIPAPSPPPPRSHAPRVSSWASSLA 3149

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 52/173 (30%), Positives = 57/173 (32%), Gaps = 15/173 (8%)
 Frame = +1

Query: 241  PWPQQPGRSARPRWCLKRRLGARVKLGRRHRRSSSSRGTSMRRPPT*RRCSSLGWSLWTC 420
            P PQ      RPR       G RV L RR  R      +S  + P  R       SL   
Sbjct: 2744 PPPQTVPAPERPRDDRAPAPG-RVSLPRRASRQGRPAPSSPLQRPRRRAARPAVGSLTNL 2802

Query: 421  VPTWGCQPLPSPLPTSPPHPPCLPRRQQPPRPHPQLPL-------PRGPQP-------AL 558
                   P  +P PTSP   P        P P P           P  P P       A 
Sbjct: 2803 ADPHPPGP-ETPTPTSPTANPHATTASATPAPPPVAATGPTRPTSPATPTPTVAAAGRAS 2861

Query: 559  APPQP-SPRAAYQPHAGAPPRPPRARQAALLMRKLLAPSCRHAYRCAGARPGA 714
            APP P +P A   P A A P  P A  A        AP+   A   A A P A
Sbjct: 2862 APPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAA-PAAPAAPAAPAA 2913

 Score = 32.3 bits (72), Expect = 7.6
 Identities = 30/96 (31%), Positives = 37/96 (38%), Gaps = 4/96 (4%)
 Frame = +1

Query: 442  PLPSPLPTSPPHPPCLPRRQQ----PPRPHPQLPLPRGPQPALAPPQPSPRAAYQPHAGA 609
            P P+P P  PP P   PR  +         P  P P  PQ   AP +P         A A
Sbjct: 2708 PPPAPHPPDPPPPDPSPRPNELGGGETAAAPSAPDPPPPQTVPAPERPR-----DDRAPA 2762

Query: 610  PPRPPRARQAALLMRKLLAPSCRHAYRCAGARPGAG 717
            P R    R+A+   R   +   +   R A ARP  G
Sbjct: 2763 PGRVSLPRRASRQGRPAPSSPLQRPRRRA-ARPAVG 2797

 Score = 32.3 bits (72), Expect = 7.6
 Identities = 20/62 (32%), Positives = 25/62 (40%)
 Frame = -3

Query: 456 GRRERLATPCRHASPQAPAERAAAASGRWPPHAGATAAAAAAVATAQLHPRPQSPLQAPP 277
           GR    A P   + P  PA R    +GR P  A  TA++       +  P P S  Q P 
Sbjct: 492 GRPPTPANPTASSEPPTPAGRPPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQPPA 551

Query: 276 RA 271
            A
Sbjct: 552 AA 553

>dbj|BAC58076.2| large tegument protein [Cercopithecine herpesvirus 1]
          Length = 3326

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 63/182 (34%), Positives = 65/182 (35%), Gaps = 8/182 (4%)
 Frame = -3

Query: 552  RLRTPGERQLRMRPRRLLATRQARRMGRGGRQGRRERLATPC-----RHASPQAPA-ERA 391
            R   PG   L   PRR  A+RQ R       Q  R R A P        A P  P  E  
Sbjct: 2749 RAPAPGRVSL---PRR--ASRQGRPAPSSPLQRPRRRAARPAVGSLTNLADPHPPGPETP 2803

Query: 390  AAASGRWPPHAGATAAAAAAVATAQLHP-RPQSPLQAPPRARRAARLLRPWRCCLRVHAG 214
               S    PHA   +A  A    A   P RP SP    P    A R   P          
Sbjct: 2804 TPTSPTANPHATTASATPAPPPVAATGPTRPTSPATPTPTVAAAGRASAPPAPAAPAAPA 2863

Query: 213  GPAGAVLGGCAAAPCLQGHMTRPLGTRRLAAPARPRRSATPTAPGA-AAPHAQAAVAALA 37
             PA        AAP        P      AAPA P   A P AP A AAP A AA AA A
Sbjct: 2864 APAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPA 2923

Query: 36   AP 31
            AP
Sbjct: 2924 AP 2925

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 50/142 (35%), Positives = 51/142 (35%), Gaps = 6/142 (4%)
 Frame = -3

Query: 432  PCRHASPQAPAERAAAASGRWPPHAGATAAAAAAVATAQLHPRPQSPLQ-----APPRAR 268
            P R  SP  P    AAA     P A A  AA AA A       P +P       AP    
Sbjct: 2831 PTRPTSPATPTPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPA 2890

Query: 267  RAARLLRPWRCCLRVHAGGPAGAVLGGCAAAPCLQGHMTRPLGTRRLAAPARPRRSATPT 88
              A    P           PA        AAP        P      AAPA P   A P 
Sbjct: 2891 APAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPAAPAAPAAPAAPA 2950

Query: 87   APGA-AAPHAQAAVAALAAPLP 25
            AP A AAP A AA AA AAP P
Sbjct: 2951 APAAPAAPAAPAAPAAPAAPAP 2972

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 50/146 (34%), Positives = 54/146 (36%), Gaps = 3/146 (2%)
 Frame = -3

Query: 456  GRRERLATPCRHASPQAPAERAAAASGRWP--PHAGATAAAAAAVATAQLHPRPQSPLQA 283
            GR      P   A+P APA  AA A+   P  P A A  AA AA A       P +P   
Sbjct: 2848 GRASAPPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAP 2907

Query: 282  PPRARRAARLLRPWRCCLRVHAGGPAGAVLGGCAAAPCLQGHMTRPLGTRRLAAPARPRR 103
               A  AA                PA        AAP        P      AAPA P  
Sbjct: 2908 AAPAAPAA----------------PAAPAAPAAPAAPAAPAPAAVPAAPAAPAAPAAPAA 2951

Query: 102  SATPTAPGA-AAPHAQAAVAALAAPL 28
             A P AP A AAP A AA A  A P+
Sbjct: 2952 PAAPAAPAAPAAPAAPAAPAPAAVPV 2977

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 44/140 (31%), Positives = 49/140 (34%), Gaps = 2/140 (1%)
 Frame = -3

Query: 438  ATPCRHASPQAPAERAAAASGRWP--PHAGATAAAAAAVATAQLHPRPQSPLQAPPRARR 265
            A P   A+P APA  AA A+   P  P A A  AA AA A       P +P  AP     
Sbjct: 2860 AAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPA-APAAPAA 2918

Query: 264  AARLLRPWRCCLRVHAGGPAGAVLGGCAAAPCLQGHMTRPLGTRRLAAPARPRRSATPTA 85
             A    P        A  PA        AAP        P      AAPA P  +A P  
Sbjct: 2919 PAAPAAPAAPAAPAPAAVPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPVV 2978

Query: 84   PGAAAPHAQAAVAALAAPLP 25
                AP A        +P P
Sbjct: 2979 --VPAPTATLTATTTTSPAP 2996

 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 58/225 (25%), Positives = 83/225 (36%), Gaps = 7/225 (3%)
 Frame = +3

Query: 33   APPAPQRRPVREELRRLGLSESRFAEAALGLLGGECPAAVSYVLEDMA------PQRNPQ 194
            AP +P +RP R   R    S +  A+      G E P   S      A      P   P 
Sbjct: 2769 APSSPLQRPRRRAARPAVGSLTNLADPHPP--GPETPTPTSPTANPHATTASATPAPPPV 2826

Query: 195  APHPQGRLHAHAGSSAMAAAAGPLGAPEVVLEEEIGGAGEAGPSPPPQQQQPWHQHEAAT 374
            A     R  + A  +   AAAG   AP          A  A P+ P     P      A 
Sbjct: 2827 AATGPTRPTSPATPTPTVAAAGRASAPPA----PAAPAAPAAPAAPAAPAAPAAPAAPAA 2882

Query: 375  DLTPLQLSRLELVDLRADMGLPASPVSPADLPSPSSLPA-ASPAAAAAASSAASPPGSSA 551
               P            A    PA+P +PA   +P++  A A+PAA AA ++ A+P   +A
Sbjct: 2883 PAAP------------AAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAA 2930

Query: 552  CSGTSSAFSASGISTPRWSAASAAPGSAGGAADEKTPGTLVPSCL 686
             +  +   + +  + P   AA AAP +    A    P    P+ +
Sbjct: 2931 PAPAAVPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAV 2975

 Score = 42.0 bits (97), Expect = 0.010
 Identities = 25/66 (37%), Positives = 28/66 (41%)
 Frame = +1

Query: 424 PTWGCQPLPSPLPTSPPHPPCLPRRQQPPRPHPQLPLPRGPQPALAPPQPSPRAAYQPHA 603
           PT G  P P+   T+   PP    R   P   P  P  R P PA  PP P+ R      A
Sbjct: 436 PTPGAPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRP--PTPA 493

Query: 604 GAPPRP 621
           G PP P
Sbjct: 494 GRPPTP 499

 Score = 41.6 bits (96), Expect = 0.013
 Identities = 36/120 (30%), Positives = 45/120 (37%), Gaps = 12/120 (10%)
 Frame = +1

Query: 298 LGARVKLGRRHRRSSSSRGTS---MRRPPT*RRCSSLGWSLWTCVPTWGCQPLPS--PLP 462
           L  R +   RH  +  SRG+      RP    R  +      +  PT G  P P   P P
Sbjct: 377 LPTRTRRSARHAATPFSRGSGGDEQTRPAAGPRPPTPA----SRPPTPGAPPTPGAPPTP 432

Query: 463 TSPPHPPCLP-------RRQQPPRPHPQLPLPRGPQPALAPPQPSPRAAYQPHAGAPPRP 621
            +PP P   P          +PP P  + P P G  P  A   P+P       AG PP P
Sbjct: 433 GAPPTPGAPPTPAGPTTASSEPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTP 492

 Score = 40.8 bits (94), Expect = 0.021
 Identities = 49/191 (25%), Positives = 71/191 (36%), Gaps = 1/191 (0%)
 Frame = +3

Query: 111  AALGLLGGECPAAVSYVLEDMAPQRNPQAPHPQGRLHAHAGSSAMAAAAGPLG-APEVVL 287
            AA G      PA  +  +        P AP       A A  +A AA A P   A     
Sbjct: 2827 AATGPTRPTSPATPTPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAP 2886

Query: 288  EEEIGGAGEAGPSPPPQQQQPWHQHEAATDLTPLQLSRLELVDLRADMGLPASPVSPADL 467
                  A  A P+ P     P      A    P   +        A   +PA+P +PA  
Sbjct: 2887 AAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPAAPAAPAAP 2946

Query: 468  PSPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
             +P++  A +  AA AA +A + P  +A      A +A+  +T   S A AA      A+
Sbjct: 2947 AAPAAPAAPAAPAAPAAPAAPAAPAPAAVPVVVPAPTATLTATTTTSPAPAAT----PAS 3002

Query: 648  DEKTPGTLVPS 680
               TP + +P+
Sbjct: 3003 PVPTPTSSLPT 3013

 Score = 40.4 bits (93), Expect = 0.028
 Identities = 43/140 (30%), Positives = 52/140 (36%), Gaps = 5/140 (3%)
 Frame = -3

Query: 417  SPQAPAERAAAASGRWPPHAGATAAAAAAVATAQLHPRPQSPLQAPPRARRAAR-LLRPW 241
            +P+ P +  A A GR          +    A+ Q  P P SPLQ P   RRAAR  +   
Sbjct: 2741 APERPRDDRAPAPGR---------VSLPRRASRQGRPAPSSPLQRP--RRRAARPAVGSL 2789

Query: 240  RCCLRVHAGGPAGAVLGGCAAAPCLQGHMTRPLGTRRLAAPARPRRSAT----PTAPGAA 73
                  H  GP           P        P  T   A PA P  +AT    PT+P   
Sbjct: 2790 TNLADPHPPGPE---------TPTPTSPTANPHATTASATPAPPPVAATGPTRPTSPATP 2840

Query: 72   APHAQAAVAALAAPLPRHPS 13
             P   AA  A A P P  P+
Sbjct: 2841 TPTVAAAGRASAPPAPAAPA 2860

 Score = 39.7 bits (91), Expect = 0.048
 Identities = 36/120 (30%), Positives = 43/120 (35%), Gaps = 1/120 (0%)
 Frame = -3

Query: 438  ATPCRHASPQAPAERAAAASGRWPPHAGATAA-AAAAVATAQLHPRPQSPLQAPPRARRA 262
            A P   A+P APA  AA A+   P    A AA AA A   A   P P +   AP      
Sbjct: 2887 AAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPAAPAAPAAP 2946

Query: 261  ARLLRPWRCCLRVHAGGPAGAVLGGCAAAPCLQGHMTRPLGTRRLAAPARPRRSATPTAP 82
            A    P           PA       AA P +   +  P  T        P  +ATP +P
Sbjct: 2947 AAPAAPAAPAAPAAPAAPAAPAAPAPAAVPVV---VPAPTATLTATTTTSPAPAATPASP 3003

 Score = 39.7 bits (91), Expect = 0.048
 Identities = 24/61 (39%), Positives = 26/61 (42%)
 Frame = +1

Query: 448  PSPLPTSPPHPPCLPRRQQPPRPHPQLPLPRGPQPALAPPQPSPRAAYQPHAGAPPRPPR 627
            PS LP SPP P   P    PP P P+     G + A AP  P P       A   PR  R
Sbjct: 2690 PSTLPPSPPPPAPHPPDPPPPDPSPRPNELGGGETAAAPSAPDPPPPQTVRAPERPRDDR 2749

Query: 628  A 630
            A
Sbjct: 2750 A 2750

 Score = 39.3 bits (90), Expect = 0.062
 Identities = 45/190 (23%), Positives = 63/190 (32%), Gaps = 31/190 (16%)
 Frame = +3

Query: 186  NPQAPHPQGRLHAHAGSSAMAAAAGP-------LGAPE------------VVLEEEIGGA 308
            +P  P P  R +   G    AA + P       + APE            V L       
Sbjct: 2706 DPPPPDPSPRPNELGGGETAAAPSAPDPPPPQTVRAPERPRDDRAPAPGRVSLPRRASRQ 2765

Query: 309  GEAGPSPPPQQQQPWHQHEAATDLT------------PLQLSRLELVDLRADMGLPASPV 452
            G   PS P Q+ +      A   LT            P   S             PA P 
Sbjct: 2766 GRPAPSSPLQRPRRRAARPAVGSLTNLADPHPPGPETPTPTSPTANPHATTASATPAPPP 2825

Query: 453  SPADLPSPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGS 632
              A  P+  + PA      AAA  A++PP  +A +  ++  + +  + P   AA AAP +
Sbjct: 2826 VAATGPTRPTSPATPTPTVAAAGRASAPPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAA 2885

Query: 633  AGGAADEKTP 662
                A    P
Sbjct: 2886 PAAPAAPAAP 2895

 Score = 37.7 bits (86), Expect = 0.18
 Identities = 20/61 (32%), Positives = 27/61 (43%)
 Frame = +1

Query: 433 GCQPLPSPLPTSPPHPPCLPRRQQPPRPHPQLPLPRGPQPALAPPQPSPRAAYQPHAGAP 612
           G  P P+  P +P   P  P  + PP P  + P P  P  +  PP P+P  A  P +   
Sbjct: 480 GRPPTPAGRPPTPAGRPPTPAGR-PPTPAGRPPTPANPTASSEPPTPNPEGAPAPSSNEQ 538

Query: 613 P 615
           P
Sbjct: 539 P 539

 Score = 37.4 bits (85), Expect = 0.24
 Identities = 25/69 (36%), Positives = 27/69 (38%), Gaps = 3/69 (4%)
 Frame = +1

Query: 424 PTWGCQPLPSPL---PTSPPHPPCLPRRQQPPRPHPQLPLPRGPQPALAPPQPSPRAAYQ 594
           PT      P+P    PT    PP    R   P   P  P  R P PA  PP P+ R    
Sbjct: 447 PTTASSEPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRP--P 504

Query: 595 PHAGAPPRP 621
             AG PP P
Sbjct: 505 TPAGRPPTP 513

 Score = 37.0 bits (84), Expect = 0.31
 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 8/66 (12%)
 Frame = +1

Query: 460  PTSPPHPPCLPRRQQPPRPHPQLPLPRGPQPALAPPQPSPR--------AAYQPHAGAPP 615
            P   P PP  P    PP P P  P P  P P   PP PSPR         A  P A  PP
Sbjct: 2680 PRDDPGPPAAPSTL-PPSPPP--PAPHPPDP--PPPDPSPRPNELGGGETAAAPSAPDPP 2734

Query: 616  RPPRAR 633
             P   R
Sbjct: 2735 PPQTVR 2740

 Score = 36.6 bits (83), Expect = 0.40
 Identities = 22/65 (33%), Positives = 27/65 (40%), Gaps = 1/65 (1%)
 Frame = +1

Query: 433 GCQPLPSPLPTSPPHPPCLPRRQQP-PRPHPQLPLPRGPQPALAPPQPSPRAAYQPHAGA 609
           G  P P+  P +P   P  P  + P P   P  P  R P PA  PP P+ R     +  A
Sbjct: 459 GRPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPAGRPPTPANPTA 518

Query: 610 PPRPP 624
              PP
Sbjct: 519 SSEPP 523

 Score = 36.6 bits (83), Expect = 0.40
 Identities = 21/72 (29%), Positives = 28/72 (38%), Gaps = 8/72 (11%)
 Frame = +1

Query: 445  LPSPLPTSPPHPPCLPRRQQPPRPHPQLPLPRGPQP--------ALAPPQPSPRAAYQPH 600
            +P P P   P  P +  R + P   PQ   PR P+         +  PP P P A + P 
Sbjct: 2647 VPPPRPAPRPSEPAVQSRARRPDAPPQSARPRTPRDDPGPPAAPSTLPPSPPPPAPHPPD 2706

Query: 601  AGAPPRPPRARQ 636
               P   PR  +
Sbjct: 2707 PPPPDPSPRPNE 2718

 Score = 35.8 bits (81), Expect = 0.69
 Identities = 43/171 (25%), Positives = 62/171 (36%), Gaps = 7/171 (4%)
 Frame = +3

Query: 189  PQAPHPQGRLHAHAGSSAMAAAAGPLGAPEVVLEEEIGGAGEAGPSPPPQQQQPWHQHEA 368
            P AP       A A  +A AA A P  A           A  A P+ P     P      
Sbjct: 2859 PAAPAAPAAPAAPAAPAAPAAPAAP--AAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAP 2916

Query: 369  ATDLTPLQLSRLELVDLRADMGLPASPVSPADLPSPSSLPAASPAAAAAASSAASP---- 536
            A    P   +        A    PA+P +PA   +P++  A +  AA AA +A +P    
Sbjct: 2917 AAPAAPAAPAAPAAPAPAAVPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVP 2976

Query: 537  ---PGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAADEKTPGTLVPS 680
               P  +A    ++  S +  +TP  ++    P S+      K P    PS
Sbjct: 2977 VVVPAPTATLTATTTTSPAPAATP--ASPVPTPTSSLPTPPSKPPAFFQPS 3025

 Score = 35.4 bits (80), Expect = 0.90
 Identities = 44/170 (25%), Positives = 58/170 (33%), Gaps = 10/170 (5%)
 Frame = +1

Query: 133  ASAQRPCHMSLKTWRRSATPKHRTRRAACMHTQAAAPWPQQPGRSARPRWCLKRRL--GA 306
            A A  P  +   T   +AT       AA   +    P    P   ++P    +  L  G 
Sbjct: 2971 APAAVPVVVPAPTATLTATTTTSPAPAATPASPVPTPTSSLPTPPSKPPAFFQPSLATGG 3030

Query: 307  RVKLGRRHRRSSSSRGTSM-----RRPPT*RRCS---SLGWSLWTCVPTWGCQPLPSPLP 462
             V  G   RR + SR T+       RPP  R      S     +   P    +P     P
Sbjct: 3031 SVAPGGDFRRRAPSRPTAAVPAAPSRPPARRLARPAVSRSTESFALPPDELARPRTPEAP 3090

Query: 463  TSPPHPPCLPRRQQPPRPHPQLPLPRGPQPALAPPQPSPRAAYQPHAGAP 612
              P      P  ++P  P P    P+G  P+ A P   P AA  P  G P
Sbjct: 3091 APPTETEEAPVAERPAPPEP----PQGRPPSPAAPDAGPAAASGPSGGVP 3136

 Score = 35.0 bits (79), Expect = 1.2
 Identities = 24/67 (35%), Positives = 31/67 (45%), Gaps = 3/67 (4%)
 Frame = +1

Query: 433 GCQPLPSPLPTSPPHPPCLPRRQQPPRPHPQLPLPRG--PQPALAPPQP-SPRAAYQPHA 603
           G  P P+  P +P   P  P  + PP P  + P P G  P PA  PP P +P A+ +P  
Sbjct: 466 GRPPTPAGRPPTPAGRPPTPAGR-PPTPAGRPPTPAGRPPTPAGRPPTPANPTASSEPPT 524

Query: 604 GAPPRPP 624
             P   P
Sbjct: 525 PNPEGAP 531

 Score = 35.0 bits (79), Expect = 1.2
 Identities = 17/45 (37%), Positives = 23/45 (50%), Gaps = 3/45 (6%)
 Frame = +1

Query: 505  PPRPHPQLPLPRGPQPALAPPQPSPR---AAYQPHAGAPPRPPRA 630
            PP P P    P  P  ++ PP+P+PR    A Q  A  P  PP++
Sbjct: 2630 PPPPLPPAARPAAPDRSVPPPRPAPRPSEPAVQSRARRPDAPPQS 2674

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 51/171 (29%), Positives = 61/171 (34%), Gaps = 25/171 (14%)
 Frame = -3

Query: 438  ATPCRHASPQAPAERAAAASGRWP-----PHAGATAAA----AAAVATAQLHPRPQSPLQ 286
            A P   A+P APA  AA A    P     P A  TA      A A   A   P P S L 
Sbjct: 2953 AAPAAPAAPAAPAAPAAPAPAAVPVVVPAPTATLTATTTTSPAPAATPASPVPTPTSSLP 3012

Query: 285  APPRARRAARLLRPWRCCLRVHAGG---PAGAVLGGCAAAP--CLQGHMTRPLGTRRLAA 121
             PP   +     +P      +  GG   P G       + P   +    +RP   RRLA 
Sbjct: 3013 TPP--SKPPAFFQP-----SLATGGSVAPGGDFRRRAPSRPTAAVPAAPSRP-PARRLAR 3064

Query: 120  PA----------RPRRSATPTAPGAAAPHAQAAVAALA-APLPRHPSRCCP 1
            PA           P   A P  P A AP  +   A +A  P P  P +  P
Sbjct: 3065 PAVSRSTESFALPPDELARPRTPEAPAPPTETEEAPVAERPAPPEPPQGRP 3115

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 46/194 (23%), Positives = 65/194 (32%), Gaps = 10/194 (5%)
 Frame = +3

Query: 114 ALGLLGGECPAAVSYVLEDMAPQRNPQAPHPQGRLHAHAGSSAMAAAAGPLGAP------ 275
           A+G   G  PAA         P +   AP P G   A    +A+A A   L AP      
Sbjct: 260 AVGEEAGRAPAAARKAPPQTPPPK-AAAPEPAGAADAGVWGAALAGAPLALPAPAPSDSA 318

Query: 276 --EVVLEEEIGGAGEAGPSPPPQQQQP--WHQHEAATDLTPLQLSRLELVDLRADMGLPA 443
             +   ++E G      P P P Q  P  + +    T   P  L  L             
Sbjct: 319 GGDDAEDDEDGAMEVVSPLPRPNQHYPLGFSKRRRPTWTPPSSLEDLS------------ 366

Query: 444 SPVSPADLPSPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAA 623
              +    P  +SLP  +  +A  A++    P S    G      A+G   P  ++    
Sbjct: 367 ---AGRHHPKRASLPTRTRRSARHAAT----PFSRGSGGDEQTRPAAGPRPPTPASRPPT 419

Query: 624 PGSAGGAADEKTPG 665
           PG+        TPG
Sbjct: 420 PGAPPTPGAPPTPG 433

 Score = 33.5 bits (75), Expect = 3.4
 Identities = 25/70 (35%), Positives = 30/70 (42%), Gaps = 3/70 (4%)
 Frame = +1

Query: 427  TW--GCQPLPSPLPTSPPHPPCLPRRQQPPRPHPQLPLPR-GPQPALAPPQPSPRAAYQP 597
            TW  G + L S     PP P  LP   +P  P   +P PR  P+P+    Q   R    P
Sbjct: 2614 TWIRGLEELASDDAGDPPPP--LPPAARPAAPDRSVPPPRPAPRPSEPAVQSRARRPDAP 2671

Query: 598  HAGAPPRPPR 627
               A PR PR
Sbjct: 2672 PQSARPRTPR 2681

 Score = 33.5 bits (75), Expect = 3.4
 Identities = 47/179 (26%), Positives = 65/179 (36%), Gaps = 7/179 (3%)
 Frame = +3

Query: 15   SGAAAAAPPAPQRRPVREELRRLGLSESRFAEAALGLLGGECPAAVSYVL--EDMAPQRN 188
            S   AA P AP R P R  L R  +S S                  S+ L  +++A  R 
Sbjct: 3044 SRPTAAVPAAPSRPPARR-LARPAVSRS----------------TESFALPPDELARPRT 3086

Query: 189  PQAPHPQGRLHAHAGSSAMAAAAGPLGAPEVVLEEEIGGAGEAGPS---PPPQQQQPWHQ 359
            P+AP P         +   A    P G P      + G A  +GPS   P P+       
Sbjct: 3087 PEAPAPPTETEEAPVAERPAPPEPPQGRPPSPAAPDAGPAAASGPSGGVPAPR------- 3139

Query: 360  HEAATDLTPLQLSRLELVDLRADMGLPASPVSPADLPSPSSLPAAS--PAAAAAASSAA 530
                  L  L   R+ +   +        P  P ++P+PS  P  S  P  ++ ASS A
Sbjct: 3140 ------LGALVPGRVAVPRRQI-----PPPAPPREIPAPSPPPPRSHAPRVSSWASSLA 3187

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 30/96 (31%), Positives = 37/96 (38%), Gaps = 4/96 (4%)
 Frame = +1

Query: 442  PLPSPLPTSPPHPPCLPRRQQ----PPRPHPQLPLPRGPQPALAPPQPSPRAAYQPHAGA 609
            P P+P P  PP P   PR  +         P  P P  PQ   AP +P         A A
Sbjct: 2698 PPPAPHPPDPPPPDPSPRPNELGGGETAAAPSAPDPPPPQTVRAPERPR-----DDRAPA 2752

Query: 610  PPRPPRARQAALLMRKLLAPSCRHAYRCAGARPGAG 717
            P R    R+A+   R   +   +   R A ARP  G
Sbjct: 2753 PGRVSLPRRASRQGRPAPSSPLQRPRRRA-ARPAVG 2787

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 52/173 (30%), Positives = 57/173 (32%), Gaps = 15/173 (8%)
 Frame = +1

Query: 241  PWPQQPGRSARPRWCLKRRLGARVKLGRRHRRSSSSRGTSMRRPPT*RRCSSLGWSLWTC 420
            P PQ      RPR       G RV L RR  R      +S  + P  R       SL   
Sbjct: 2734 PPPQTVRAPERPRDDRAPAPG-RVSLPRRASRQGRPAPSSPLQRPRRRAARPAVGSLTNL 2792

Query: 421  VPTWGCQPLPSPLPTSPPHPPCLPRRQQPPRPHPQLPL-------PRGPQP-------AL 558
                   P  +P PTSP   P        P P P           P  P P       A 
Sbjct: 2793 ADPHPPGP-ETPTPTSPTANPHATTASATPAPPPVAATGPTRPTSPATPTPTVAAAGRAS 2851

Query: 559  APPQP-SPRAAYQPHAGAPPRPPRARQAALLMRKLLAPSCRHAYRCAGARPGA 714
            APP P +P A   P A A P  P A  A        AP+   A   A A P A
Sbjct: 2852 APPAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAA-PAAPAAPAAPAA 2903

>pir||T31328 fibroin - Chinese oak silkmoth gi|3450883|gb|AAC32606.1| fibroin
           [Antheraea pernyi]
          Length = 2639

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 51/198 (25%), Positives = 71/198 (35%), Gaps = 23/198 (11%)
 Frame = -2

Query: 544 DPGGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGV----- 380
           D    AA  AAAAAAG  AG   G G   G   ++    +A  + +++  S  G      
Sbjct: 199 DSAAAAAAAAAAAAAGSGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSSAGGAGGGYG 258

Query: 379 --------RSVAASCWCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAAMALLPAC 224
                    S AA+         G G G +       S S  + A +  AAAA +     
Sbjct: 259 WGDGGYGSDSAAAAAAAAAAAAAGSGAGGSGGYGGYGSDSAAAAAAAAAAAAAGSSAGGA 318

Query: 223 ACRRPCGCGAWGLRCGAMSSRTYDTAA----------GHSPPSSPSAASAKRDSDSPRRR 74
                 G G +G    A ++     AA          G+    S +AA+A   + + RR 
Sbjct: 319 GGGYGWGDGGYGSDSAAAAAAAAAAAASSGAGGRGDGGYGSGGSSAAAAAAAAAAAARRA 378

Query: 73  SSSRTGRRCGAGGAAAAA 20
              R      A  AAAAA
Sbjct: 379 GHDRAAGSAAAAAAAAAA 396

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 68/237 (28%), Positives = 92/237 (38%), Gaps = 23/237 (9%)
 Frame = -2

Query: 661  GVFSSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAEDPGGEAAEDAAAAAAGDAAGK 482
            G  SSAA  A   AA AA + G D             A      AA  AAAAAA  A G 
Sbjct: 916  GSGSSAAAAAAAAAASAARRAGHD------------SAAGSAAAAAAAAAAAAASGAGG- 962

Query: 481  EDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC-WCHGCCCCGGGDGPASPA 305
              G G   G+ G   +  +A  + +++  + SG         W  G    G G   A+ A
Sbjct: 963  -SGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDG----GYGSDSAAAA 1017

Query: 304  PPISSSSTTSGA---------PSGPAAAAMALLPACACRRPCG--CGAWGLRCGAMSSRT 158
               ++++  SGA          S  AAAA A   A A     G   G +G   G   S +
Sbjct: 1018 AAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDS 1077

Query: 157  YDTAAGHSPPSSPSAASAKRD-------SDSPRRRSSSRTGRRCG----AGGAAAAA 20
               AA  +  ++ S A  + D       S +    +++   RR G    AG AAAAA
Sbjct: 1078 AAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAGHDRAAGSAAAAA 1134

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 63/237 (26%), Positives = 87/237 (36%), Gaps = 23/237 (9%)
 Frame = -2

Query: 661  GVFSSAAPPAEPGAAEAALQRGVD----------MPLAEKAEEVPEQAEDPGGEAAEDAA 512
            G  S +A  A   AA AA   G               A  A      A   G E A  +A
Sbjct: 2156 GYGSDSAAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAGHERAAGSA 2215

Query: 511  AAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASCWCHGCCCCG 332
            AAAA  AA    G GRS G  G       +  + +++  + +   S A     +G     
Sbjct: 2216 AAAAAAAAAAASGAGRSGGSYGWGDGGYGSDSAAAAAAAAAAAAASGAGGSGGYGGYGGY 2275

Query: 331  GGDGPASPAPPISSSSTTSGAPSG-------------PAAAAMALLPACACRRPCGCGAW 191
            G D  A+ A   +++++ +G   G              AAAA A   A         G +
Sbjct: 2276 GSDSAAAAAAAAAAAASGAGGAGGYGGYGGYGSYGSDSAAAAAAAAAAAGSGAGGVGGGY 2335

Query: 190  GLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAAA 20
            G   G   S   D+AA     ++ +AA+A   S +  RR     G    A  AAAAA
Sbjct: 2336 GWGDGGYGS---DSAA-----AAAAAAAAAAGSGAGGRRGYGAYGSDSSAAAAAAAA 2384

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 66/238 (27%), Positives = 90/238 (37%), Gaps = 24/238 (10%)
 Frame = -2

Query: 661  GVFSSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAEDPGGEAAEDAAAAAAGDAAGK 482
            G  SSAA  A   AA AA + G D             A      AA  AAAAAA  A G 
Sbjct: 544  GSGSSAAAAAAAAAASAARRAGHD------------SAAGSAAAAAAAAAAAAASGAGG- 590

Query: 481  EDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC-WCHGCCCCGGGDGPASPA 305
              G G   G+ G   +  +A  + +++  + SG         W  G    G G   A+ A
Sbjct: 591  -SGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDG----GYGSDSAAAA 645

Query: 304  PPISSSSTTSGA---------PSGPAAAAMALLPACACRRPCG--CGAWGLRCGAMSSRT 158
               ++++  SGA          S  AAAA A   A A     G   G +G   G   S +
Sbjct: 646  AAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDS 705

Query: 157  YDTAAGHSPPSSPSAASAKRD------------SDSPRRRSSSRTGRRCGAGGAAAAA 20
               AA  +  ++ S A  + D            + +    ++ R G    AG AAAAA
Sbjct: 706  AAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRAGHDSAAGSAAAAA 763

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 66/238 (27%), Positives = 90/238 (37%), Gaps = 24/238 (10%)
 Frame = -2

Query: 661  GVFSSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAEDPGGEAAEDAAAAAAGDAAGK 482
            G  SSAA  A   AA AA + G D             A      AA  AAAAAA  A G 
Sbjct: 730  GSGSSAAAAAAAAAASAARRAGHD------------SAAGSAAAAAAAAAAAAASGAGG- 776

Query: 481  EDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC-WCHGCCCCGGGDGPASPA 305
              G G   G+ G   +  +A  + +++  + SG         W  G    G G   A+ A
Sbjct: 777  -SGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDG----GYGSDSAAAA 831

Query: 304  PPISSSSTTSGA---------PSGPAAAAMALLPACACRRPCG--CGAWGLRCGAMSSRT 158
               ++++  SGA          S  AAAA A   A A     G   G +G   G   S +
Sbjct: 832  AAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDS 891

Query: 157  YDTAAGHSPPSSPSAASAKRD------------SDSPRRRSSSRTGRRCGAGGAAAAA 20
               AA  +  ++ S A  + D            + +    ++ R G    AG AAAAA
Sbjct: 892  AAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRAGHDSAAGSAAAAA 949

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 50/182 (27%), Positives = 70/182 (37%), Gaps = 9/182 (4%)
 Frame = -2

Query: 538  GGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC 359
            GG  ++ AAAAAA  AA    G G S G  G   +  +A  + +++  + SG    A   
Sbjct: 1441 GGYGSDSAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAAASG----AGGA 1496

Query: 358  WCHGCCCCGGGDGPASPAPPISSSSTTSGA---------PSGPAAAAMALLPACACRRPC 206
              +G     G D  A+ A   ++++  SGA           G   +  A   A A     
Sbjct: 1497 GGYGGY---GSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSYSAAAAAAAAAAAA 1553

Query: 205  GCGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAA 26
            G GA G   G   S             S +AA+A   + + RR    R      A  AAA
Sbjct: 1554 GSGAGGRGDGGYGS------------GSSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAA 1601

Query: 25   AA 20
            AA
Sbjct: 1602 AA 1603

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 52/182 (28%), Positives = 72/182 (38%), Gaps = 9/182 (4%)
 Frame = -2

Query: 538  GGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC 359
            GG  ++ AAAAAA  AA    G   S G  G   +  +A  + +++  + SG   V    
Sbjct: 1007 GGYGSDSAAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGY 1066

Query: 358  -WCHGCCCCGGGDGPASPAPPISSSSTTSGA--------PSGPAAAAMALLPACACRRPC 206
             W  G    G G   A+ A   ++++  SGA         SG +AAA A   A A RR  
Sbjct: 1067 GWGDG----GYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARR-- 1120

Query: 205  GCGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAA 26
                      A   R   +AA  +  ++ +AAS    S           G    A  AAA
Sbjct: 1121 ----------AGHDRAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAA 1170

Query: 25   AA 20
            AA
Sbjct: 1171 AA 1172

 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 47/147 (31%), Positives = 59/147 (39%), Gaps = 8/147 (5%)
 Frame = +2

Query: 29   SGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTAPA 208
            S AA+AA AA A G+ A G        G + AA     +        H  AA   + A A
Sbjct: 1295 SAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAAARRAGHDRAAGSAAAAAA 1354

Query: 209  GPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*G------- 367
               A          ++  A  + GG   GD G G   A A AAAAAA A A G       
Sbjct: 1355 AAAAA---------AASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAASGAGGSGGY 1405

Query: 368  -GHRPDAAAALSAGACGLACRHGVASL 445
             G+  D+AAA +A A   A   G   +
Sbjct: 1406 GGYGSDSAAAAAAAAAAAAAGSGAGGV 1432

 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 56/197 (28%), Positives = 82/197 (41%), Gaps = 24/197 (12%)
 Frame = -2

Query: 538 GGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC 359
           G ++A  AAAAAA  AAG   G G S G  G  G    +  + +++  + +   S   + 
Sbjct: 197 GSDSAAAAAAAAAAAAAG--SGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSSAGGAG 254

Query: 358 WCHGCCCCG-GGDGPASPAPPISSSSTTSGA---------PSGPAAAAMALLPACACRRP 209
             +G    G G D  A+ A   ++++  SGA          S  AAAA A   A A    
Sbjct: 255 GGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGSGGYGGYGSDSAAAAAAAAAAAAAGSS 314

Query: 208 CG--CGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRD--------SDSPRRRSSSRT 59
            G   G +G   G   S +   AA  +  ++ S A  + D        S +    +++  
Sbjct: 315 AGGAGGGYGWGDGGYGSDSAAAAAAAAAAAASSGAGGRGDGGYGSGGSSAAAAAAAAAAA 374

Query: 58  GRRCG----AGGAAAAA 20
            RR G    AG AAAAA
Sbjct: 375 ARRAGHDRAAGSAAAAA 391

 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 60/228 (26%), Positives = 84/228 (36%), Gaps = 9/228 (3%)
 Frame = -2

Query: 676  GTRVPGVFSSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAEDPGGEAAEDAAAAAAG 497
            G R  G + S +  A   AA AA  R              ++A      AA  AAAAAA 
Sbjct: 1870 GGRGDGGYGSGSSAAAAAAAAAAAARRAGH----------DRAAGSAAAAAAAAAAAAAS 1919

Query: 496  DAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASCWCHGCCCCGGGDGP 317
             A G   G G   G+ G   +  +A  + +++  + SG          +G    G G   
Sbjct: 1920 GAGGA--GGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGAGGG---YGWGDDGYGSDS 1974

Query: 316  ASPAPPISSSSTTSGA---------PSGPAAAAMALLPACACRRPCGCGAWGLRCGAMSS 164
            A+ A   ++++  SGA           G   +  A   A A     G GA G   G    
Sbjct: 1975 AAAAAAAAAAAAGSGAGGRGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDG---- 2030

Query: 163  RTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAAA 20
                   G+   SS +AA+A   + + RR    R      A  AAAAA
Sbjct: 2031 -------GYGSGSSAAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAA 2071

 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 66/246 (26%), Positives = 88/246 (34%), Gaps = 32/246 (13%)
 Frame = -2

Query: 661  GVFSSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAE----------------DPGGE 530
            G  SSAA  A   AA AA + G D      A      A                 D G  
Sbjct: 1320 GSGSSAAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGGYG 1379

Query: 529  AAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC-WC 353
            +   AAAAAA  AA    G G S G  G   +  +A  + +++  + SG   V     W 
Sbjct: 1380 SDSAAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGYGWG 1439

Query: 352  HGCCCCGGGDGPASPAPPISSSSTTSGA----------PSGPAAAAMALLPACACRRPCG 203
             G    G G   A+ A   ++++  SGA              AAAA A   A A     G
Sbjct: 1440 DG----GYGSDSAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAAASGAGG 1495

Query: 202  CGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGG---- 35
             G +G               G+   S+ +AA+A   + +      +  G   G GG    
Sbjct: 1496 AGGYG---------------GYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSY 1540

Query: 34   -AAAAA 20
             AAAAA
Sbjct: 1541 SAAAAA 1546

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 52/195 (26%), Positives = 72/195 (36%), Gaps = 25/195 (12%)
 Frame = -2

Query: 529  AAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASCWCH 350
            AA  AAAAAAG  AG     G  +G +  A    +A  +  +  +  +G  + AA+    
Sbjct: 1699 AAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAA 1758

Query: 349  GCCCCGG-------GDG-----PASPAPPISSSSTTSGAPS-------------GPAAAA 245
                 GG       GDG      A+ A   ++++  SGA               G  +AA
Sbjct: 1759 AASGAGGSGGSYGWGDGGYGSDSAAAAAAAAAAAAASGAGGSGGYGGYGGYGGYGSDSAA 1818

Query: 244  MALLPACACRRPCGCGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSS 65
             A   A A     G GA G+  G       D   G    ++ +AA+A         R   
Sbjct: 1819 AAAAAAAAAAAAAGSGAGGVGGGYGWG---DGGYGSDSAAAAAAAAAAAAGSGAGGRGDG 1875

Query: 64   RTGRRCGAGGAAAAA 20
              G    A  AAAAA
Sbjct: 1876 GYGSGSSAAAAAAAA 1890

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 64/244 (26%), Positives = 86/244 (35%), Gaps = 10/244 (4%)
 Frame = -2

Query: 721  SARRRAERQRSDRHDGTRVPGVFSSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAED 542
            +A   A   R   HD  R  G  ++AA  A   AA  A   G      +          D
Sbjct: 367  AAAAAAAAARRAGHD--RAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGG-----YGSD 419

Query: 541  PGGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCS-------- 386
                AA  AAAAAAG  AG   G G   G++G   +  +A  + +++  +          
Sbjct: 420  SAAAAAAAAAAAAAGSGAGGAGG-GYGWGDSGYGSDSAAAAAAAAAAAAASGAGGSGGYG 478

Query: 385  --GVRSVAASCWCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAAMALLPACACRR 212
              G  S AA+         G G G A  +         S + +  AAAA A         
Sbjct: 479  GYGSDSAAAAAAAAAAAAAGAGAGGAGGSYGWGDGGYGSDSAAAAAAAAAA--------- 529

Query: 211  PCGCGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGA 32
              G GA G   G           G+   SS +AA+A   + + RR           A  A
Sbjct: 530  AAGSGAGGRGDG-----------GYGSGSSAAAAAAAAAASAARRAGHDSAAGSAAAAAA 578

Query: 31   AAAA 20
            AAAA
Sbjct: 579  AAAA 582

 Score = 44.7 bits (104), Expect(2) = 1e-08
 Identities = 57/183 (31%), Positives = 68/183 (37%), Gaps = 39/183 (21%)
 Frame = +2

Query: 2    GQQRLGCRGSGAASAATAACA*GAAAPGAVGV----------------ALRRGRAGAARR 133
            G    G  GS +A+AA AA A  AA  GA GV                A     A AA  
Sbjct: 1031 GSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAG 1090

Query: 134  RVPSGRVICP*RHGAAAQPPSTAPAGPPACTRRQQRHGRSSRAARRAR------------ 277
                GR       G  +   + A A   A   R+  H R++ +A  A             
Sbjct: 1091 SGAGGRG----DGGYGSGSSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAAAAASGAG 1146

Query: 278  ---GGA*RGDWGRG*SWAVATAAAAAAVAPA--------*GGHRPDAAAALSAGACGLAC 424
               GG   GD G G   A A AAAAAA A A         GG+  D+AAA +A A   A 
Sbjct: 1147 GSGGGYGWGDGGYGSDSAAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAA 1206

Query: 425  RHG 433
              G
Sbjct: 1207 GSG 1209

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 52/184 (28%), Positives = 68/184 (36%), Gaps = 9/184 (4%)
 Frame = -2

Query: 544 DPGGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAA 365
           D    AA  AAAAAAG  AG   G G    ++  A    +A  +  SS     G      
Sbjct: 267 DSAAAAAAAAAAAAAGSGAGGSGGYGGYGSDSAAAAAAAAAAAAAGSSAGGAGG-----G 321

Query: 364 SCWCHGCCCCGGGDGPASPAPPISSSSTTSGA---------PSGPAAAAMALLPACACRR 212
             W  G    G G   A+ A   ++++ +SGA           G +AAA A   A A RR
Sbjct: 322 YGWGDG----GYGSDSAAAAAAAAAAAASSGAGGRGDGGYGSGGSSAAAAAAAAAAAARR 377

Query: 211 PCGCGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGA 32
                       A   R   +AA  +  ++ +AAS    S           G    A  A
Sbjct: 378 ------------AGHDRAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAAA 425

Query: 31  AAAA 20
           AAAA
Sbjct: 426 AAAA 429

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 50/173 (28%), Positives = 60/173 (33%)
 Frame = -2

Query: 538  GGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC 359
            GG  ++ AAAAAA  AA    G G S G  G  G                 G  S AA+ 
Sbjct: 1222 GGYGSDSAAAAAAAAAAAAASGAGGSGGYGGYGGY----------------GSDSAAAAA 1265

Query: 358  WCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAAMALLPACACRRPCGCGAWGLRC 179
                    G G G A            S + +  AAAA A           G GA G   
Sbjct: 1266 AAAAAAAAGSGAGGAGGGYGWGDGGYGSDSAAAAAAAAAA---------AAGSGAGGRGD 1316

Query: 178  GAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAAA 20
            G           G+   SS +AA+A   + + RR    R      A  AAAAA
Sbjct: 1317 G-----------GYGSGSSAAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAA 1358

 Score = 44.3 bits (103), Expect(2) = 8e-08
 Identities = 48/147 (32%), Positives = 55/147 (36%), Gaps = 8/147 (5%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
            G  GS +A+AA AA A  AA  GA G     G  G       +          AAA   S
Sbjct: 2087 GGYGSDSAAAAAAAAAAAAAGSGAGGAGGYGGYGGYGSDSAAAAAAAA-----AAAAAGS 2141

Query: 197  TAPAGPPACTRRQQRHGRSSRAARRAR--------GGA*RGDWGRG*SWAVATAAAAAAV 352
             A             +G  S AA  A         G   RGD G G   + A AAAAAA 
Sbjct: 2142 GAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAA 2201

Query: 353  APA*GGHRPDAAAALSAGACGLACRHG 433
            A    GH   A +A +A A   A   G
Sbjct: 2202 AARRAGHERAAGSAAAAAAAAAAAASG 2228

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 49/182 (26%), Positives = 73/182 (39%), Gaps = 9/182 (4%)
 Frame = -2

Query: 538  GGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC 359
            GG  ++ AAAAAA  AA    G   S G  G   +  +A  + +++  + SG   V    
Sbjct: 821  GGYGSDSAAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGY 880

Query: 358  -WCHGCCCCGGGDGPASPAPPISSSSTTSGA--------PSGPAAAAMALLPACACRRPC 206
             W  G    G G   A+ A   ++++  SGA         SG +AAA A   A +  R  
Sbjct: 881  GWGDG----GYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRA 936

Query: 205  GCGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAA 26
            G               +D+AAG +  ++ +AA+A                   G+  AAA
Sbjct: 937  G---------------HDSAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAA 981

Query: 25   AA 20
            AA
Sbjct: 982  AA 983

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 49/182 (26%), Positives = 73/182 (39%), Gaps = 9/182 (4%)
 Frame = -2

Query: 538  GGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC 359
            GG  ++ AAAAAA  AA    G   S G  G   +  +A  + +++  + SG   V    
Sbjct: 635  GGYGSDSAAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGY 694

Query: 358  -WCHGCCCCGGGDGPASPAPPISSSSTTSGA--------PSGPAAAAMALLPACACRRPC 206
             W  G    G G   A+ A   ++++  SGA         SG +AAA A   A +  R  
Sbjct: 695  GWGDG----GYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRA 750

Query: 205  GCGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAA 26
            G               +D+AAG +  ++ +AA+A                   G+  AAA
Sbjct: 751  G---------------HDSAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAA 795

Query: 25   AA 20
            AA
Sbjct: 796  AA 797

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 48/181 (26%), Positives = 73/181 (39%), Gaps = 9/181 (4%)
 Frame = -2

Query: 535 GEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC- 359
           G  ++ AAAAAA  AA    G G S G  G   +  +A  + +++  + +G      S  
Sbjct: 450 GYGSDSAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAAGAGAGGAGGSYG 509

Query: 358 WCHGCCCCGGGDGPASPAPPISSSSTTSGA--------PSGPAAAAMALLPACACRRPCG 203
           W  G    G G   A+ A   ++++  SGA         SG +AAA A   A +  R  G
Sbjct: 510 WGDG----GYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRAG 565

Query: 202 CGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAA 23
                          +D+AAG +  ++ +AA+A                   G+  AAAA
Sbjct: 566 ---------------HDSAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAA 610

Query: 22  A 20
           A
Sbjct: 611 A 611

 Score = 43.9 bits (102), Expect(2) = 3e-04
 Identities = 49/167 (29%), Positives = 61/167 (36%), Gaps = 21/167 (12%)
 Frame = +2

Query: 2    GQQRLGCRGSGAASAATAACA*GAAAPGAVGVALRRGRAG---------------AARRR 136
            G    G   + AA+AA AA A   +  G +G    RG  G               AA RR
Sbjct: 2399 GDGGYGSDSAAAAAAAAAAAAAAGSGAGGIGGGFGRGDGGYGSGSSAAAAAAAAAAAARR 2458

Query: 137  VPSGRVICP*RHGAAAQPPSTAPA-----GPPACTRRQQRHGRSSRAARRARGGA*RG-D 298
               GR        AAA   + A       G           G ++ AA    GG+  G  
Sbjct: 2459 AGHGRSAGSAAAAAAAAAAAAASGAGGSGGSYGWDYESYGSGSAAAAAGSGAGGSGGGYG 2518

Query: 299  WGRG*SWAVATAAAAAAVAPA*GGHRPDAAAALSAGACGLACRHGVA 439
            WG G   + ++AAAAAA A A G  R     A  AG+   A     A
Sbjct: 2519 WGDGGYGSGSSAAAAAAAAAAAGSRRSGHDRAYGAGSAAAAAAAAAA 2565

 Score = 43.5 bits (101), Expect(2) = 6e-06
 Identities = 48/151 (31%), Positives = 61/151 (39%), Gaps = 10/151 (6%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
            G  GS +A+AA AA A  AA  GA G       +G++     +       R G      S
Sbjct: 2155 GGYGSDSAAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAGHERAAGS 2214

Query: 197  TAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA----- 361
             A A   A          ++  A R+ G    GD G G   A A AAAAAA A +     
Sbjct: 2215 AAAAAAAAAA--------AASGAGRSGGSYGWGDGGYGSDSAAAAAAAAAAAAASGAGGS 2266

Query: 362  -----*GGHRPDAAAALSAGACGLACRHGVA 439
                  GG+  D+AAA +A A   A   G A
Sbjct: 2267 GGYGGYGGYGSDSAAAAAAAAAAAASGAGGA 2297

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 49/195 (25%), Positives = 67/195 (34%), Gaps = 20/195 (10%)
 Frame = -2

Query: 544  DPGGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAA 365
            D    AA  AAAAA   A G+ DG   S      A    +A  +  +  +  +G  + AA
Sbjct: 2007 DSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAAARRAGHDRAAGSAAAAA 2066

Query: 364  SCWCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAA-------------------- 245
            +          GG G         S S  + A +  AAAA                    
Sbjct: 2067 AAAAAAAASGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSGAGGAGGYGGYGGYGSDS 2126

Query: 244  MALLPACACRRPCGCGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSS 65
             A   A A     G GA G+  G      Y    G     S +AA+A   + +    +  
Sbjct: 2127 AAAAAAAAAAAAAGSGAGGVGGG------YGWGDGGYGSDSAAAAAAAAAAAAAGSGAGG 2180

Query: 64   RTGRRCGAGGAAAAA 20
            R     G+G +AAAA
Sbjct: 2181 RGDGGYGSGSSAAAA 2195

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 49/180 (27%), Positives = 66/180 (36%), Gaps = 6/180 (3%)
 Frame = -2

Query: 544  DPGGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSS------RESCSG 383
            D G  +   AAAAAA  AA      GR  G  G   +  +A  + ++S       +S +G
Sbjct: 698  DGGYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRAGHDSAAG 757

Query: 382  VRSVAASCWCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAAMALLPACACRRPCG 203
              + AA+          GG G               G+ S  AAAA A   A        
Sbjct: 758  SAAAAAAAAAAAAASGAGGSGGG-----YGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGA 812

Query: 202  CGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAA 23
             G +G   G   S   D+AA  +  ++ +AAS  R S       S        A  AAAA
Sbjct: 813  GGGYGWGDGGYGS---DSAAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAA 869

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 49/180 (27%), Positives = 66/180 (36%), Gaps = 6/180 (3%)
 Frame = -2

Query: 544  DPGGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSS------RESCSG 383
            D G  +   AAAAAA  AA      GR  G  G   +  +A  + ++S       +S +G
Sbjct: 884  DGGYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRAGHDSAAG 943

Query: 382  VRSVAASCWCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAAMALLPACACRRPCG 203
              + AA+          GG G               G+ S  AAAA A   A        
Sbjct: 944  SAAAAAAAAAAAAASGAGGSGGG-----YGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGA 998

Query: 202  CGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAA 23
             G +G   G   S   D+AA  +  ++ +AAS  R S       S        A  AAAA
Sbjct: 999  GGGYGWGDGGYGS---DSAAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAA 1055

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 58/210 (27%), Positives = 77/210 (36%), Gaps = 40/210 (19%)
 Frame = -2

Query: 529  AAEDAAAAAAGDAAGKED----GEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAAS 362
            AA  AAAAAAG  AG       G G SA     A    + R     +  S +   + AA+
Sbjct: 1544 AAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAA 1603

Query: 361  CWCHGCCCCGGGDG-------------PASPAPPISSSSTTSGAPSG----------PAA 251
                G    GGG G              A+ A   ++ S   GA  G           +A
Sbjct: 1604 AAASGAGGAGGGYGWGDGGYSSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDDGYGSDSA 1663

Query: 250  AAMALLPACACRRPCG--CGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRD------ 95
            AA A   A A     G   G +G   G   S +   AA  +  ++ S A  + D      
Sbjct: 1664 AAAAAAAAAAAGSGAGGRGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSG 1723

Query: 94   -SDSPRRRSSSRTGRRCG----AGGAAAAA 20
             S +    +++   RR G    AG AAAAA
Sbjct: 1724 SSAAAAAAAAAAAARRAGHDRAAGSAAAAA 1753

 Score = 42.7 bits (99), Expect(2) = 2e-06
 Identities = 43/140 (30%), Positives = 52/140 (36%)
 Frame = +2

Query: 2    GQQRLGCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAA 181
            G    G  GS +A+AA AA A  AAA GA G     G    +     +         GA 
Sbjct: 1465 GSGGYGGYGSDSAAAAAAAAAAAAAASGAGGAGGYGGYGSDSAAAAAAAAAAAAAGSGAG 1524

Query: 182  AQPPSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA 361
                     G             ++ AA    G   RGD G G   + A AAAAAA A  
Sbjct: 1525 GAGGGYG-WGDGGYGSYSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAAR 1583

Query: 362  *GGHRPDAAAALSAGACGLA 421
              GH   A +A +A A   A
Sbjct: 1584 RAGHDRAAGSAAAAAAAAAA 1603

 Score = 42.7 bits (99), Expect(2) = 2e-06
 Identities = 49/142 (34%), Positives = 55/142 (38%), Gaps = 7/142 (4%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
            G  GS +A+AA AA A  AAA GA G     G  G       S          AAA   S
Sbjct: 1775 GGYGSDSAAAAAAAAA-AAAASGAGGSGGYGGYGGYGGYGSDSAAAAAAAAAAAAAAAGS 1833

Query: 197  TAPAGPPACTRRQQRHGRSSRAARRAR-------GGA*RGDWGRG*SWAVATAAAAAAVA 355
             A             +G  S AA  A        G   RGD G G   + A AAAAAA A
Sbjct: 1834 GAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAA 1893

Query: 356  PA*GGHRPDAAAALSAGACGLA 421
                GH   A +A +A A   A
Sbjct: 1894 ARRAGHDRAAGSAAAAAAAAAA 1915

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 48/148 (32%), Positives = 57/148 (38%), Gaps = 9/148 (6%)
 Frame = +2

Query: 17  GCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
           G  GS +A+AA AA A  AA  GA G     G    +     +          AAA   S
Sbjct: 262 GGYGSDSAAAAAAAAAAAAAGSGAGGSGGYGGYGSDSAAAAAAA--------AAAAAAGS 313

Query: 197 TAPAGPPACTRRQQRHGRSSRAARRAR---------GGA*RGDWGRG*SWAVATAAAAAA 349
           +A             +G  S AA  A          GG   G +G G S A A AAAAAA
Sbjct: 314 SAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAASSGAGGRGDGGYGSGGSSAAAAAAAAAA 373

Query: 350 VAPA*GGHRPDAAAALSAGACGLACRHG 433
            A   G  R   +AA +A A   A   G
Sbjct: 374 AARRAGHDRAAGSAAAAAAAAAAAAASG 401

 Score = 42.0 bits (97), Expect = 0.010
 Identities = 50/150 (33%), Positives = 58/150 (38%), Gaps = 10/150 (6%)
 Frame = +2

Query: 26   GSGAASAATAACA*GAAAPG---AVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
            GS AA+AA AA A  A   G   A G A     A AA     +G        G       
Sbjct: 918  GSSAAAAAAAAAASAARRAGHDSAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSD 977

Query: 197  TAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*---- 364
            +A A   A        G     A  A GG   GD G G   A A AAAAAA A +     
Sbjct: 978  SAAAAAAAAAAAAAGSG-----AGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAASGARGS 1032

Query: 365  ---GGHRPDAAAALSAGACGLACRHGVASL 445
               GG+  D+AAA +A A   A   G   +
Sbjct: 1033 GGYGGYGSDSAAAAAAAAAAAAAGSGAGGV 1062

 Score = 42.0 bits (97), Expect(2) = 2e-06
 Identities = 50/150 (33%), Positives = 58/150 (38%), Gaps = 10/150 (6%)
 Frame = +2

Query: 26  GSGAASAATAACA*GAAAPG---AVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
           GS AA+AA AA A  A   G   A G A     A AA     +G        G       
Sbjct: 546 GSSAAAAAAAAAASAARRAGHDSAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSD 605

Query: 197 TAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*---- 364
           +A A   A        G     A  A GG   GD G G   A A AAAAAA A +     
Sbjct: 606 SAAAAAAAAAAAAAGSG-----AGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAASGARGS 660

Query: 365 ---GGHRPDAAAALSAGACGLACRHGVASL 445
              GG+  D+AAA +A A   A   G   +
Sbjct: 661 GGYGGYGSDSAAAAAAAAAAAAAGSGAGGV 690

 Score = 42.0 bits (97), Expect(2) = 2e-06
 Identities = 50/150 (33%), Positives = 58/150 (38%), Gaps = 10/150 (6%)
 Frame = +2

Query: 26   GSGAASAATAACA*GAAAPG---AVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
            GS AA+AA AA A  A   G   A G A     A AA     +G        G       
Sbjct: 732  GSSAAAAAAAAAASAARRAGHDSAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSD 791

Query: 197  TAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*---- 364
            +A A   A        G     A  A GG   GD G G   A A AAAAAA A +     
Sbjct: 792  SAAAAAAAAAAAAAGSG-----AGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAASGARGS 846

Query: 365  ---GGHRPDAAAALSAGACGLACRHGVASL 445
               GG+  D+AAA +A A   A   G   +
Sbjct: 847  GGYGGYGSDSAAAAAAAAAAAAAGSGAGGV 876

 Score = 41.6 bits (96), Expect = 0.013
 Identities = 50/148 (33%), Positives = 57/148 (37%), Gaps = 9/148 (6%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
            G  GS +A+AA AA A  AAA GA G     G  G       +          AAA   S
Sbjct: 1222 GGYGSDSAAAAAAAAA-AAAASGAGGSGGYGGYGGYGSDSAAAAAAAA-----AAAAAGS 1275

Query: 197  TAPAGPPACTRRQQRHGRSSRAARRAR---------GGA*RGDWGRG*SWAVATAAAAAA 349
             A             +G  S AA  A          GG   G +G G S A A AAAAAA
Sbjct: 1276 GAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAA 1335

Query: 350  VAPA*GGHRPDAAAALSAGACGLACRHG 433
             A   G  R   +AA +A A   A   G
Sbjct: 1336 AARRAGHDRAAGSAAAAAAAAAAAAASG 1363

 Score = 41.6 bits (96), Expect(2) = 8e-07
 Identities = 53/154 (34%), Positives = 60/154 (38%), Gaps = 15/154 (9%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
            G  GS +A+AA AA A  AA  GA G     G  G       S          AAA   +
Sbjct: 1933 GGYGSDSAAAAAAAAAAAAAGSGAGGAG---GGYGWGDDGYGSDSA-------AAAAAAA 1982

Query: 197  TAPAGPPACTRR------QQRHGRSSRAARRAR---------GGA*RGDWGRG*SWAVAT 331
             A AG  A  R          +G  S AA  A          GG   G +G G S A A 
Sbjct: 1983 AAAAGSGAGGRGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAA 2042

Query: 332  AAAAAAVAPA*GGHRPDAAAALSAGACGLACRHG 433
            AAAAAA A   G  R   +AA +A A   A   G
Sbjct: 2043 AAAAAAAARRAGHDRAAGSAAAAAAAAAAAAASG 2076

 Score = 41.6 bits (96), Expect = 0.013
 Identities = 48/175 (27%), Positives = 71/175 (40%), Gaps = 25/175 (14%)
 Frame = -2

Query: 535  GEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCS--------GV 380
            G  +  AAAAAA  AA +  G GRSAG    A    +A  ++ +     S        G 
Sbjct: 2440 GSGSSAAAAAAAAAAAARRAGHGRSAGSAAAAAAAAAAAAASGAGGSGGSYGWDYESYGS 2499

Query: 379  RSVAASCWC--------HGCCCCGGGDGPASPAPPISSSSTTS---------GAPSGPAA 251
             S AA+           +G    G G G ++ A   ++++  S         GA S  AA
Sbjct: 2500 GSAAAAAGSGAGGSGGGYGWGDGGYGSGSSAAAAAAAAAAAGSRRSGHDRAYGAGSAAAA 2559

Query: 250  AAMALLPACACRRPCGCGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDS 86
            AA A   A A R+    G +G   G +    YD+    +  ++ +AA+A     S
Sbjct: 2560 AAAAAAGAGASRQ---VGIYGTDDGFVLDGGYDSEGSAAAAAAAAAAAASSSGRS 2611

 Score = 41.2 bits (95), Expect = 0.016
 Identities = 58/198 (29%), Positives = 77/198 (38%), Gaps = 28/198 (14%)
 Frame = -2

Query: 529  AAEDAAAAAA---GDAAGKED---GEGRSAGETGEAGNPMSARKS-TSSSRESCSGVRSV 371
            AA  AAAAAA     A G+ D   G G SA     A    +AR++    +  S +   + 
Sbjct: 1296 AAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAAARRAGHDRAAGSAAAAAAA 1355

Query: 370  AASCWCHGCCCCGGG----------DGPASPAPPISSSSTTSGA---------PSGPAAA 248
            AA+    G    GGG          D  A+ A   ++++  SGA          S  AAA
Sbjct: 1356 AAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAA 1415

Query: 247  AMALLPACACRRPCG--CGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRR 74
            A A   A A     G   G +G   G   S   D+AA  +  ++ +AAS    S      
Sbjct: 1416 AAAAAAAAAAGSGAGGVGGGYGWGDGGYGS---DSAAAAAAAAAAAAASGAGGSGGYGGY 1472

Query: 73   SSSRTGRRCGAGGAAAAA 20
             S        A  AAAAA
Sbjct: 1473 GSDSAAAAAAAAAAAAAA 1490

 Score = 41.2 bits (95), Expect = 0.016
 Identities = 56/201 (27%), Positives = 76/201 (36%), Gaps = 28/201 (13%)
 Frame = -2

Query: 538  GGEAAEDAAAAAA----GDAAGKED---GEGRSAGETGEAGNPMSARKSTSSSRESCSGV 380
            G ++A  AAAAAA      A G+ D   G G SA     A    + R     +  S +  
Sbjct: 1074 GSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAGHDRAAGSAAAA 1133

Query: 379  RSVAASCWCHGCCCCGGG----------DGPASPAPPISSSSTTSGA---------PSGP 257
             + AA+    G    GGG          D  A+ A   ++++  SGA          S  
Sbjct: 1134 AAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAASGAGGSGGYGGYGSDS 1193

Query: 256  AAAAMALLPACACRRPCG--CGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSP 83
            AAAA A   A A     G   G +G   G   S   D+AA  +  ++ +AAS    S   
Sbjct: 1194 AAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGS---DSAAAAAAAAAAAAASGAGGSGGY 1250

Query: 82   RRRSSSRTGRRCGAGGAAAAA 20
                   +     A  AAAAA
Sbjct: 1251 GGYGGYGSDSAAAAAAAAAAA 1271

 Score = 40.8 bits (94), Expect = 0.021
 Identities = 51/173 (29%), Positives = 67/173 (38%)
 Frame = -2

Query: 538  GGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC 359
            GG  ++ AAAAAA  AA    G G   G  G  G+  SA  + +++  S +G        
Sbjct: 2340 GGYGSDSAAAAAAAAAAAAGSGAGGRRGY-GAYGSDSSAAAAAAAAAASGAGGS------ 2392

Query: 358  WCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAAMALLPACACRRPCGCGAWGLRC 179
                    GGG G               G+ S  AAAA A   A A     G GA G+  
Sbjct: 2393 --------GGGYGWGDGG---------YGSDSAAAAAAAAAAAAAA-----GSGAGGIGG 2430

Query: 178  GAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAAA 20
            G      +    G     S +AA+A   + + RR    R+     A  AAAAA
Sbjct: 2431 G------FGRGDGGYGSGSSAAAAAAAAAAAARRAGHGRSAGSAAAAAAAAAA 2477

 Score = 40.8 bits (94), Expect(2) = 4e-06
 Identities = 50/149 (33%), Positives = 57/149 (37%), Gaps = 13/149 (8%)
 Frame = +2

Query: 26   GSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTAP 205
            G G  S+ +AA A  AAA  A G       AG A      G         AAA   + A 
Sbjct: 1619 GDGGYSSDSAAAAAAAAAAAAAGSG-----AGGAGGGYGWGDDGYGSDSAAAAAAAAAAA 1673

Query: 206  AGPPACTRR------QQRHGRSSRAARRAR-------GGA*RGDWGRG*SWAVATAAAAA 346
            AG  A  R          +G  S AA  A        G   RGD G G   + A AAAAA
Sbjct: 1674 AGSGAGGRGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAA 1733

Query: 347  AVAPA*GGHRPDAAAALSAGACGLACRHG 433
            A A    GH   A +A +A A   A   G
Sbjct: 1734 AAAARRAGHDRAAGSAAAAAAAAAAAASG 1762

 Score = 40.8 bits (94), Expect(2) = 4e-06
 Identities = 55/165 (33%), Positives = 60/165 (36%), Gaps = 21/165 (12%)
 Frame = +2

Query: 2    GQQRLGCRGSGAASAATAACA*GAAAPGAVGVALRRG-------------RAGAARRRVP 142
            G    G  GS +A+AA AA A  AA  GA G     G              A AA     
Sbjct: 1182 GSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAA 1241

Query: 143  SGRVICP*RHGAAAQPPSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWA 322
            SG        G       +A A   A        G     A  A GG   GD G G   A
Sbjct: 1242 SGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSG-----AGGAGGGYGWGDGGYGSDSA 1296

Query: 323  VATAAAAAAVAPA*GGHRPD--------AAAALSAGACGLACRHG 433
             A AAAAAA A +  G R D        AAAA +A A   A R G
Sbjct: 1297 AAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAAARRAG 1341

 Score = 40.4 bits (93), Expect = 0.028
 Identities = 43/171 (25%), Positives = 63/171 (36%), Gaps = 3/171 (1%)
 Frame = -2

Query: 529 AAEDAAAAAA---GDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC 359
           AA  AAAAAA     A G+ DG   S G +  A    +A  +  +  +  +G  + AA+ 
Sbjct: 334 AAAAAAAAAAAASSGAGGRGDGGYGSGGSSAAAAAAAAAAAARRAGHDRAAGSAAAAAAA 393

Query: 358 WCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAAMALLPACACRRPCGCGAWGLRC 179
                    GG G           S ++ A +  AAAA A   A       G G  G   
Sbjct: 394 AAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDSGYGS 453

Query: 178 GAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAA 26
            + ++     AA  +  +  S       SDS    +++      GAG   A
Sbjct: 454 DSAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAAGAGAGGA 504

 Score = 40.4 bits (93), Expect = 0.028
 Identities = 46/173 (26%), Positives = 66/173 (37%)
 Frame = -2

Query: 538  GGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC 359
            GG  ++ AAAAAA  AA    G G  AG  G           + SS  + +   + AA  
Sbjct: 2401 GGYGSDSAAAAAAAAAAAAAAGSG--AGGIGGGFGRGDGGYGSGSSAAAAAAAAAAAARR 2458

Query: 358  WCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAAMALLPACACRRPCGCGAWGLRC 179
              HG      G   A+ A   +++++ +G   G          + +     G GA G   
Sbjct: 2459 AGHGR---SAGSAAAAAAAAAAAAASGAGGSGGSYGWDYESYGSGSAAAAAGSGAGG--- 2512

Query: 178  GAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAAA 20
               S   Y    G     S +AA+A   + +  RRS        G+  AAAAA
Sbjct: 2513 ---SGGGYGWGDGGYGSGSSAAAAAAAAAAAGSRRSGHDRAYGAGSAAAAAAA 2562

 Score = 40.0 bits (92), Expect = 0.036
 Identities = 55/230 (23%), Positives = 80/230 (33%), Gaps = 11/230 (4%)
 Frame = -2

Query: 676  GTRVPGVFSSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAEDPGGEAAEDAAAAAAG 497
            G R  G + S +  A   AA AA  R                  D    +A  AAAAAA 
Sbjct: 1713 GGRGDGGYGSGSSAAAAAAAAAAAAR--------------RAGHDRAAGSAAAAAAAAAA 1758

Query: 496  DAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASCWCHGCCCCGGGDGP 317
             A+G     G      G  G+  +A  + +++  + SG    +     +G     G D  
Sbjct: 1759 AASGAGGSGGSYGWGDGGYGSDSAAAAAAAAAAAAASGAGG-SGGYGGYGGYGGYGSDSA 1817

Query: 316  ASPAPPISSSSTTSGAPSGPAAAA-----------MALLPACACRRPCGCGAWGLRCGAM 170
            A+ A   ++++  +G+ +G                 A   A A     G GA G   G  
Sbjct: 1818 AAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDGGY 1877

Query: 169  SSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAAA 20
             S             S +AA+A   + + RR    R      A  AAAAA
Sbjct: 1878 GS------------GSSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAA 1915

 Score = 40.0 bits (92), Expect = 0.036
 Identities = 67/260 (25%), Positives = 95/260 (35%), Gaps = 26/260 (10%)
 Frame = -2

Query: 721  SARRRAERQRSDRHDGTRVPGVFSSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAED 542
            +A   A      R DG    G  S+AA  A   AA AA + G D                
Sbjct: 340  AAAAAASSGAGGRGDGGYGSGGSSAAAAAA--AAAAAARRAGHDRA-------------- 383

Query: 541  PGGEAAEDAAAAAAGDAAGK---EDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSV 371
              G AA  AAAAAA  AA       G G   G+ G   +  +A  + +++  + SG    
Sbjct: 384  -AGSAA--AAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGA 440

Query: 370  AASCWCHGCCCCGGGDGPASPAPPISSSSTTSGA-----------PSGPAAAAMALLPAC 224
                  +G    G G   A+ A   ++++  SGA            S  AAAA A   A 
Sbjct: 441  GGG---YGWGDSGYGSDSAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAA 497

Query: 223  ACRRPCGCGAWGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRD------------SDSPR 80
                    G++G   G   S +   AA  +  ++ S A  + D            + +  
Sbjct: 498  GAGAGGAGGSYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAA 557

Query: 79   RRSSSRTGRRCGAGGAAAAA 20
              ++ R G    AG AAAAA
Sbjct: 558  ASAARRAGHDSAAGSAAAAA 577

 Score = 40.0 bits (92), Expect = 0.036
 Identities = 57/235 (24%), Positives = 80/235 (33%), Gaps = 21/235 (8%)
 Frame = -2

Query: 661  GVFSSAAPPAEPGAAEAALQRGV-----------DMPLAEKAEEVPEQAEDPGGEAAEDA 515
            G + S +  A   AA AA   G                A  A      A   G + A  +
Sbjct: 2002 GGYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAAARRAGHDRAAGS 2061

Query: 514  AAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASCWCHGCCCC 335
            AAAAA  AA         +G  G  G   S   + +++  + +   S A     +G    
Sbjct: 2062 AAAAAAAAAAAAASGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSGAGGAGGYGGYGG 2121

Query: 334  GGGDGPASPAPPISSSSTTSGA----------PSGPAAAAMALLPACACRRPCGCGAWGL 185
             G D  A+ A   ++++  SGA            G  + + A   A A     G GA G 
Sbjct: 2122 YGSDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGR 2181

Query: 184  RCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAAA 20
              G   S             S +AA+A   + + RR    R      A  AAAAA
Sbjct: 2182 GDGGYGS------------GSSAAAAAAAAAAAARRAGHERAAGSAAAAAAAAAA 2224

 Score = 40.0 bits (92), Expect(2) = 3e-04
 Identities = 49/150 (32%), Positives = 54/150 (35%), Gaps = 15/150 (10%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
            G  G G+ SAA AA A  AAA    G     GR G       S          AAA   S
Sbjct: 2338 GDGGYGSDSAAAAAAAAAAAAGSGAG-----GRRGYGAYGSDSSAAAA-----AAAAAAS 2387

Query: 197  TAPAGPPACTRRQQRHGRSSRAARRAR---------------GGA*RGDWGRG*SWAVAT 331
             A             +G  S AA  A                GG  RGD G G   + A 
Sbjct: 2388 GAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAAGSGAGGIGGGFGRGDGGYGSGSSAAA 2447

Query: 332  AAAAAAVAPA*GGHRPDAAAALSAGACGLA 421
            AAAAAA A    GH   A +A +A A   A
Sbjct: 2448 AAAAAAAAARRAGHGRSAGSAAAAAAAAAA 2477

 Score = 40.0 bits (92), Expect(2) = 5e-06
 Identities = 46/151 (30%), Positives = 57/151 (37%), Gaps = 12/151 (7%)
 Frame = +2

Query: 29   SGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTAPA 208
            S AA+AA AA A G+ A G        G + AA     +        H  AA   + A A
Sbjct: 2008 SAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAAARRAGHDRAAGSAAAAAA 2067

Query: 209  GPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA--------- 361
               A             AA  A G    G +G   S + A AAAAAA A A         
Sbjct: 2068 AAAAA------------AASGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSGAGGAGG 2115

Query: 362  ---*GGHRPDAAAALSAGACGLACRHGVASL 445
                GG+  D+AAA +A A   A   G   +
Sbjct: 2116 YGGYGGYGSDSAAAAAAAAAAAAAGSGAGGV 2146

 Score = 40.0 bits (92), Expect(2) = 8e-06
 Identities = 48/146 (32%), Positives = 56/146 (37%), Gaps = 7/146 (4%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
            G  GS +A+AA AA A  AAA GA G     G    +                AAA   +
Sbjct: 1376 GGYGSDSAAAAAAAAAAAAAASGAGGSGGYGGYGSDSA--------------AAAAAAAA 1421

Query: 197  TAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*---- 364
             A AG                 A    GG   GD G G   A A AAAAAA A +     
Sbjct: 1422 AAAAGS---------------GAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAASGAGGS 1466

Query: 365  ---GGHRPDAAAALSAGACGLACRHG 433
               GG+  D+AAA +A A   A   G
Sbjct: 1467 GGYGGYGSDSAAAAAAAAAAAAAASG 1492

 Score = 39.7 bits (91), Expect(2) = 5e-07
 Identities = 44/137 (32%), Positives = 51/137 (37%), Gaps = 6/137 (4%)
 Frame = +2

Query: 29   SGAASAATAACA*GAAAPGAVG------VALRRGRAGAARRRVPSGRVICP*RHGAAAQP 190
            + AA+AA AA A GA   G  G       A     A AA     +G V      G     
Sbjct: 1015 AAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYG 1074

Query: 191  PSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*GG 370
              +A A   A             AA    G   RGD G G   + A AAAAAA A    G
Sbjct: 1075 SDSAAAAAAAA------------AAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAG 1122

Query: 371  HRPDAAAALSAGACGLA 421
            H   A +A +A A   A
Sbjct: 1123 HDRAAGSAAAAAAAAAA 1139

 Score = 39.7 bits (91), Expect(2) = 4e-07
 Identities = 54/158 (34%), Positives = 60/158 (37%), Gaps = 21/158 (13%)
 Frame = +2

Query: 23   RGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTA 202
            R +G+A+AA AA A  AAA GA G     G  G       S          AAA   S A
Sbjct: 1901 RAAGSAAAAAAAAA-AAAASGAGGAG---GGYGWGDGGYGSDSAAAAAAAAAAAAAGSGA 1956

Query: 203  PAGPPACTRRQQRHGRSSRAARRAR-------------GGA*RGDWGRG*SWAVATAAAA 343
                         +G  S AA  A              GG   GD G G   A A AAAA
Sbjct: 1957 GGAGGGYGWGDDGYGSDSAAAAAAAAAAAAGSGAGGRGGGYGWGDGGYGSDSAAAAAAAA 2016

Query: 344  AAVAPA*GGHRPD--------AAAALSAGACGLACRHG 433
            AA A +  G R D        AAAA +A A   A R G
Sbjct: 2017 AAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAAARRAG 2054

 Score = 39.7 bits (91), Expect = 0.048
 Identities = 45/176 (25%), Positives = 70/176 (39%), Gaps = 10/176 (5%)
 Frame = -2

Query: 529  AAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASCWCH 350
            AA  AAAAAA  +     G G   G+ G   +  +A  + +++  + SG           
Sbjct: 2129 AAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGG-------R 2181

Query: 349  GCCCCGGGDGPASPAPPISSSSTTSG--APSGPAAAAMALLPACACRRPCGCGAWGLRCG 176
            G    G G   A+ A   ++++  +G    +G AAAA A   A A       G++G   G
Sbjct: 2182 GDGGYGSGSSAAAAAAAAAAAARRAGHERAAGSAAAAAAAAAAAASGAGRSGGSYGWGDG 2241

Query: 175  AMSSRTYDTAAGHSPPSSPSAASAK--------RDSDSPRRRSSSRTGRRCGAGGA 32
               S +   AA  +  ++ S A             SDS    +++      GAGGA
Sbjct: 2242 GYGSDSAAAAAAAAAAAAASGAGGSGGYGGYGGYGSDSAAAAAAAAAAAASGAGGA 2297

 Score = 39.7 bits (91), Expect(2) = 3e-05
 Identities = 46/144 (31%), Positives = 55/144 (37%), Gaps = 13/144 (9%)
 Frame = +2

Query: 29   SGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTAPA 208
            + AA+AA AA   GA   G  G       A AA     + R      H  AA   + A A
Sbjct: 1855 AAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRA---GHDRAAGSAAAAAA 1911

Query: 209  GPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*G------- 367
               A          ++  A  A GG   GD G G   A A AAAAAA A   G       
Sbjct: 1912 AAAAA---------AASGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGAGGG 1962

Query: 368  ------GHRPDAAAALSAGACGLA 421
                  G+  D+AAA +A A   A
Sbjct: 1963 YGWGDDGYGSDSAAAAAAAAAAAA 1986

 Score = 39.7 bits (91), Expect = 0.048
 Identities = 50/158 (31%), Positives = 62/158 (38%), Gaps = 19/158 (12%)
 Frame = +2

Query: 17  GCRGSGAASAATAACA*GAAAPGAVGV-----------ALRRGRAGAARRRVPSGRVICP 163
           G   + AA+AA AA A G++A GA G            +     A AA     SG     
Sbjct: 230 GSDSAAAAAAAAAAAAAGSSAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGSG 289

Query: 164 *RHGAAAQPPSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAA 343
              G  +   + A A   A          +  +A  A GG   GD G G   A A AAAA
Sbjct: 290 GYGGYGSDSAAAAAAAAAAAA--------AGSSAGGAGGGYGWGDGGYGSDSAAAAAAAA 341

Query: 344 AAVAPA*GGHRPD--------AAAALSAGACGLACRHG 433
           AA A +  G R D        +AAA +A A   A R G
Sbjct: 342 AAAASSGAGGRGDGGYGSGGSSAAAAAAAAAAAARRAG 379

 Score = 39.3 bits (90), Expect(2) = 4e-06
 Identities = 52/160 (32%), Positives = 59/160 (36%), Gaps = 21/160 (13%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAAAPGAVGVALRRG-------------RAGAARRRVPSGRVI 157
            G  GS +A+AA AA A  AA  GA G     G              A AA     SG   
Sbjct: 786  GGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAASGARG 845

Query: 158  CP*RHGAAAQPPSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAA 337
                 G  +   + A A   A          +   A    GG   GD G G   A A AA
Sbjct: 846  SGGYGGYGSDSAAAAAAAAAAAA--------AGSGAGGVGGGYGWGDGGYGSDSAAAAAA 897

Query: 338  AAAAVAPA*GGHRPD--------AAAALSAGACGLACRHG 433
            AAAA A +  G R D        AAAA +A A   A R G
Sbjct: 898  AAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRAG 937

 Score = 39.3 bits (90), Expect(2) = 4e-06
 Identities = 52/160 (32%), Positives = 59/160 (36%), Gaps = 21/160 (13%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAAAPGAVGVALRRG-------------RAGAARRRVPSGRVI 157
            G  GS +A+AA AA A  AA  GA G     G              A AA     SG   
Sbjct: 600  GGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAASGARG 659

Query: 158  CP*RHGAAAQPPSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAA 337
                 G  +   + A A   A          +   A    GG   GD G G   A A AA
Sbjct: 660  SGGYGGYGSDSAAAAAAAAAAAA--------AGSGAGGVGGGYGWGDGGYGSDSAAAAAA 711

Query: 338  AAAAVAPA*GGHRPD--------AAAALSAGACGLACRHG 433
            AAAA A +  G R D        AAAA +A A   A R G
Sbjct: 712  AAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRAG 751

 Score = 39.3 bits (90), Expect(2) = 1e-05
 Identities = 53/157 (33%), Positives = 60/157 (37%), Gaps = 20/157 (12%)
 Frame = +2

Query: 23   RGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTA 202
            R +G+A+AA AA A  AAA GA G     G  G       S          AAA   S A
Sbjct: 1589 RAAGSAAAAAAAAA-AAAASGAGGAG---GGYGWGDGGYSSDSAAAAAAAAAAAAAGSGA 1644

Query: 203  PAGPPACTRRQQRHGRSSRAARRAR-------------GGA*RGDWGRG*SWAVATAAAA 343
                         +G  S AA  A              GG   GD G G   A A AAAA
Sbjct: 1645 GGAGGGYGWGDDGYGSDSAAAAAAAAAAAAGSGAGGRGGGYGWGDGGYGSDSAAAAAAAA 1704

Query: 344  AAVAPA*GGHRPD-------AAAALSAGACGLACRHG 433
            AA A +  G R D       +AAA +A A   A R G
Sbjct: 1705 AAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAG 1741

 Score = 38.9 bits (89), Expect = 0.081
 Identities = 51/178 (28%), Positives = 69/178 (38%), Gaps = 5/178 (2%)
 Frame = -2

Query: 538 GGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC 359
           GG  ++ AAAAAA  AA      G SAG  G  G         S S  + +   + AAS 
Sbjct: 292 GGYGSDSAAAAAAAAAAA---AAGSSAGGAG-GGYGWGDGGYGSDSAAAAAAAAAAAASS 347

Query: 358 WCHGCCCCGGGDGPASPAPPISSSSTTS-----GAPSGPAAAAMALLPACACRRPCGCGA 194
              G    G G G +S A   ++++  +        +G AAAA A   A A     G G 
Sbjct: 348 GAGGRGDGGYGSGGSSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAAAAASGAGGSGG 407

Query: 193 WGLRCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAAA 20
            G   G     +   AA  +  ++ +A S    +        S  G    A  AAAAA
Sbjct: 408 -GYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDSGYGSDSAAAAAAAAA 464

 Score = 38.9 bits (89), Expect(2) = 5e-06
 Identities = 46/153 (30%), Positives = 55/153 (35%), Gaps = 13/153 (8%)
 Frame = +2

Query: 2   GQQRLGCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAA 181
           G    G  G G+ SAA AA A  AAA    G     GR         S          +A
Sbjct: 506 GSYGWGDGGYGSDSAAAAAAAAAAAAGSGAG-----GRGDGGYGSGSSAAAAAAAAAASA 560

Query: 182 AQPPSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAP- 358
           A+      A   A          ++  A  + GG   GD G G   A A AAAAAA A  
Sbjct: 561 ARRAGHDSAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAG 620

Query: 359 ------------A*GGHRPDAAAALSAGACGLA 421
                         GG+  D+AAA +A A   A
Sbjct: 621 SGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAA 653

 Score = 38.5 bits (88), Expect(2) = 1e-06
 Identities = 51/159 (32%), Positives = 59/159 (37%), Gaps = 20/159 (12%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAAAPGAVGVALRRG-------------RAGAARRRVPSGRVI 157
            G  GS +A+AA AA A  AA  GA G     G              A AA     SG   
Sbjct: 972  GGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAASGARG 1031

Query: 158  CP*RHGAAAQPPSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAA 337
                 G  +   + A A   A          +   A    GG   GD G G   A A AA
Sbjct: 1032 SGGYGGYGSDSAAAAAAAAAAAA--------AGSGAGGVGGGYGWGDGGYGSDSAAAAAA 1083

Query: 338  AAAAVAPA*GGHRPD-------AAAALSAGACGLACRHG 433
            AAAA A +  G R D       +AAA +A A   A R G
Sbjct: 1084 AAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAG 1122

 Score = 38.5 bits (88), Expect(2) = 2e-05
 Identities = 54/181 (29%), Positives = 64/181 (34%), Gaps = 41/181 (22%)
 Frame = +2

Query: 2    GQQRLGCRGSGAASAATAACA*GAAAPGAVGVALRRG-----------RAGAARRRVPSG 148
            G    G  GS +A+AA AA A  AA  GA GV    G            A AA     +G
Sbjct: 845  GSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAG 904

Query: 149  RVICP*RHGAAAQPPSTAPAGPPACTRRQQRHGRSSRAARRAR-------------GGA* 289
                    G      S A A   A     +R G  S A   A              GG+ 
Sbjct: 905  SGAGGRGDGGYGSGSSAAAAAAAAAASAARRAGHDSAAGSAAAAAAAAAAAAASGAGGSG 964

Query: 290  RG-DWGRG*SWAVATAAAAAAVAPA----------------*GGHRPDAAAALSAGACGL 418
             G  WG G   + + AAAAAA A A                 GG+  D+AAA +A A   
Sbjct: 965  GGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAA 1024

Query: 419  A 421
            A
Sbjct: 1025 A 1025

 Score = 38.5 bits (88), Expect(2) = 2e-05
 Identities = 40/136 (29%), Positives = 51/136 (37%), Gaps = 1/136 (0%)
 Frame = +2

Query: 17  GCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
           G  G G+ SAA AA A  AAA    G +   G  G+      +           A     
Sbjct: 447 GDSGYGSDSAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAAGAGAGGAGG 506

Query: 197 TAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA-*GGH 373
           +   G             ++ AA    G   RGD G G   + A AAAAAA + A   GH
Sbjct: 507 SYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRAGH 566

Query: 374 RPDAAAALSAGACGLA 421
              A +A +A A   A
Sbjct: 567 DSAAGSAAAAAAAAAA 582

 Score = 38.5 bits (88), Expect(2) = 6e-06
 Identities = 52/160 (32%), Positives = 59/160 (36%), Gaps = 21/160 (13%)
 Frame = +2

Query: 17  GCRGSGAASAATAACA*GAAAPGAVGVALRRG-------------RAGAARRRVPSGRVI 157
           G  GS +A+AA AA A  AA  GA G     G              A AA     SG   
Sbjct: 414 GGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDSGYGSDSAAAAAAAAAAAAASGAGG 473

Query: 158 CP*RHGAAAQPPSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAA 337
                G  +   + A A   A          +   A  A G    GD G G   A A AA
Sbjct: 474 SGGYGGYGSDSAAAAAAAAAAAA--------AGAGAGGAGGSYGWGDGGYGSDSAAAAAA 525

Query: 338 AAAAVAPA*GGHRPD--------AAAALSAGACGLACRHG 433
           AAAA A +  G R D        AAAA +A A   A R G
Sbjct: 526 AAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRAG 565

 Score = 38.5 bits (88), Expect = 0.11
 Identities = 60/216 (27%), Positives = 74/216 (33%), Gaps = 2/216 (0%)
 Frame = -2

Query: 661  GVFSSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAEDPGGEAAEDAAAAAA--GDAA 488
            G  SSAA  A   AA  A   G      +          D    AA  AAAAAA    A 
Sbjct: 2372 GSDSSAAAAAAAAAASGAGGSGGGYGWGDGG-----YGSDSAAAAAAAAAAAAAAGSGAG 2426

Query: 487  GKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASCWCHGCCCCGGGDGPASP 308
            G   G GR  G  G   +  +A  + +++       RS  ++             G    
Sbjct: 2427 GIGGGFGRGDGGYGSGSSAAAAAAAAAAAARRAGHGRSAGSAAAAAAAAAAAAASGAGGS 2486

Query: 307  APPISSSSTTSGAPSGPAAAAMALLPACACRRPCGCGAWGLRCGAMSSRTYDTAAGHSPP 128
                     + G  SG AAAA             G GA G      S   Y    G    
Sbjct: 2487 GGSYGWDYESYG--SGSAAAA------------AGSGAGG------SGGGYGWGDGGYGS 2526

Query: 127  SSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAAA 20
             S +AA+A   + +  RRS     R  GAG AAAAA
Sbjct: 2527 GSSAAAAAAAAAAAGSRRSGH--DRAYGAGSAAAAA 2560

 Score = 38.5 bits (88), Expect = 0.11
 Identities = 61/223 (27%), Positives = 84/223 (37%), Gaps = 9/223 (4%)
 Frame = -2

Query: 661  GVFSSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAEDPGGEAAEDAAAAAAGDAAGK 482
            G  S +A  A   AA AA   G     A  A       +D  G  +  AAAAAA  AAG 
Sbjct: 1622 GYSSDSAAAAAAAAAAAAAGSG-----AGGAGGGYGWGDDGYGSDSAAAAAAAAAAAAGS 1676

Query: 481  EDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASCWCHGCCCCGGGDGPASPAP 302
              G     G  G  G       S S++  + +   +  +     G    G G   A+ A 
Sbjct: 1677 GAG-----GRGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAA 1731

Query: 301  PISSSSTTSG--APSGPAAAAMALLPACACRRPCGCGAWGLRCGAMSSRTYDTAAGHSPP 128
              ++++  +G    +G AAAA A   A A       G++G   G   S   D+AA  +  
Sbjct: 1732 AAAAAARRAGHDRAAGSAAAAAAAAAAAASGAGGSGGSYGWGDGGYGS---DSAAAAAAA 1788

Query: 127  SSPSAASAKRDSDS-------PRRRSSSRTGRRCGAGGAAAAA 20
            ++ +AAS    S             S S       A  AAAAA
Sbjct: 1789 AAAAAASGAGGSGGYGGYGGYGGYGSDSAAAAAAAAAAAAAAA 1831

 Score = 38.5 bits (88), Expect(2) = 6e-06
 Identities = 54/181 (29%), Positives = 64/181 (34%), Gaps = 41/181 (22%)
 Frame = +2

Query: 2    GQQRLGCRGSGAASAATAACA*GAAAPGAVGVALRRG-----------RAGAARRRVPSG 148
            G    G  GS +A+AA AA A  AA  GA GV    G            A AA     +G
Sbjct: 659  GSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAG 718

Query: 149  RVICP*RHGAAAQPPSTAPAGPPACTRRQQRHGRSSRAARRAR-------------GGA* 289
                    G      S A A   A     +R G  S A   A              GG+ 
Sbjct: 719  SGAGGRGDGGYGSGSSAAAAAAAAAASAARRAGHDSAAGSAAAAAAAAAAAAASGAGGSG 778

Query: 290  RG-DWGRG*SWAVATAAAAAAVAPA----------------*GGHRPDAAAALSAGACGL 418
             G  WG G   + + AAAAAA A A                 GG+  D+AAA +A A   
Sbjct: 779  GGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAA 838

Query: 419  A 421
            A
Sbjct: 839  A 839

 Score = 38.1 bits (87), Expect(2) = 5e-05
 Identities = 46/152 (30%), Positives = 57/152 (37%), Gaps = 17/152 (11%)
 Frame = +2

Query: 29   SGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTAPA 208
            S AA+AA AA A G+ A G        G + AA                AAA   +   A
Sbjct: 1696 SAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAA---------------AAAAAAAAARRA 1740

Query: 209  GPPACTRRQQRHGRSSRAARRARGGA*R----GDWGRG*SWAVATAAAAAAVAPA----- 361
            G             ++ AA    GG+      GD G G   A A AAAAAA A +     
Sbjct: 1741 GHDRAAGSAAAAAAAAAAAASGAGGSGGSYGWGDGGYGSDSAAAAAAAAAAAAASGAGGS 1800

Query: 362  --------*GGHRPDAAAALSAGACGLACRHG 433
                     GG+  D+AAA +A A   A   G
Sbjct: 1801 GGYGGYGGYGGYGSDSAAAAAAAAAAAAAAAG 1832

 Score = 38.1 bits (87), Expect(2) = 4e-05
 Identities = 51/149 (34%), Positives = 57/149 (38%), Gaps = 14/149 (9%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
            G  G G+ SAA AA A  AAA    G   R G  G       S          AAA   +
Sbjct: 1654 GDDGYGSDSAAAAAAA--AAAAAGSGAGGRGGGYGWGDGGYGSDSA-------AAAAAAA 1704

Query: 197  TAPAGPPACTRRQQRHGRSSRAARRARGGA*---RGDWGRG*SWAVATAAAAAAVAP--- 358
             A AG  A  R    +G  S AA  A   A    R    R    A A AAAAAA A    
Sbjct: 1705 AAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAAAASGAG 1764

Query: 359  --------A*GGHRPDAAAALSAGACGLA 421
                      GG+  D+AAA +A A   A
Sbjct: 1765 GSGGSYGWGDGGYGSDSAAAAAAAAAAAA 1793

 Score = 37.7 bits (86), Expect = 0.18
 Identities = 44/175 (25%), Positives = 66/175 (37%), Gaps = 2/175 (1%)
 Frame = -2

Query: 538  GGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASC 359
            GG  ++ AAAAAA  AA        + G  G  G       S S++  + +   +  +  
Sbjct: 1810 GGYGSDSAAAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGA 1869

Query: 358  WCHGCCCCGGGDGPASPAPPISSSSTTSG--APSGPAAAAMALLPACACRRPCGCGAWGL 185
               G    G G   A+ A   ++++  +G    +G AAAA A   A A     G G  G 
Sbjct: 1870 GGRGDGGYGSGSSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAAAAASGAGGAGG-GY 1928

Query: 184  RCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAAA 20
              G     +   AA  +  ++ +A S    +           G    A  AAAAA
Sbjct: 1929 GWGDGGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDDGYGSDSAAAAAAAAA 1983

 Score = 37.4 bits (85), Expect = 0.24
 Identities = 59/214 (27%), Positives = 79/214 (36%)
 Frame = +3

Query: 3    GSSGSGAAAAAPPAPQRRPVREELRRLGLSESRFAEAALGLLGGECPAAVSYVLEDMAPQ 182
            GSS + AAAAA  A  RR   +  R  G + +  A AA     G   +   Y   D    
Sbjct: 1322 GSSAAAAAAAAAAAAARRAGHD--RAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGG-- 1377

Query: 183  RNPQAPHPQGRLHAHAGSSAMAAAAGPLGAPEVVLEEEIGGAGEAGPSPPPQQQQPWHQH 362
                     G   A A ++A AAAA   GA         GG+G  G           +  
Sbjct: 1378 --------YGSDSAAAAAAAAAAAAAASGA---------GGSGGYGG----------YGS 1410

Query: 363  EAATDLTPLQLSRLELVDLRADMGLPASPVSPADLPSPSSLPAASPAAAAAASSAASPPG 542
            ++A        +        A  G  A  V            + S AAAAAA++AA+  G
Sbjct: 1411 DSAAAAAAAAAA--------AAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAASG 1462

Query: 543  SSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
            +    G     S S  +    +AA+AA   AGGA
Sbjct: 1463 AGGSGGYGGYGSDSAAAAAAAAAAAAAASGAGGA 1496

 Score = 37.4 bits (85), Expect(2) = 1e-04
 Identities = 47/138 (34%), Positives = 53/138 (38%), Gaps = 7/138 (5%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPS 196
            G  G G+ SAA AA A  AAA GA G     G  G       S          AAA   +
Sbjct: 2271 GYGGYGSDSAAAAAAAAAAAASGAGGAGGYGGYGGYGSYGSDS----------AAAAAAA 2320

Query: 197  TAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*GGHR 376
             A AG                 A    GG   GD G G   A A AAAAAA A +  G R
Sbjct: 2321 AAAAGS---------------GAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGR 2365

Query: 377  -------PDAAAALSAGA 409
                    D++AA +A A
Sbjct: 2366 RGYGAYGSDSSAAAAAAA 2383

 Score = 37.4 bits (85), Expect(2) = 1e-04
 Identities = 45/144 (31%), Positives = 54/144 (37%), Gaps = 13/144 (9%)
 Frame = +2

Query: 29   SGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTAPA 208
            + AA+AA AA   GA   G  G       A AA     + R      H  AA   + A A
Sbjct: 1543 AAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRA---GHDRAAGSAAAAAA 1599

Query: 209  GPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA*G------- 367
               A          ++  A  A GG   GD G     A A AAAAAA A   G       
Sbjct: 1600 AAAAA---------AASGAGGAGGGYGWGDGGYSSDSAAAAAAAAAAAAAGSGAGGAGGG 1650

Query: 368  ------GHRPDAAAALSAGACGLA 421
                  G+  D+AAA +A A   A
Sbjct: 1651 YGWGDDGYGSDSAAAAAAAAAAAA 1674

 Score = 37.0 bits (84), Expect(2) = 5e-05
 Identities = 51/159 (32%), Positives = 62/159 (38%), Gaps = 22/159 (13%)
 Frame = +2

Query: 23   RGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTA 202
            R +G+A+AA AA A  AAA GA G     G  G       +          AAA   + +
Sbjct: 2057 RAAGSAAAAAAAAA-AAAASGAGGSGGYGGYGGYGSDSAAAAAA-------AAAAAAAGS 2108

Query: 203  PAGPPACTRRQQRHGRSSRAARRARG-----GA*RGDWGRG*SW----------AVATAA 337
             AG          +G  S AA  A       G+  G  G G  W          A A AA
Sbjct: 2109 GAGGAGGYGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAA 2168

Query: 338  AAAAVAPA*GGHRPD-------AAAALSAGACGLACRHG 433
            AAAA A +  G R D       +AAA +A A   A R G
Sbjct: 2169 AAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAG 2207

 Score = 37.0 bits (84), Expect = 0.31
 Identities = 22/51 (43%), Positives = 34/51 (66%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            +A+ AAAAAA+SAA   G  + +G+++A +A+  +    +AAS A GS GG
Sbjct: 920  SAAAAAAAAAASAARRAGHDSAAGSAAAAAAAAAA----AAASGAGGSGGG 966

 Score = 37.0 bits (84), Expect = 0.31
 Identities = 22/51 (43%), Positives = 34/51 (66%)
 Frame = +3

Query: 489 AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
           +A+ AAAAAA+SAA   G  + +G+++A +A+  +    +AAS A GS GG
Sbjct: 734 SAAAAAAAAAASAARRAGHDSAAGSAAAAAAAAAA----AAASGAGGSGGG 780

 Score = 37.0 bits (84), Expect = 0.31
 Identities = 22/51 (43%), Positives = 34/51 (66%)
 Frame = +3

Query: 489 AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
           +A+ AAAAAA+SAA   G  + +G+++A +A+  +    +AAS A GS GG
Sbjct: 548 SAAAAAAAAAASAARRAGHDSAAGSAAAAAAAAAA----AAASGAGGSGGG 594

 Score = 37.0 bits (84), Expect = 0.31
 Identities = 21/52 (40%), Positives = 30/52 (57%)
 Frame = +3

Query: 489 AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
           AA+ AAAAAA++A+   GS    G  S  +A+  +    +AA A  G AGG+
Sbjct: 456 AAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAAGAGAGGAGGS 507

 Score = 37.0 bits (84), Expect(2) = 5e-04
 Identities = 26/58 (44%), Positives = 33/58 (56%)
 Frame = +3

Query: 471 SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
           S S+  AA+ AAAAAA S A   G     G+ SA +A+       +AA+AA  SAGGA
Sbjct: 266 SDSAAAAAAAAAAAAAGSGAGGSGGYGGYGSDSAAAAAAA-----AAAAAAGSSAGGA 318

 Score = 36.6 bits (83), Expect(2) = 4e-07
 Identities = 21/53 (39%), Positives = 30/53 (55%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
            +A+ AAAAAA++AAS  G S   G    + +   +    +AA+AA GS  G A
Sbjct: 2061 SAAAAAAAAAAAAASGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSGAGGA 2113

 Score = 36.6 bits (83), Expect = 0.40
 Identities = 21/53 (39%), Positives = 30/53 (55%)
 Frame = +3

Query: 489 AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
           AA+ AAAAAA++A S  G S   G    + +   +    +AA+AA GS+ G A
Sbjct: 201 AAAAAAAAAAAAAGSGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSSAGGA 253

 Score = 36.6 bits (83), Expect(2) = 1e-08
 Identities = 21/53 (39%), Positives = 30/53 (55%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
            +A+ AAAAAA++AAS  G S   G    + +   +    +AA+AA GS  G A
Sbjct: 1228 SAAAAAAAAAAAAASGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSGAGGA 1280

 Score = 36.2 bits (82), Expect = 0.53
 Identities = 25/59 (42%), Positives = 33/59 (55%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
            S S+  AA+ AAAAAA+S A   G     G+ SA +A+       +AA+AA GS  G A
Sbjct: 1474 SDSAAAAAAAAAAAAAASGAGGAGGYGGYGSDSAAAAAA------AAAAAAAGSGAGGA 1526

 Score = 36.2 bits (82), Expect(2) = 5e-07
 Identities = 25/59 (42%), Positives = 33/59 (55%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
            S S+  AA+ AAAAAA+S A   G     G+ SA +A+       +AA+AA GS  G A
Sbjct: 1161 SDSAAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAA------AAAAAAAGSGAGGA 1213

 Score = 36.2 bits (82), Expect = 0.53
 Identities = 49/174 (28%), Positives = 60/174 (34%)
 Frame = -2

Query: 544 DPGGEAAEDAAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAA 365
           D G  +   AAAAAA  AA       R AG    AG              S +   + AA
Sbjct: 540 DGGYGSGSSAAAAAAAAAA----SAARRAGHDSAAG--------------SAAAAAAAAA 581

Query: 364 SCWCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAAMALLPACACRRPCGCGAWGL 185
           +    G    GGG G               G+ S  AAAA A   A         G +G 
Sbjct: 582 AAAASGAGGSGGGYGWGDGG---------YGSDSAAAAAAAAAAAAAGSGAGGAGGGYGW 632

Query: 184 RCGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAA 23
             G   S   D+AA  +  ++ +AAS  R S       S        A  AAAA
Sbjct: 633 GDGGYGS---DSAAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAA 683

 Score = 36.2 bits (82), Expect(2) = 8e-05
 Identities = 44/138 (31%), Positives = 52/138 (36%), Gaps = 7/138 (5%)
 Frame = +2

Query: 29   SGAASAATAACA*GAAAPGAVG------VALRRGRAGAARRRVPSGRVICP*RHGAAAQP 190
            + AA+AA AA A GA   G  G       A     A AA     +G V      G     
Sbjct: 829  AAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYG 888

Query: 191  PSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA-*G 367
              +A A   A             AA    G   RGD G G   + A AAAAAA + A   
Sbjct: 889  SDSAAAAAAAA------------AAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRA 936

Query: 368  GHRPDAAAALSAGACGLA 421
            GH   A +A +A A   A
Sbjct: 937  GHDSAAGSAAAAAAAAAA 954

 Score = 36.2 bits (82), Expect(2) = 8e-05
 Identities = 44/138 (31%), Positives = 52/138 (36%), Gaps = 7/138 (5%)
 Frame = +2

Query: 29   SGAASAATAACA*GAAAPGAVG------VALRRGRAGAARRRVPSGRVICP*RHGAAAQP 190
            + AA+AA AA A GA   G  G       A     A AA     +G V      G     
Sbjct: 643  AAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYG 702

Query: 191  PSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA-*G 367
              +A A   A             AA    G   RGD G G   + A AAAAAA + A   
Sbjct: 703  SDSAAAAAAAA------------AAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRA 750

Query: 368  GHRPDAAAALSAGACGLA 421
            GH   A +A +A A   A
Sbjct: 751  GHDSAAGSAAAAAAAAAA 768

 Score = 35.8 bits (81), Expect(2) = 1e-06
 Identities = 21/55 (38%), Positives = 30/55 (54%)
 Frame = +3

Query: 477  SSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            S   AA+ AAAAAA++A+   GS    G  S  +A+  +    +AA +  G AGG
Sbjct: 1161 SDSAAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGAGG 1215

 Score = 35.8 bits (81), Expect = 0.69
 Identities = 22/57 (38%), Positives = 29/57 (50%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            S S+  AA+ AAAAAAS A    G     G  S  +A+  +    +AA +  G AGG
Sbjct: 1226 SDSAAAAAAAAAAAAASGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSGAGGAGG 1282

 Score = 35.8 bits (81), Expect = 0.69
 Identities = 26/58 (44%), Positives = 31/58 (52%)
 Frame = +3

Query: 471 SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
           S S+  AA+ AAAAAA S A   GS    G     S S  +    +AA+AA  SAGGA
Sbjct: 198 SDSAAAAAAAAAAAAAGSGAG--GSGGYGGYGGYGSDSAAAAAAAAAAAAAGSSAGGA 253

 Score = 35.8 bits (81), Expect = 0.69
 Identities = 26/89 (29%), Positives = 34/89 (37%), Gaps = 14/89 (15%)
 Frame = -1

Query: 671  EGARSFLISSAACRARGGRGGAPAWG*YAARGEG*GGARAG*GPRGRGS*GCGRGGCWRR 492
            + A +   ++AA  A  G GGA  +G Y +       A A     G G+ G G G  W  
Sbjct: 1475 DSAAAAAAAAAAAAAASGAGGAGGYGGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGD 1534

Query: 491  GRQGGW--------------GGEVGRGDG 447
            G  G +               G  GRGDG
Sbjct: 1535 GGYGSYSAAAAAAAAAAAAGSGAGGRGDG 1563

 Score = 35.4 bits (80), Expect = 0.90
 Identities = 22/60 (36%), Positives = 30/60 (49%)
 Frame = +3

Query: 462  DLPSPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            D  + S+  AA+ AAAAAAS A    G     G  S  +A+  +    +AA +  G AGG
Sbjct: 2056 DRAAGSAAAAAAAAAAAAASGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSGAGGAGG 2115

 Score = 35.4 bits (80), Expect = 0.90
 Identities = 64/239 (26%), Positives = 83/239 (33%)
 Frame = +3

Query: 3   GSSGSGAAAAAPPAPQRRPVREELRRLGLSESRFAEAALGLLGGECPAAVSYVLEDMAPQ 182
           G S + AAAAA  A  RR   +  R  G + +  A AA     G   +   Y   D    
Sbjct: 360 GGSSAAAAAAAAAAAARRAGHD--RAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGG-- 415

Query: 183 RNPQAPHPQGRLHAHAGSSAMAAAAGPLGAPEVVLEEEIGGAGEAGPSPPPQQQQPWHQH 362
                    G   A A ++A AAAA   GA         GGAG             W   
Sbjct: 416 --------YGSDSAAAAAAAAAAAAAGSGA---------GGAGGG---------YGWGDS 449

Query: 363 EAATDLTPLQLSRLELVDLRADMGLPASPVSPADLPSPSSLPAASPAAAAAASSAASPPG 542
              +D      +        A  G   S        S S+  AA+ AAAAAA + A   G
Sbjct: 450 GYGSDSAAAAAAAAAAA---AASGAGGSG-GYGGYGSDSAAAAAAAAAAAAAGAGAGGAG 505

Query: 543 SSACSGTSSAFSASGISTPRWSAASAAPGSAGGAADEKTPGTLVPSCLSLRWRSARRRA 719
            S   G     S S  +    +AA+A  G+ G        G+   +  +    SA RRA
Sbjct: 506 GSYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRA 564

 Score = 35.0 bits (79), Expect = 1.2
 Identities = 25/57 (43%), Positives = 30/57 (51%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            S S+  AA+ AAAAA S A    G  A    SSA +A+       +AAS A GS GG
Sbjct: 2344 SDSAAAAAAAAAAAAGSGAGGRRGYGAYGSDSSAAAAAAA-----AAASGAGGSGGG 2395

 Score = 35.0 bits (79), Expect = 1.2
 Identities = 50/175 (28%), Positives = 65/175 (36%), Gaps = 40/175 (22%)
 Frame = +2

Query: 17  GCRGSGAASAATAACA*GAAAPGAVG-------------VALRRGRAGAARRRVPSGRVI 157
           G   + AA+AA AA A G++A GA G              A     A AA      GR  
Sbjct: 295 GSDSAAAAAAAAAAAAAGSSAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAASSGAGGRG- 353

Query: 158 CP*RHGAAAQPPSTAPAGPPACTRR---QQRHGRSSRAARRARGGA*RG--------DWG 304
               +G+     + A A   A  RR    +  G ++ AA  A   A  G         WG
Sbjct: 354 -DGGYGSGGSSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAAAAASGAGGSGGGYGWG 412

Query: 305 RG*SWAVATAAAAAAVAPA----------------*GGHRPDAAAALSAGACGLA 421
            G   + + AAAAAA A A                  G+  D+AAA +A A   A
Sbjct: 413 DGGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDSGYGSDSAAAAAAAAAAAA 467

 Score = 35.0 bits (79), Expect(2) = 5e-05
 Identities = 45/136 (33%), Positives = 55/136 (40%), Gaps = 18/136 (13%)
 Frame = +2

Query: 80  PGAVGVALRRGRAGAARRRVPSGRVICP*R---HGAAAQPPSTAPAGPPACTRR----QQ 238
           PGA   A     A A      SG+ I   R   HGA     + A A   +  RR     +
Sbjct: 87  PGASSSAAAASSASAG-----SGQTIIVERQASHGAGGAAGAAAGAAAGSSARRGGGFYE 141

Query: 239 RH--------GRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVA---PA*GGHRPDA 385
            H        G SS AA    GG   G +G   + A A AAAAA+ A      GG+  D+
Sbjct: 142 THNSYSSYGSGSSSAAAGSGAGGV-GGGYGSDSAAAAAAAAAAASGAGGSGGYGGYGSDS 200

Query: 386 AAALSAGACGLACRHG 433
           AAA +A A   A   G
Sbjct: 201 AAAAAAAAAAAAAGSG 216

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +3

Query: 495 SPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
           S AAAAAA++AA+  G+    G     S S  +    +AA+AA   AGGA
Sbjct: 455 SAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAAGAGAGGA 504

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/55 (36%), Positives = 30/55 (54%)
 Frame = +3

Query: 477  SSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            S   AA+ AAAAAA++A+   G+    G  S  +A+  +    +AA +  G AGG
Sbjct: 1474 SDSAAAAAAAAAAAAAASGAGGAGGYGGYGSDSAAAAAAAAAAAAAGSGAGGAGG 1528

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/55 (36%), Positives = 30/55 (54%)
 Frame = +3

Query: 477 SSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
           S   AA+ AAAAAA++ +   GS    G  S  +A+  +    +AA ++ G AGG
Sbjct: 266 SDSAAAAAAAAAAAAAGSGAGGSGGYGGYGSDSAAAAAAAAAAAAAGSSAGGAGG 320

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 24/60 (40%), Positives = 29/60 (48%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAAD 650
            S S+  AA+ AAAAAA S A   G     G     S S  +    +AA+AA   AGG  D
Sbjct: 2124 SDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGRGD 2183

 Score = 34.3 bits (77), Expect = 2.0
 Identities = 20/53 (37%), Positives = 29/53 (53%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
            AA  AAAAAA++AA+    +  SG    +   G  +   +AA+AA  +AG  A
Sbjct: 2058 AAGSAAAAAAAAAAAAASGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSGA 2110

 Score = 34.3 bits (77), Expect(2) = 8e-08
 Identities = 22/52 (42%), Positives = 31/52 (59%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
            +A+ AAAAAA++AAS  G S   G    + +   +    +AA+AA G AGGA
Sbjct: 2247 SAAAAAAAAAAAAASGAGGSGGYGGYGGYGSDSAAAAAAAAAAAASG-AGGA 2297

 Score = 34.3 bits (77), Expect = 2.0
 Identities = 48/186 (25%), Positives = 66/186 (34%), Gaps = 16/186 (8%)
 Frame = -2

Query: 544  DPGGEAAEDAAAAAAGDAA-------GKEDGEGRSAGETGEAGNPMSARKSTSSSRESCS 386
            D G  +   AAAAAA  AA       G+ DG G  +G +  A    +A  +  +  E  +
Sbjct: 2154 DGGYGSDSAAAAAAAAAAAAAGSGAGGRGDG-GYGSGSSAAAAAAAAAAAARRAGHERAA 2212

Query: 385  GVRSVAASCWCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAAMALLPACACRRPC 206
            G  + AA+         G   G        S      G  S  AAAA A   A A     
Sbjct: 2213 GSAAAAAAAAAAAASGAGRSGG--------SYGWGDGGYGSDSAAAAAAAAAAAAASGAG 2264

Query: 205  GCGAWGLRCGAMSSRTYDTAAGHSPPSSPSAAS---------AKRDSDSPRRRSSSRTGR 53
            G G +G   G  S      AA  +  +S +  +             SDS    +++    
Sbjct: 2265 GSGGYGGYGGYGSDSAAAAAAAAAAAASGAGGAGGYGGYGGYGSYGSDSAAAAAAAAAAA 2324

Query: 52   RCGAGG 35
              GAGG
Sbjct: 2325 GSGAGG 2330

 Score = 34.3 bits (77), Expect = 2.0
 Identities = 57/234 (24%), Positives = 75/234 (31%), Gaps = 17/234 (7%)
 Frame = -2

Query: 670 RVPGVFSSAAPPAEPGAA-------EAALQRGVDMPLAEKAEEVPEQAEDPGGEAAED-- 518
           RVPG  SSAA  +   A        E     G        A      +   GG   E   
Sbjct: 85  RVPGASSSAAAASSASAGSGQTIIVERQASHGAGGAAGAAAGAAAGSSARRGGGFYETHN 144

Query: 517 --------AAAAAAGDAAGKEDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAAS 362
                   +++AAAG  AG   G   S      A    +A  +  S      G  S AA+
Sbjct: 145 SYSSYGSGSSSAAAGSGAGGVGGGYGSDSAAAAAAAAAAASGAGGSGGYGGYGSDSAAAA 204

Query: 361 CWCHGCCCCGGGDGPASPAPPISSSSTTSGAPSGPAAAAMALLPACACRRPCGCGAWGLR 182
                    G G G +             G+ S  AAAA A   A         G +G  
Sbjct: 205 AAAAAAAAAGSGAGGSGGYGGYGG----YGSDSAAAAAAAAAAAAAGSSAGGAGGGYGWG 260

Query: 181 CGAMSSRTYDTAAGHSPPSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAAA 20
            G   S   D+AA  +  ++ +AA +            S +     A  AAAAA
Sbjct: 261 DGGYGS---DSAAAAAAAAAAAAAGSGAGGSGGYGGYGSDSAAAAAAAAAAAAA 311

 Score = 34.3 bits (77), Expect(2) = 2e-04
 Identities = 46/153 (30%), Positives = 57/153 (37%), Gaps = 18/153 (11%)
 Frame = +2

Query: 17   GCRGSGAASAATAACA*GAA-------APGAVGVALRRGRAGAARRRVPSGRVICP*RHG 175
            G  GSG+++AA AA A  AA       A G+   A     A AA     SG        G
Sbjct: 1099 GGYGSGSSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGG 1158

Query: 176  AAAQPPSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVA 355
              +   + A A   A             AA  A G    G +G   + A A AAAAAA  
Sbjct: 1159 YGSDSAAAAAAAAAAAA-----------AASGAGGSGGYGGYGSDSAAAAAAAAAAAAAG 1207

Query: 356  P-----------A*GGHRPDAAAALSAGACGLA 421
                          GG+  D+AAA +A A   A
Sbjct: 1208 SGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAA 1240

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +3

Query: 495 SPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
           S AAAAAA++AA+    +  SG    + +   +    +AA+AA GS+ G A
Sbjct: 268 SAAAAAAAAAAAAAGSGAGGSGGYGGYGSDSAAAAAAAAAAAAAGSSAGGA 318

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            +++ AAAAAA++AA   G    +G+++A +A+  +    +AAS A GS GG
Sbjct: 1105 SSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAA----AAASGAGGSGGG 1151

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 19/51 (37%), Positives = 28/51 (54%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            AA+ AAAAAA++A+   GS    G  S  +A+  +    +AA +  G  GG
Sbjct: 1014 AAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGG 1064

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 19/51 (37%), Positives = 28/51 (54%)
 Frame = +3

Query: 489 AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
           AA+ AAAAAA++A+   GS    G  S  +A+  +    +AA +  G  GG
Sbjct: 828 AAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGG 878

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 19/51 (37%), Positives = 28/51 (54%)
 Frame = +3

Query: 489 AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
           AA+ AAAAAA++A+   GS    G  S  +A+  +    +AA +  G  GG
Sbjct: 642 AAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGVGG 692

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 23/55 (41%), Positives = 28/55 (50%)
 Frame = +3

Query: 480  SLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
            S  AA+ AAAAAA+S A   G     G     S S  +    +AA+AA   AGGA
Sbjct: 1593 SAAAAAAAAAAAAASGAGGAGGGYGWGDGGYSSDSAAAAAAAAAAAAAGSGAGGA 1647

 Score = 33.9 bits (76), Expect(2) = 5e-05
 Identities = 23/58 (39%), Positives = 30/58 (51%)
 Frame = +3

Query: 471 SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
           S S+  AA+ AAAAAA S+A   G     G     S S  +    +AA+AA   AGG+
Sbjct: 231 SDSAAAAAAAAAAAAAGSSAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGS 288

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 58/217 (26%), Positives = 81/217 (36%), Gaps = 3/217 (1%)
 Frame = -2

Query: 661  GVFSSAAPPAEPGAAEAALQRGVDMPLAEKAEEVPEQAEDPGGEAAEDAAAAAAGDAAGK 482
            G  S +A  A   AA AA   G     A  A        D    AA  AAAAAA   +G 
Sbjct: 1471 GYGSDSAAAAAAAAAAAAAASG-----AGGAGGYGGYGSDSAAAAA--AAAAAAAAGSGA 1523

Query: 481  EDGEGRSAGETGEAGNPMSARKSTSSSRESCSGVRSVAASCWCHGCCCCGGGDGPASPAP 302
                G      G  G+  +A  + +++  + SG           G    G G   A+ A 
Sbjct: 1524 GGAGGGYGWGDGGYGSYSAAAAAAAAAAAAGSGAGG-------RGDGGYGSGSSAAAAAA 1576

Query: 301  PISSSSTTSG--APSGPAAAAMALLPACACRRPCGC-GAWGLRCGAMSSRTYDTAAGHSP 131
              ++++  +G    +G AAAA A   A A     G  G +G   G  SS +   AA  + 
Sbjct: 1577 AAAAAARRAGHDRAAGSAAAAAAAAAAAAASGAGGAGGGYGWGDGGYSSDS--AAAAAAA 1634

Query: 130  PSSPSAASAKRDSDSPRRRSSSRTGRRCGAGGAAAAA 20
             ++ +A S    +           G    A  AAAAA
Sbjct: 1635 AAAAAAGSGAGGAGGGYGWGDDGYGSDSAAAAAAAAA 1671

 Score = 33.5 bits (75), Expect(2) = 4e-06
 Identities = 23/55 (41%), Positives = 28/55 (50%)
 Frame = +3

Query: 480  SLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
            S  AA+ AAAAAA+S A   G     G     S S  +    +AA+AA   AGGA
Sbjct: 944  SAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGA 998

 Score = 33.5 bits (75), Expect(2) = 4e-04
 Identities = 23/55 (41%), Positives = 28/55 (50%)
 Frame = +3

Query: 480  SLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
            S  AA+ AAAAAA+S A   G     G     S S  +    +AA+AA   AGGA
Sbjct: 1905 SAAAAAAAAAAAAASGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGA 1959

 Score = 33.5 bits (75), Expect(2) = 4e-06
 Identities = 23/55 (41%), Positives = 28/55 (50%)
 Frame = +3

Query: 480 SLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
           S  AA+ AAAAAA+S A   G     G     S S  +    +AA+AA   AGGA
Sbjct: 758 SAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGA 812

 Score = 33.5 bits (75), Expect(2) = 5e-06
 Identities = 27/83 (32%), Positives = 36/83 (42%)
 Frame = +3

Query: 471 SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAAD 650
           S S+  AA+ AAAAAA S A   G     G     S S  +    +AA+A  G+ G    
Sbjct: 668 SDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDG 727

Query: 651 EKTPGTLVPSCLSLRWRSARRRA 719
               G+   +  +    SA RRA
Sbjct: 728 GYGSGSSAAAAAAAAAASAARRA 750

 Score = 33.5 bits (75), Expect(2) = 6e-06
 Identities = 23/55 (41%), Positives = 28/55 (50%)
 Frame = +3

Query: 480 SLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
           S  AA+ AAAAAA+S A   G     G     S S  +    +AA+AA   AGGA
Sbjct: 572 SAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAGSGAGGA 626

 Score = 33.5 bits (75), Expect(2) = 6e-06
 Identities = 27/83 (32%), Positives = 36/83 (42%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAAD 650
            S S+  AA+ AAAAAA S A   G     G     S S  +    +AA+A  G+ G    
Sbjct: 854  SDSAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDG 913

Query: 651  EKTPGTLVPSCLSLRWRSARRRA 719
                G+   +  +    SA RRA
Sbjct: 914  GYGSGSSAAAAAAAAAASAARRA 936

 Score = 33.5 bits (75), Expect(2) = 8e-07
 Identities = 19/51 (37%), Positives = 28/51 (54%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            AA+ AAAAAA++A S  G +   G    + +   +    +AA+AA GS  G
Sbjct: 2094 AAAAAAAAAAAAAGSGAGGAGGYGGYGGYGSDSAAAAAAAAAAAAAGSGAG 2144

 Score = 33.1 bits (74), Expect = 4.4
 Identities = 22/71 (30%), Positives = 31/71 (42%)
 Frame = -1

Query: 677  RHEGARSFLISSAACRARGGRGGAPAWG*YAARGEG*GGARAG*GPRGRGS*GCGRGGCW 498
            R  G+ +   ++AA  A  G GG+  +G Y   G G   A A        + G G GG  
Sbjct: 2057 RAAGSAAAAAAAAAAAAASGAGGSGGYGGYG--GYGSDSAAAAAAAAAAAAAGSGAGGAG 2114

Query: 497  RRGRQGGWGGE 465
              G  GG+G +
Sbjct: 2115 GYGGYGGYGSD 2125

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 20/49 (40%), Positives = 27/49 (54%)
 Frame = +3

Query: 495  SPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            S AAAAAA++AA+  G+    G     S S  +    +AA+AA   AGG
Sbjct: 1013 SAAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGG 1061

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 20/49 (40%), Positives = 27/49 (54%)
 Frame = +3

Query: 495 SPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
           S AAAAAA++AA+  G+    G     S S  +    +AA+AA   AGG
Sbjct: 827 SAAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGG 875

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 20/49 (40%), Positives = 27/49 (54%)
 Frame = +3

Query: 495 SPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
           S AAAAAA++AA+  G+    G     S S  +    +AA+AA   AGG
Sbjct: 641 SAAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGG 689

 Score = 32.7 bits (73), Expect(2) = 0.001
 Identities = 22/60 (36%), Positives = 30/60 (49%)
 Frame = +3

Query: 471 SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAAD 650
           S S+  AA+ AAAAAA S+A   G     G    + +   +    +AA+AA   AGG  D
Sbjct: 296 SDSAAAAAAAAAAAAAGSSAGGAGGGYGWG-DGGYGSDSAAAAAAAAAAAASSGAGGRGD 354

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +3

Query: 495 SPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
           S AAAAAA++AA+    +  SG    +   G  +   +AA+AA  +AG +A
Sbjct: 200 SAAAAAAAAAAAAAGSGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSSA 250

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 19/51 (37%), Positives = 33/51 (64%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            +++ AAAAAA++AA   G    +G+++A +A+  +    +AAS A G+ GG
Sbjct: 1881 SSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAA----AAASGAGGAGGG 1927

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 19/51 (37%), Positives = 33/51 (64%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            +++ AAAAAA++AA   G    +G+++A +A+  +    +AAS A G+ GG
Sbjct: 1569 SSAAAAAAAAAAAARRAGHDRAAGSAAAAAAAAAA----AAASGAGGAGGG 1615

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 22/53 (41%), Positives = 30/53 (56%)
 Frame = +3

Query: 489 AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
           AA+ AAAAAA+S A   G     G+ SA +A+       +AA+AA GS  G +
Sbjct: 174 AAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAA------AAAAAAAGSGAGGS 220

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 22/55 (40%), Positives = 28/55 (50%)
 Frame = +3

Query: 480  SLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGA 644
            S  AA+ AAAAAA+S A   G     G     S S  +    +AA+AA   AGG+
Sbjct: 1129 SAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAASGAGGS 1183

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 23/54 (42%), Positives = 30/54 (54%)
 Frame = +3

Query: 480  SLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            S  AA+ AAAAAA+S A   G     G+ SA +A+       +AA+AA GS  G
Sbjct: 1013 SAAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAA------AAAAAAAGSGAG 1060

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 23/54 (42%), Positives = 30/54 (54%)
 Frame = +3

Query: 480 SLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
           S  AA+ AAAAAA+S A   G     G+ SA +A+       +AA+AA GS  G
Sbjct: 827 SAAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAA------AAAAAAAGSGAG 874

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 23/54 (42%), Positives = 30/54 (54%)
 Frame = +3

Query: 480 SLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
           S  AA+ AAAAAA+S A   G     G+ SA +A+       +AA+AA GS  G
Sbjct: 641 SAAAAAAAAAAAAASGARGSGGYGGYGSDSAAAAAA------AAAAAAAGSGAG 688

 Score = 32.7 bits (73), Expect = 5.8
 Identities = 24/57 (42%), Positives = 34/57 (59%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            S SS  AA+ AAAAAA+  A   G    +G+++A +A+  +    +AAS A GS GG
Sbjct: 1321 SGSSAAAAAAAAAAAAARRA---GHDRAAGSAAAAAAAAAA----AAASGAGGSGGG 1370

 Score = 32.7 bits (73), Expect(2) = 2e-04
 Identities = 26/83 (31%), Positives = 36/83 (43%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAAD 650
            S S+  AA+ AAAAAA S A   G     G     S S  +    +AA+A  G+ G    
Sbjct: 1258 SDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRGDG 1317

Query: 651  EKTPGTLVPSCLSLRWRSARRRA 719
                G+   +  +    +A RRA
Sbjct: 1318 GYGSGSSAAAAAAAAAAAAARRA 1340

 Score = 32.3 bits (72), Expect = 7.6
 Identities = 23/60 (38%), Positives = 32/60 (53%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAADEKTPGT 668
            AA+ AAAAAA++A S  G     G  S  SA+       +AA+AA  +A  A  E+  G+
Sbjct: 2162 AAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAA-------AAAAAAAAAARRAGHERAAGS 2214

 Score = 32.3 bits (72), Expect(2) = 4e-04
 Identities = 44/160 (27%), Positives = 60/160 (37%), Gaps = 25/160 (15%)
 Frame = +2

Query: 23   RGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTA 202
            R +G+A+AA AA A  A+  G  G +   G  G       +          AAA   + +
Sbjct: 1744 RAAGSAAAAAAAAAAAASGAGGSGGSYGWGDGGYGSDSAAAA--------AAAAAAAAAS 1795

Query: 203  PAGPPACTRRQQRHG----------RSSRAARRARGGA*RGDWGRG*SWA-------VAT 331
             AG          +G           ++ AA  A  G+  G  G G  W         A 
Sbjct: 1796 GAGGSGGYGGYGGYGGYGSDSAAAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAA 1855

Query: 332  AAAAAAVAPA--------*GGHRPDAAAALSAGACGLACR 427
            AAAAAA A A         GG+   ++AA +A A   A R
Sbjct: 1856 AAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAAR 1895

 Score = 32.3 bits (72), Expect = 7.6
 Identities = 22/56 (39%), Positives = 28/56 (49%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAG 638
            S S+  AA+ AAAAAA S A   G     G     S S  +    +AA+AA G+ G
Sbjct: 1191 SDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAASGAGG 1246

 Score = 32.3 bits (72), Expect(2) = 5e-06
 Identities = 25/66 (37%), Positives = 35/66 (52%), Gaps = 7/66 (10%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAAS-------PPGSSACSGTSSAFSASGISTPRWSAASAAPG 629
            S S+  AA+ AAAAAA S A          GSSA +  ++A +A+  +    +A SAA  
Sbjct: 2159 SDSAAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAGHERAAGSAAAA 2218

Query: 630  SAGGAA 647
            +A  AA
Sbjct: 2219 AAAAAA 2224

 Score = 32.0 bits (71), Expect = 9.9
 Identities = 20/57 (35%), Positives = 28/57 (49%)
 Frame = +3

Query: 495  SPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAADEKTPG 665
            S AAAAAA++AA+  G+    G        G  +   +AA+AA  +A  AA     G
Sbjct: 1781 SAAAAAAAAAAAAASGAGGSGGYGGYGGYGGYGSDSAAAAAAAAAAAAAAAGSGAGG 1837

 Score = 32.0 bits (71), Expect(2) = 2e-06
 Identities = 23/59 (38%), Positives = 31/59 (51%), Gaps = 3/59 (5%)
 Frame = +3

Query: 480 SLPAASPAAAAAASSAASPPGS---SACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
           S  AA+ AAAAAA S A   G     + S  ++A +A+  S  R +   +A GSA  AA
Sbjct: 705 SAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRAGHDSAAGSAAAAA 763

 Score = 32.0 bits (71), Expect = 9.9
 Identities = 21/50 (42%), Positives = 27/50 (54%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAG 638
            AA+ AAAAAA+S A   G S   G     S S  +    +AA+AA G+ G
Sbjct: 2216 AAAAAAAAAAASGAGRSGGSYGWGDGGYGSDSAAAAAAAAAAAAASGAGG 2265

 Score = 32.0 bits (71), Expect(2) = 5e-05
 Identities = 21/53 (39%), Positives = 28/53 (52%)
 Frame = +3

Query: 480  SLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAG 638
            S  AA+ AAAAAA+S A   G     G   + SA+  +    +AAS A G+ G
Sbjct: 2247 SAAAAAAAAAAAAASGAGGSGGYGGYGGYGSDSAAAAAAAAAAAASGAGGAGG 2299

 Score = 32.0 bits (71), Expect = 9.9
 Identities = 19/53 (35%), Positives = 29/53 (53%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
            AA  AAAAAA++AA+    +  SG    +   G  +   +AA+AA  +A  A+
Sbjct: 1126 AAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAAS 1178

 Score = 32.0 bits (71), Expect(2) = 1e-05
 Identities = 21/50 (42%), Positives = 27/50 (54%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAG 638
            AA+ AAAAAA+S A   G S   G     S S  +    +AA+AA G+ G
Sbjct: 1750 AAAAAAAAAAASGAGGSGGSYGWGDGGYGSDSAAAAAAAAAAAAASGAGG 1799

 Score = 32.0 bits (71), Expect(2) = 2e-05
 Identities = 22/56 (39%), Positives = 28/56 (49%)
 Frame = +3

Query: 471 SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAG 638
           S S+  AA+ AAAAAA S A   G     G     S S  +    +AA+AA G+ G
Sbjct: 604 SDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAASGARG 659

 Score = 32.0 bits (71), Expect = 9.9
 Identities = 23/59 (38%), Positives = 31/59 (51%), Gaps = 3/59 (5%)
 Frame = +3

Query: 480 SLPAASPAAAAAASSAASPPGS---SACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
           S  AA+ AAAAAA S A   G     + S  ++A +A+  S  R +   +A GSA  AA
Sbjct: 519 SAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRAGHDSAAGSAAAAA 577

 Score = 32.0 bits (71), Expect(2) = 4e-06
 Identities = 19/53 (35%), Positives = 29/53 (53%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
            AA  AAAAAA++AA+    +  SG    +   G  +   +AA+AA  +A  A+
Sbjct: 1345 AAGSAAAAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAAS 1397

 Score = 32.0 bits (71), Expect = 9.9
 Identities = 23/62 (37%), Positives = 31/62 (49%), Gaps = 2/62 (3%)
 Frame = +3

Query: 462  DLPSPSSLPAASPAAAAAASSAASPPGSSAC--SGTSSAFSASGISTPRWSAASAAPGSA 635
            D  + S+  AA+ AAAAAAS A    G       G SS  +A+  +    +AA +  G A
Sbjct: 1588 DRAAGSAAAAAAAAAAAAASGAGGAGGGYGWGDGGYSSDSAAAAAAAAAAAAAGSGAGGA 1647

Query: 636  GG 641
            GG
Sbjct: 1648 GG 1649

 Score = 32.0 bits (71), Expect(2) = 8e-05
 Identities = 22/56 (39%), Positives = 28/56 (49%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAG 638
            S S+  AA+ AAAAAA S A   G     G     S S  +    +AA+AA G+ G
Sbjct: 976  SDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAASGARG 1031

 Score = 32.0 bits (71), Expect(2) = 8e-05
 Identities = 22/56 (39%), Positives = 28/56 (49%)
 Frame = +3

Query: 471 SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAG 638
           S S+  AA+ AAAAAA S A   G     G     S S  +    +AA+AA G+ G
Sbjct: 790 SDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSDSAAAAAAAAAAAAASGARG 845

 Score = 32.0 bits (71), Expect(2) = 4e-06
 Identities = 19/53 (35%), Positives = 29/53 (53%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
            +A+ AAAAAA++AAS  G S   G    +   G  +   +AA+AA  +A   +
Sbjct: 1781 SAAAAAAAAAAAAASGAGGSGGYGGYGGYGGYGSDSAAAAAAAAAAAAAAAGS 1833

 Score = 32.0 bits (71), Expect = 9.9
 Identities = 20/69 (28%), Positives = 30/69 (42%)
 Frame = -1

Query: 671  EGARSFLISSAACRARGGRGGAPAWG*YAARGEG*GGARAG*GPRGRGS*GCGRGGCWRR 492
            + A +   ++AA  A  G GG+  +G Y +       A A     G G+ G G G  W  
Sbjct: 1162 DSAAAAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAAGSGAGGAGGGYGW-- 1219

Query: 491  GRQGGWGGE 465
               GG+G +
Sbjct: 1220 -GDGGYGSD 1227

 Score = 32.0 bits (71), Expect(2) = 2e-06
 Identities = 23/59 (38%), Positives = 31/59 (51%), Gaps = 3/59 (5%)
 Frame = +3

Query: 480  SLPAASPAAAAAASSAASPPGS---SACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
            S  AA+ AAAAAA S A   G     + S  ++A +A+  S  R +   +A GSA  AA
Sbjct: 891  SAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAASAARRAGHDSAAGSAAAAA 949

 Score = 31.6 bits (70), Expect(2) = 0.001
 Identities = 44/151 (29%), Positives = 57/151 (37%), Gaps = 15/151 (9%)
 Frame = +2

Query: 26  GSGAASAATAACA*GAAAP-GAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQPPSTA 202
           GSG++SAA  + A G     G+   A     A AA     SG       +G      + A
Sbjct: 150 GSGSSSAAAGSGAGGVGGGYGSDSAAAAAAAAAAASGAGGSGG------YGGYGSDSAAA 203

Query: 203 PAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAPA------- 361
            A   A          ++ A   A G    G +G   S + A AAAAAA A A       
Sbjct: 204 AAAAAA----------AAAAGSGAGGSGGYGGYGGYGSDSAAAAAAAAAAAAAGSSAGGA 253

Query: 362 -------*GGHRPDAAAALSAGACGLACRHG 433
                   GG+  D+AAA +A A   A   G
Sbjct: 254 GGGYGWGDGGYGSDSAAAAAAAAAAAAAGSG 284

 Score = 31.6 bits (70), Expect(2) = 2e-05
 Identities = 22/60 (36%), Positives = 29/60 (47%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAAD 650
            S S+  AA+ AAAAAA S A   G     G    + +   +    +AA+AA   AGG  D
Sbjct: 1040 SDSAAAAAAAAAAAAAGSGAGGVGGGYGWG-DGGYGSDSAAAAAAAAAAAAGSGAGGRGD 1098

 Score = 31.6 bits (70), Expect(2) = 8e-06
 Identities = 24/60 (40%), Positives = 29/60 (48%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGGAAD 650
            S S+  AA+ AAAAAA S A   G     G     S S  +    +AA+AA   AGG  D
Sbjct: 1504 SDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDGGYGSYSAAAAAA-AAAAAAGSGAGGRGD 1562

 Score = 31.2 bits (69), Expect(2) = 4e-05
 Identities = 23/61 (37%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGS-AGGAA 647
            S S+  AA+ AAAAAA++ +   G     G       S  +    +AA+AA GS AGG  
Sbjct: 1814 SDSAAAAAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGGRG 1873

Query: 648  D 650
            D
Sbjct: 1874 D 1874

 Score = 30.8 bits (68), Expect(2) = 2e-06
 Identities = 21/56 (37%), Positives = 27/56 (47%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAG 638
            S S+  AA+ AAAAAA S A   G     G     S S  +    +AA+A  G+ G
Sbjct: 1625 SDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDDGYGSDSAAAAAAAAAAAAGSGAGG 1680

 Score = 30.8 bits (68), Expect(2) = 2e-06
 Identities = 21/56 (37%), Positives = 27/56 (47%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAG 638
            S S+  AA+ AAAAAA S A   G     G     S S  +    +AA+A  G+ G
Sbjct: 1937 SDSAAAAAAAAAAAAAGSGAGGAGGGYGWGDDGYGSDSAAAAAAAAAAAAGSGAGG 1992

 Score = 30.8 bits (68), Expect(2) = 5e-05
 Identities = 26/68 (38%), Positives = 35/68 (51%), Gaps = 9/68 (13%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASP------PGSSACSGTSSAFSA---SGISTPRWSAASAA 623
            S S+  AA+ AAAAA S A          GSSA +  ++A +A   +G      SAA+AA
Sbjct: 1851 SDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAGHDRAAGSAAAAA 1910

Query: 624  PGSAGGAA 647
              +A  AA
Sbjct: 1911 AAAAAAAA 1918

 Score = 30.4 bits (67), Expect(2) = 1e-04
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            +A+ AAAAAA+S A   G     G     S S  +    +AA+AA GS  G
Sbjct: 2376 SAAAAAAAAAASGAGGSGGGYGWGDGGYGSDSAAAAAAAAAAAAAAGSGAG 2426

 Score = 30.4 bits (67), Expect(2) = 1e-04
 Identities = 24/65 (36%), Positives = 34/65 (51%), Gaps = 6/65 (9%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSAASP------PGSSACSGTSSAFSASGISTPRWSAASAAPGS 632
            S S+  AA+ AAAAA S A          GSSA +  ++A +A+  +    +A SAA  +
Sbjct: 1694 SDSAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAARRAGHDRAAGSAAAAA 1753

Query: 633  AGGAA 647
            A  AA
Sbjct: 1754 AAAAA 1758

 Score = 30.0 bits (66), Expect(2) = 3e-05
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 3/59 (5%)
 Frame = +3

Query: 480  SLPAASPAAAAAASSAASPPGS---SACSGTSSAFSASGISTPRWSAASAAPGSAGGAA 647
            S  AA+ AAAAAA S A   G     + S  ++A +A+  +  R +    A GSA  AA
Sbjct: 2008 SAAAAAAAAAAAAGSGAGGRGDGGYGSGSSAAAAAAAAAAAAARRAGHDRAAGSAAAAA 2066

 Score = 28.5 bits (62), Expect(2) = 6e-06
 Identities = 20/54 (37%), Positives = 25/54 (46%)
 Frame = +3

Query: 477  SSLPAASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAG 638
            S   AA+ AAAAAA S A   G     G     S S  +    +AA+A  G+ G
Sbjct: 2311 SDSAAAAAAAAAAAGSGAGGVGGGYGWGDGGYGSDSAAAAAAAAAAAAGSGAGG 2364

 Score = 28.5 bits (62), Expect(2) = 5e-04
 Identities = 40/147 (27%), Positives = 53/147 (35%), Gaps = 9/147 (6%)
 Frame = +2

Query: 8   QRLGCRGSGAASAATAACA*GAAAPGAVGVALRRGRAGAARRRVPSGRVICP*RHGAAAQ 187
           +R    G+G A+        GAAA  A G + RRG          S          +AA 
Sbjct: 110 ERQASHGAGGAA--------GAAAGAAAGSSARRGGGFYETHNSYSSYGS---GSSSAAA 158

Query: 188 PPSTAPAGPPACTRRQQRHGRSSRAARRARGGA*RGDWGRG*SWAVATAAAAAAVAP--- 358
                  G    +        ++ AA  A G    G +G   + A A AAAAAA      
Sbjct: 159 GSGAGGVGGGYGSDSAAAAAAAAAAASGAGGSGGYGGYGSDSAAAAAAAAAAAAAGSGAG 218

Query: 359 ------A*GGHRPDAAAALSAGACGLA 421
                   GG+  D+AAA +A A   A
Sbjct: 219 GSGGYGGYGGYGSDSAAAAAAAAAAAA 245

 Score = 26.2 bits (56), Expect(2) = 3e-04
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +3

Query: 489  AASPAAAAAASSAASPPGSSACSGTSSAFSASGISTPRWSAASAAPGSAGG 641
            AA+ AAAAAA +A+   GS    G    + + G  +   +A S A GS GG
Sbjct: 2469 AAAAAAAAAA-AASGAGGSGGSYGWD--YESYGSGSAAAAAGSGAGGSGGG 2516

 Score = 22.3 bits (46), Expect(2) = 3e-04
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +3

Query: 471  SPSSLPAASPAAAAAASSA 527
            S  S  AA+ AAAAAASS+
Sbjct: 2590 SEGSAAAAAAAAAAAASSS 2608



EST assemble image


clone accession position
1 LCL083g09_r AV630752 1 432
2 CL40d12_r AV395377 241 722




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research