KCC000542A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000542A_C01 KCC000542A_c01
acattgaaacattcagcagcttcaCAACTTCAACCAATTCCAGCAAATACGTGCAAGCTA
ACACTCTTCCGACACACCTAAACGCCTCGCGCCCTTGCGCGGGCCCGCAACGGCCAGCGG
CGCTTCTGCAGCTGCAACCCTTTGGACAAAGTACCAAGAGAGGTTAAGGAAAGGCACGAT
GGCCGATGCTCAAGCTTCGTCGATTCCCGCGACCATGGGCACCGGCGGTCCTGCCGCTCC
TGAGCCGGTGCCGCAGTCGGAGCCGCTGAGCGAGGACCAGGTTCTCAACAACGCGGGCGG
TTTCGTCTTCAAGGTCGACGATTTCACGCTGCTGCGTCGATTCATCATTCTGGGCTCCGA
CGCCAACAACTACTACGTCTCGCGCAAGTCTGTGGACCTGGCGTCCGCCCAGTGCGTGGT
GCGACTGCTGGCGGCGGGGCAGGGCGAGGCGGTGGTGAAGGAGGTCGTCGACATCAGCCG
GGAGGGACGGGCGCCCAAGCAGGCCACCGGTATCGTGGTCCTGGCCATGTGCGCTCGCCT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000542A_C01 KCC000542A_c01
         (540 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_505638.1| RO (Ro) ribonucleoProtein, possibly an RNA qual...    87  1e-16
gb|AAH52380.1| Unknown (protein for IMAGE:5697399) [Mus musculus]      83  3e-15
gb|AAH51974.1| 60kD Ro/SSA autoantigen [Mus musculus]                  83  3e-15
ref|NP_038863.1| 60kD Ro/SSA autoantigen [Mus musculus] gi|12643...    83  3e-15
gb|AAL77518.1|L81154_1 ribonucleoprotein [Mus musculus]                83  3e-15

>ref|NP_505638.1| RO (Ro) ribonucleoProtein, possibly an RNA quality control
           checkpoint (72.8 kD) (rop-1) [Caenorhabditis elegans]
           gi|12643738|sp|Q27274|RO60_CAEEL 60-kDa SS-A/Ro
           ribonucleoprotein homolog gi|7511637|pir||T19225 Ro
           autoantigen 60K homolog - Caenorhabditis elegans
           gi|784872|gb|AAC41575.1| Ro ribonucleoprotein
           autoantigen gi|905359|gb|AAA96949.1| ribonucleoprotein
           Ro autoantigen homolog gi|3874263|emb|CAA98241.1| C.
           elegans ROP-1 protein (corresponding sequence C12D8.11)
           [Caenorhabditis elegans] gi|3880715|emb|CAA16325.1| C.
           elegans ROP-1 protein (corresponding sequence C12D8.11)
           [Caenorhabditis elegans] gi|1586552|prf||2204248A 60kD
           Ro autoantigen
          Length = 643

 Score = 87.0 bits (214), Expect = 1e-16
 Identities = 43/95 (45%), Positives = 62/95 (65%)
 Frame = +2

Query: 254 QSEPLSEDQVLNNAGGFVFKVDDFTLLRRFIILGSDANNYYVSRKSVDLASAQCVVRLLA 433
           Q E + + QV NNAGGFVF V D T +RRF+ILGSD  +Y+ S + + + +AQ +++++ 
Sbjct: 54  QMEKVKDGQVENNAGGFVFPVSDETQVRRFLILGSDKGSYHQSSEKITIDNAQRIIKIIE 113

Query: 434 AGQGEAVVKEVVDISREGRAPKQATGIVVLAMCAR 538
            G G  V+KE+  I+ E R PK    I  LA+CAR
Sbjct: 114 QGNGHMVLKELALINAENRNPKMNAMIFTLAICAR 148

>gb|AAH52380.1| Unknown (protein for IMAGE:5697399) [Mus musculus]
          Length = 547

 Score = 82.8 bits (203), Expect = 3e-15
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 254 QSEPLSEDQVLNNAGGFVFKVDDFTLLRRFIILGSDANNYYVSRKSVDLASAQCVVRLLA 433
           Q +PLSE QV+N+ GG V++V D   LRRF+  GS+   YY+  + + L +A+ ++RL+ 
Sbjct: 16  QLQPLSETQVVNSEGGCVWQVTDMNRLRRFLCFGSEGGTYYIKEQKLGLENAEALIRLIE 75

Query: 434 AGQGEAVVKEVVDISREGRAPKQATGIVVLAMCAR 538
            G+G  V++E+   S+EGR  KQ   +  LA+C++
Sbjct: 76  DGRGCEVIQEIKSFSQEGRTAKQEPLLFALAVCSQ 110

>gb|AAH51974.1| 60kD Ro/SSA autoantigen [Mus musculus]
          Length = 538

 Score = 82.8 bits (203), Expect = 3e-15
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 254 QSEPLSEDQVLNNAGGFVFKVDDFTLLRRFIILGSDANNYYVSRKSVDLASAQCVVRLLA 433
           Q +PLSE QV+N+ GG V++V D   LRRF+  GS+   YY+  + + L +A+ ++RL+ 
Sbjct: 7   QLQPLSETQVVNSEGGCVWQVTDMNRLRRFLCFGSEGGTYYIKEQKLGLENAEALIRLIE 66

Query: 434 AGQGEAVVKEVVDISREGRAPKQATGIVVLAMCAR 538
            G+G  V++E+   S+EGR  KQ   +  LA+C++
Sbjct: 67  DGRGCEVIQEIKSFSQEGRTAKQEPLLFALAVCSQ 101

>ref|NP_038863.1| 60kD Ro/SSA autoantigen [Mus musculus]
           gi|12643534|sp|O08848|RO60_MOUSE 60-kDa SS-A/Ro
           ribonucleoprotein (60 kDa Ro protein) (60 kDa
           ribonucleoprotein Ro) (RoRNP) gi|1946306|gb|AAC53142.1|
           Mus musculus 60kDa SS-A/Ro
          Length = 538

 Score = 82.8 bits (203), Expect = 3e-15
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 254 QSEPLSEDQVLNNAGGFVFKVDDFTLLRRFIILGSDANNYYVSRKSVDLASAQCVVRLLA 433
           Q +PLSE QV+N+ GG V++V D   LRRF+  GS+   YY+  + + L +A+ ++RL+ 
Sbjct: 7   QLQPLSETQVVNSEGGCVWQVTDMNRLRRFLCFGSEGGTYYIKEQKLGLENAEALIRLIE 66

Query: 434 AGQGEAVVKEVVDISREGRAPKQATGIVVLAMCAR 538
            G+G  V++E+   S+EGR  KQ   +  LA+C++
Sbjct: 67  DGRGCEVIQEIKSFSQEGRTAKQEPLLFALAVCSQ 101

>gb|AAL77518.1|L81154_1 ribonucleoprotein [Mus musculus]
          Length = 538

 Score = 82.8 bits (203), Expect = 3e-15
 Identities = 38/95 (40%), Positives = 62/95 (65%)
 Frame = +2

Query: 254 QSEPLSEDQVLNNAGGFVFKVDDFTLLRRFIILGSDANNYYVSRKSVDLASAQCVVRLLA 433
           Q +PLSE QV+N+ GG V++V D   LRRF+  GS+   YY+  + + L +A+ ++RL+ 
Sbjct: 7   QLQPLSETQVVNSEGGCVWQVTDMNRLRRFLCFGSEGGTYYIKEQKLGLENAEALIRLIE 66

Query: 434 AGQGEAVVKEVVDISREGRAPKQATGIVVLAMCAR 538
            G+G  V++E+   S+EGR  KQ   +  LA+C++
Sbjct: 67  DGRGCEVIQEIKSFSQEGRTAKQEPLLFALAVCSQ 101



EST assemble image


clone accession position
1 LCL080d04_r AV630534 1 496
2 LCL080g08_r AV630562 25 418
3 LCL086d04_r AV630921 25 405
4 LCL086e10_r AV630936 25 496
5 LCL020a06_r AV627027 25 378
6 LCL048e06_r AV628890 25 344
7 LCL089f01_r AV631154 25 447
8 LCL045b02_r AV628650 25 298
9 CL40c02_r AV395381 43 540
10 LCL088c01_r AV631058 44 424
11 LCL081g09_r AV630631 44 476
12 LCL025b11_r AV627334 160 422




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research