KCC000544A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000544A_C01 KCC000544A_c01
ctgcacggacgtggccaagtcgctcaactgccccatcttccacgtcaacgccgacgacgt
ggagtcggtggtgcgcgtgtGCCAGCTGGCGGCGGAGTGGCGCCAGGCCTGGAAGAGCGA
CGTGGTGGTGGACCTGGTGTGCTACCGCAAGCACGGCCACAACGAGATCGACGAGCCCAT
GTTCACGCAGCCGCTCATGTACAAGAAGATCAAGGCGCACAAGCACAGCGCCCAGCTGTA
CGCGGAGCGACTGATCGCGGAGGGCACATTCACCAAGGAGGAGGTGCAGCAGGTGCGCGA
CCGCATCATGCAGCACCTGAACGCCGCCTTTGAGGGCGCCAAGGACTACAAGCCCAGCAA
GAAGGACTGGCTGGCGTCCCACTGGTCCGGCTTCATGAGCCCAGCGCAGCTGTCGCGCAT
CCGCAACACGGGTGTGCCGGCTGAGCTGCTGCGCAGCACCGGCCTGGCCATCACGGCGCT
GCCCGAGGACTTCGCCTTCCACCGCCAGATCAAGAAGGTGTACGAGACGCGCCGCGCCAT
GATCGAGAGCGGCGAGGGCCTGGACTGGGCCATGGCTGAGGCGCTCGCGTTCGCGACGTT
GGTGTCGGAGGGCAACCACGTGCGGCTGAGCGGGCAGGACGTGGAGCGCGGCACCTTCAG
CCACCGCCACGCAGTGCTGCACGACCAGACCAACGGCGCCAAGTACGTGCCGCTGAACCA
CGTGTTCCCCGGCCAGAAGCCCAACAGCTTCACGGTGTGCAACTCATCGCTGTCGGAGTT
CGGCGTGCTGGGCTTCGAGCTGGGCTACTCCATGGAGAGCCCCAACAGCCTGGTGCTGTG
GGAGGCGCAGTTCGGAGACTTCGCCAACGGAGCGCAGATCATCTTTGACCAGTTCCTGTC
GGGCGGCGAGGCCAAGTGGCTGCGCCAGAGCGGCCTGGTGTGCCTGCTGCCGCACGGCTA
CGACGGCCAGGGCCCCGAGCACTCCTCCGCGCGACTGGAGCGCTTCCTGCAGATGTGCGA
CGAGAACCCCTACGAGATGCCCCACCACGACGAGGCGCAGTGGTTCTCGGGCGGCCACCT
GGGCACCCAGATCCAGCGCGCCAACTGGCAGGTGGTCAACTGCACCACACCCGCCAACTA
CTTCCACGTGCTGCGCCGCCAGGTGCACCGCCAGTTCCGCAAGCCGCTGATCGTGATGGC
GCCCAAGAACCTGCTGCGCCACCCGCGCTGCAAGAGCCCGCTGTACGAGTTTGACGACCA
GCCCGACGACGCCAACATCGTGGGCGTGCGCTTCAAGCGAGTCATCATGGACGACACCGG
CCTGACCCCCAAGGACCGCGGCCCGCGCCCGCCCGCCGAGCCCGAGATCAAGCGCGTGGT
GTTCTGCAGCGGCAAGGTGTTCTACGACCTGCACGACGCGCGCGAGAAGCAGGGCAAGGT
GGGCGAGGTGGCCATCGTGCGTGTGGAGCAGCTGGCGCCCTTCCCCTTCGACCTGGTGTG
CCGCGAGATCCGGCGCTACCCCAACGCGCAGCTGCTGTGGTGCCAGGAGGAGCCCATGAA
CATGGGCGCCT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000544A_C01 KCC000544A_c01
         (1571 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAC84070.1| putative 2-oxoglutarate dehydrogenase, E1 subuni...   710  0.0
ref|NP_201376.1| 2-oxoglutarate dehydrogenase, E1 component [Ara...   708  0.0
pir||T50644 oxoglutarate dehydrogenase (lipoamide) (EC 1.2.4.2) ...   703  0.0
gb|AAO42889.1| At3g55410 [Arabidopsis thaliana]                       701  0.0
ref|NP_191101.2| 2-oxoglutarate dehydrogenase, E1 subunit - like...   701  0.0

>dbj|BAC84070.1| putative 2-oxoglutarate dehydrogenase, E1 subunit [Oryza sativa
            (japonica cultivar-group)]
          Length = 1008

 Score =  710 bits (1832), Expect = 0.0
 Identities = 346/525 (65%), Positives = 412/525 (77%), Gaps = 2/525 (0%)
 Frame = +2

Query: 2    CTDVAKSLNCPIFHVNADDVESVVRVCQLAAEWRQAWKSDVVVDLVCYRKHGHNEIDEPM 181
            CTDVAK+LN PIFHVN DD+E+VVRVC+LAAEWRQ + SDVVVDL+CYR+ GHNEIDEP 
Sbjct: 438  CTDVAKALNAPIFHVNGDDLEAVVRVCELAAEWRQTFHSDVVVDLICYRRFGHNEIDEPS 497

Query: 182  FTQPLMYKKIKAHKHSAQLYAERLIAEGTFTKEEVQQVRDRIMQHLNAAFEGAKDYKPSK 361
            FTQP MY+ IK H  S +LY ++L+  G  +KE+VQ++ +++ + LN  F  +KDY P+K
Sbjct: 498  FTQPKMYQVIKNHPSSLKLYEQKLLGTGEVSKEDVQKIHEKVNRILNEEFAKSKDYVPNK 557

Query: 362  KDWLASHWSGFMSPAQLSRIRNTGVPAELLRSTGLAITALPEDFAFHRQIKKVYETRRAM 541
            +DWL+++W+GF SP Q+SR+RNTGV   +L+  G AIT LPEDF  HR +KK++E R AM
Sbjct: 558  RDWLSAYWTGFKSPEQISRVRNTGVNPGVLKRVGQAITTLPEDFKPHRAVKKIFEQRAAM 617

Query: 542  IESGEGLDWAMAEALAFATLVSEGNHVRLSGQDVERGTFSHRHAVLHDQTNGAKYVPLNH 721
            IESGEG+DWA+AEALAFATL+ EGNHVRLSGQDVERGTFSHRHAVLHDQ NG K+ PL+H
Sbjct: 618  IESGEGIDWAVAEALAFATLIVEGNHVRLSGQDVERGTFSHRHAVLHDQENGRKHCPLDH 677

Query: 722  VFPGQKPNSFTVCNSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQIIFDQFLS 901
            V   Q    FTV NSSLSEF VLGFE+GYSME+PNSLVLWEAQFGDF+NGAQ++FDQFLS
Sbjct: 678  VVMNQNEELFTVSNSSLSEFAVLGFEMGYSMENPNSLVLWEAQFGDFSNGAQVMFDQFLS 737

Query: 902  GGEAKWLRQSGLVCLLPHGYDGQGPEHSSARLERFLQMCDENPYEMPHHDEAQWFSGGHL 1081
             GEAKWLRQ+GLV LLPHGYDGQGPEHSSARLERFLQM D+NP+ +P  +         L
Sbjct: 738  SGEAKWLRQTGLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMEPT-------L 790

Query: 1082 GTQIQRANWQVVNCTTPANYFHVLRRQVHRQFRKPLIVMAPKNLLRHPRCKSPLYEFDDQ 1261
              QIQ  NWQVVN TTPANYFHVLRRQ+HR+FRKPLIVMAPKNLLRH  CKS L EFDD 
Sbjct: 791  RKQIQECNWQVVNVTTPANYFHVLRRQIHREFRKPLIVMAPKNLLRHKDCKSNLSEFDDV 850

Query: 1262 PDDANI--VGVRFKRVIMDDTGLTPKDRGPRPPAEPEIKRVVFCSGKVFYDLHDAREKQG 1435
                     G RFKR+I        KDR      E  IKR+V CSGKV+Y+L + R+K  
Sbjct: 851  EGHPGFDKQGTRFKRLI--------KDRNDHKQVEEGIKRLVLCSGKVYYELDEERKKTE 902

Query: 1436 KVGEVAIVRVEQLAPFPFDLVCREIRRYPNAQLLWCQEEPMNMGA 1570
            +  +VAI RVEQL PFP+DL+ RE++RYPNA+++WCQEEPMNMGA
Sbjct: 903  R-SDVAICRVEQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMGA 946

>ref|NP_201376.1| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
            gi|10177333|dbj|BAB10682.1| 2-oxoglutarate dehydrogenase,
            E1 component [Arabidopsis thaliana]
            gi|18389254|gb|AAL67070.1| putative 2-oxoglutarate
            dehydrogenase E1 component [Arabidopsis thaliana]
            gi|20465597|gb|AAM20281.1| putative 2-oxoglutarate
            dehydrogenase E1 component [Arabidopsis thaliana]
          Length = 1025

 Score =  708 bits (1827), Expect = 0.0
 Identities = 341/524 (65%), Positives = 407/524 (77%), Gaps = 2/524 (0%)
 Frame = +2

Query: 2    CTDVAKSLNCPIFHVNADDVESVVRVCQLAAEWRQAWKSDVVVDLVCYRKHGHNEIDEPM 181
            CTDVAK+L+ PIFHVNADD+E+VV  C+LAAEWRQ + SDVVVDLVCYR+ GHNEIDEP 
Sbjct: 453  CTDVAKALSAPIFHVNADDIEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEPS 512

Query: 182  FTQPLMYKKIKAHKHSAQLYAERLIAEGTFTKEEVQQVRDRIMQHLNAAFEGAKDYKPSK 361
            FTQP MYK I++H  S Q+Y E+L+  G  T+E++ +++ ++   LN  +E +KDY P K
Sbjct: 513  FTQPKMYKVIRSHPSSLQIYQEKLLQSGQVTQEDIDKIQKKVSSILNEEYEASKDYIPQK 572

Query: 362  KDWLASHWSGFMSPAQLSRIRNTGVPAELLRSTGLAITALPEDFAFHRQIKKVYETRRAM 541
            +DWLASHW+GF SP Q+SRIRNTGV  E+L++ G AI+  PE+F  HR +K+VYE R  M
Sbjct: 573  RDWLASHWTGFKSPEQISRIRNTGVKPEILKNVGKAISTFPENFKPHRGVKRVYEQRAQM 632

Query: 542  IESGEGLDWAMAEALAFATLVSEGNHVRLSGQDVERGTFSHRHAVLHDQTNGAKYVPLNH 721
            IESGEG+DW + EALAFATLV EGNHVRLSGQDVERGTFSHRH+VLHDQ  G +Y PL+H
Sbjct: 633  IESGEGIDWGLGEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEEYCPLDH 692

Query: 722  VFPGQKPNSFTVCNSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQIIFDQFLS 901
            +   Q P  FTV NSSLSEFGVLGFELGYSME+PNSLV+WEAQFGDFANGAQ++FDQF+S
Sbjct: 693  LIKNQDPEMFTVSNSSLSEFGVLGFELGYSMENPNSLVIWEAQFGDFANGAQVMFDQFIS 752

Query: 902  GGEAKWLRQSGLVCLLPHGYDGQGPEHSSARLERFLQMCDENPYEMPHHDEAQWFSGGHL 1081
             GEAKWLRQ+GLV LLPHGYDGQGPEHSS RLERFLQM D+NPY +P  D         L
Sbjct: 753  SGEAKWLRQTGLVVLLPHGYDGQGPEHSSGRLERFLQMSDDNPYVIPEMDPT-------L 805

Query: 1082 GTQIQRANWQVVNCTTPANYFHVLRRQVHRQFRKPLIVMAPKNLLRHPRCKSPLYEFDDQ 1261
              QIQ  NWQVVN TTPANYFHVLRRQ+HR FRKPLIVMAPKNLLRH +C S L EFDD 
Sbjct: 806  RKQIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKQCVSNLSEFDDV 865

Query: 1262 PDDANI--VGVRFKRVIMDDTGLTPKDRGPRPPAEPEIKRVVFCSGKVFYDLHDAREKQG 1435
                     G RFKR+I D +G +  + G        I+R+V CSGKV+Y+L D   K+ 
Sbjct: 866  KGHPGFDKQGTRFKRLIKDQSGHSDLEEG--------IRRLVLCSGKVYYEL-DEERKKS 916

Query: 1436 KVGEVAIVRVEQLAPFPFDLVCREIRRYPNAQLLWCQEEPMNMG 1567
            +  +VAI RVEQL PFP+DL+ RE++RYPNA+++WCQEEPMNMG
Sbjct: 917  ETKDVAICRVEQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMG 960

>pir||T50644 oxoglutarate dehydrogenase (lipoamide) (EC 1.2.4.2) E1 chain
            [imported] - Arabidopsis thaliana
            gi|4210330|emb|CAA11552.1| 2-oxoglutarate dehydrogenase,
            E1 subunit [Arabidopsis thaliana]
          Length = 1027

 Score =  703 bits (1814), Expect = 0.0
 Identities = 341/526 (64%), Positives = 407/526 (76%), Gaps = 4/526 (0%)
 Frame = +2

Query: 2    CTDVAKSLNCPIFHVNADDVESVVRVCQLAAEWRQAWKSDVVVDLVCYRKHGHNEIDEPM 181
            CTDVAK+L+ PIFHVNADD+E+VV  C+LAAEWRQ + SDVVVDLVCYR+ GHNEIDEP 
Sbjct: 453  CTDVAKALSAPIFHVNADDIEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEPS 512

Query: 182  FTQPLMYKKIKAHKHSAQLYAERLIAEGTFTKEEVQQVRDRIMQHLNAAFEGAKDYKPSK 361
            FTQP MYK I++H  S Q+Y E+L+  G  T+E++ +++ ++   LN  +E +KDY P K
Sbjct: 513  FTQPKMYKVIRSHPSSLQIYQEKLLQSGQVTQEDIDKIQKKVSSILNEEYEASKDYIPQK 572

Query: 362  KDWLASHWSGFMSPAQLSRIRNTGVPAELLRSTGLAITALPEDFAFHRQIKKV--YETRR 535
            +DWLASHW+GF SP Q+SRIRNTGV  E+L++ G AI+  PE+F  HR +K+V  YE R 
Sbjct: 573  RDWLASHWTGFKSPEQISRIRNTGVKPEILKNVGKAISTFPENFKPHRGVKRVRVYEQRA 632

Query: 536  AMIESGEGLDWAMAEALAFATLVSEGNHVRLSGQDVERGTFSHRHAVLHDQTNGAKYVPL 715
             MIESGEG+DW + EALAFATLV EGNHVRLSGQDVERGTFSHRH+VLHDQ  G +Y PL
Sbjct: 633  QMIESGEGIDWGLGEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEEYCPL 692

Query: 716  NHVFPGQKPNSFTVCNSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQIIFDQF 895
            +H+   Q P  FTV NSSLSEFGVLGFELGYSME+PNSLV+WEAQFGDFANGAQ++FDQF
Sbjct: 693  DHLIKNQDPEMFTVSNSSLSEFGVLGFELGYSMENPNSLVIWEAQFGDFANGAQVMFDQF 752

Query: 896  LSGGEAKWLRQSGLVCLLPHGYDGQGPEHSSARLERFLQMCDENPYEMPHHDEAQWFSGG 1075
            +S GEAKWLRQ+GLV LLPHGYDGQGPEHSS RLERFLQM D+NPY +P  D        
Sbjct: 753  ISSGEAKWLRQTGLVVLLPHGYDGQGPEHSSGRLERFLQMSDDNPYVIPEMDPT------ 806

Query: 1076 HLGTQIQRANWQVVNCTTPANYFHVLRRQVHRQFRKPLIVMAPKNLLRHPRCKSPLYEFD 1255
             L  QIQ  NWQVVN TTPANYFHVLRRQ+HR FRKPLIVMAPKNLLRH +C S L EFD
Sbjct: 807  -LRKQIQECNWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKQCVSNLSEFD 865

Query: 1256 DQPDDANI--VGVRFKRVIMDDTGLTPKDRGPRPPAEPEIKRVVFCSGKVFYDLHDAREK 1429
            D          G RFKR+I D +G +  + G        I+R+V CSGKV+Y+L D   K
Sbjct: 866  DVKGHPGFDKQGTRFKRLIKDQSGHSDLEEG--------IRRLVLCSGKVYYEL-DEERK 916

Query: 1430 QGKVGEVAIVRVEQLAPFPFDLVCREIRRYPNAQLLWCQEEPMNMG 1567
            + +  +VAI RVEQL PFP+DL+ RE++RYPNA+++WCQEEPMNMG
Sbjct: 917  KSETKDVAICRVEQLCPFPYDLIQRELKRYPNAEIVWCQEEPMNMG 962

>gb|AAO42889.1| At3g55410 [Arabidopsis thaliana]
          Length = 1017

 Score =  701 bits (1809), Expect = 0.0
 Identities = 341/525 (64%), Positives = 409/525 (76%), Gaps = 2/525 (0%)
 Frame = +2

Query: 2    CTDVAKSLNCPIFHVNADDVESVVRVCQLAAEWRQAWKSDVVVDLVCYRKHGHNEIDEPM 181
            CTDVAK+L+ PIFHVN DDVE+VV  C+LAAEWRQ + SDVVVDLVCYR+ GHNEIDEP 
Sbjct: 449  CTDVAKALSAPIFHVNGDDVEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEPS 508

Query: 182  FTQPLMYKKIKAHKHSAQLYAERLIAEGTFTKEEVQQVRDRIMQHLNAAFEGAKDYKPSK 361
            FTQP MYK IK H  + Q+Y ++L+  G  +++++ ++++++   LN  F  +KDY P K
Sbjct: 509  FTQPKMYKVIKNHPSTLQIYHKKLLECGEVSQQDIDRIQEKVNTILNEEFVASKDYLPKK 568

Query: 362  KDWLASHWSGFMSPAQLSRIRNTGVPAELLRSTGLAITALPEDFAFHRQIKKVYETRRAM 541
            +DWL+++W+GF SP Q+SR+RNTGV  E+L++ G AI++LPE+F  HR +KKVYE R  M
Sbjct: 569  RDWLSTNWAGFKSPEQISRVRNTGVKPEILKTVGKAISSLPENFKPHRAVKKVYEQRAQM 628

Query: 542  IESGEGLDWAMAEALAFATLVSEGNHVRLSGQDVERGTFSHRHAVLHDQTNGAKYVPLNH 721
            IESGEG+DWA+AEALAFATLV EGNHVRLSGQDVERGTFSHRH+VLHDQ  G +Y PL+H
Sbjct: 629  IESGEGVDWALAEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEEYCPLDH 688

Query: 722  VFPGQKPNSFTVCNSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQIIFDQFLS 901
            +   Q P  FTV NSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQ+IFDQF+S
Sbjct: 689  LIMNQDPEMFTVSNSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQVIFDQFIS 748

Query: 902  GGEAKWLRQSGLVCLLPHGYDGQGPEHSSARLERFLQMCDENPYEMPHHDEAQWFSGGHL 1081
             GEAKWLRQ+GLV LLPHGYDGQGPEHSSARLER+LQM D+NPY +P  +         +
Sbjct: 749  SGEAKWLRQTGLVMLLPHGYDGQGPEHSSARLERYLQMSDDNPYVIPDMEPT-------M 801

Query: 1082 GTQIQRANWQVVNCTTPANYFHVLRRQVHRQFRKPLIVMAPKNLLRHPRCKSPLYEFDDQ 1261
              QIQ  NWQ+VN TTPANYFHVLRRQ+HR FRKPLIVMAPKNLLRH  CKS L EFDD 
Sbjct: 802  RKQIQECNWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKDCKSNLSEFDDV 861

Query: 1262 PDDANI--VGVRFKRVIMDDTGLTPKDRGPRPPAEPEIKRVVFCSGKVFYDLHDAREKQG 1435
                     G RFKR+I        KD+      E  I+R+V CSGKV+Y+L D R+K G
Sbjct: 862  QGHPGFDKQGTRFKRLI--------KDQNDHSDLEEGIRRLVLCSGKVYYELDDERKKVG 913

Query: 1436 KVGEVAIVRVEQLAPFPFDLVCREIRRYPNAQLLWCQEEPMNMGA 1570
               +VAI RVEQL PFP+DL+ RE++RYPNA+++WCQEE MNMGA
Sbjct: 914  AT-DVAICRVEQLCPFPYDLIQRELKRYPNAEIVWCQEEAMNMGA 957

>ref|NP_191101.2| 2-oxoglutarate dehydrogenase, E1 subunit - like protein [Arabidopsis
            thaliana]
          Length = 1017

 Score =  701 bits (1809), Expect = 0.0
 Identities = 341/525 (64%), Positives = 409/525 (76%), Gaps = 2/525 (0%)
 Frame = +2

Query: 2    CTDVAKSLNCPIFHVNADDVESVVRVCQLAAEWRQAWKSDVVVDLVCYRKHGHNEIDEPM 181
            CTDVAK+L+ PIFHVN DDVE+VV  C+LAAEWRQ + SDVVVDLVCYR+ GHNEIDEP 
Sbjct: 449  CTDVAKALSAPIFHVNGDDVEAVVHACELAAEWRQTFHSDVVVDLVCYRRFGHNEIDEPS 508

Query: 182  FTQPLMYKKIKAHKHSAQLYAERLIAEGTFTKEEVQQVRDRIMQHLNAAFEGAKDYKPSK 361
            FTQP MYK IK H  + Q+Y ++L+  G  +++++ ++++++   LN  F  +KDY P K
Sbjct: 509  FTQPKMYKVIKNHPSTLQIYHKKLLECGEVSQQDIDRIQEKVNTILNEEFVASKDYLPKK 568

Query: 362  KDWLASHWSGFMSPAQLSRIRNTGVPAELLRSTGLAITALPEDFAFHRQIKKVYETRRAM 541
            +DWL+++W+GF SP Q+SR+RNTGV  E+L++ G AI++LPE+F  HR +KKVYE R  M
Sbjct: 569  RDWLSTNWAGFKSPEQISRVRNTGVKPEILKTVGKAISSLPENFKPHRAVKKVYEQRAQM 628

Query: 542  IESGEGLDWAMAEALAFATLVSEGNHVRLSGQDVERGTFSHRHAVLHDQTNGAKYVPLNH 721
            IESGEG+DWA+AEALAFATLV EGNHVRLSGQDVERGTFSHRH+VLHDQ  G +Y PL+H
Sbjct: 629  IESGEGVDWALAEALAFATLVVEGNHVRLSGQDVERGTFSHRHSVLHDQETGEEYCPLDH 688

Query: 722  VFPGQKPNSFTVCNSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQIIFDQFLS 901
            +   Q P  FTV NSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQ+IFDQF+S
Sbjct: 689  LIMNQDPEMFTVSNSSLSEFGVLGFELGYSMESPNSLVLWEAQFGDFANGAQVIFDQFIS 748

Query: 902  GGEAKWLRQSGLVCLLPHGYDGQGPEHSSARLERFLQMCDENPYEMPHHDEAQWFSGGHL 1081
             GEAKWLRQ+GLV LLPHGYDGQGPEHSSARLER+LQM D+NPY +P  +         +
Sbjct: 749  SGEAKWLRQTGLVMLLPHGYDGQGPEHSSARLERYLQMSDDNPYVIPDMEPT-------M 801

Query: 1082 GTQIQRANWQVVNCTTPANYFHVLRRQVHRQFRKPLIVMAPKNLLRHPRCKSPLYEFDDQ 1261
              QIQ  NWQ+VN TTPANYFHVLRRQ+HR FRKPLIVMAPKNLLRH  CKS L EFDD 
Sbjct: 802  RKQIQECNWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNLLRHKDCKSNLSEFDDV 861

Query: 1262 PDDANI--VGVRFKRVIMDDTGLTPKDRGPRPPAEPEIKRVVFCSGKVFYDLHDAREKQG 1435
                     G RFKR+I        KD+      E  I+R+V CSGKV+Y+L D R+K G
Sbjct: 862  QGHPGFDKQGTRFKRLI--------KDQNDHSDLEEGIRRLVLCSGKVYYELDDERKKVG 913

Query: 1436 KVGEVAIVRVEQLAPFPFDLVCREIRRYPNAQLLWCQEEPMNMGA 1570
               +VAI RVEQL PFP+DL+ RE++RYPNA+++WCQEE MNMGA
Sbjct: 914  AT-DVAICRVEQLCPFPYDLIQRELKRYPNAEIVWCQEEAMNMGA 957



EST assemble image


clone accession position
1 CL40d10_r AV395355 1 490
2 HCL002g02_r AV639667 117 447
3 HCL082f10_r AV644138 152 607
4 HCL025d02_r AV640957 176 595
5 HCL084a07_r AV644212 483 966
6 MX014a07_r BP086669 782 1167
7 MXL023g11_r BP094486 992 1204
8 CM044h10_r AV389550 1048 1571




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research