KCC000541A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000541A_C01 KCC000541A_c01
cagtagagctggtgtcgcaggccgggctcacgccgtgagcgctcagaatcgcgactgtca
ggcagatagtagaagcagcaGTGCAGGTGTAGAGCATTCATGCGCTTCTACTTATTTACG
TAGGGTTACCCAGCGGCAAGTGGGCCAAAAGGACCGCAATACTGTAAAGCGCGAACGACG
ACGTTTCGAGGCTCCTTAACGCCATCTTGCTTCATTAAGAAGGCAACACCCAACGAATCA
AGCCGGATTCCTTCCCCAGACGCCACGCCATGCGTGGCTCGGGGTCTCCCGCCCGCCACT
GGGTTCAGTGTGCGCTGGCATGTGCGGTGGCCCTCCTCTCCGCCCACAGCGCCTTCGCGG
GTCCACTAGCGGGCACGCAATTCCCCTTTGAACCGTGCCGGAAGACGCCCGGCAACAGCC
GATTCGACGTTTTCCTTAAAAACAACACGTACGACCCAAGCAGCCAGAGCAGACAAGTCT
GCGTCCAGTTTGAGGTGAAGCCAGCGGACGAGTGTGACCCCATGGGCAACCGGTGCTGCG
ACACCTACTTCACAAGTTCAAGTTCTATCCTGGCCCCAACTGCCGCCGCGCCATGAGCTC
GGTGAAGCTCCAGCTGAGCGATGGCAGCACGCAGACCCGCGGCTCCATCTACTACGAGGA
CTCGGGCGACAGGTTCATCGGAAAGATCACTACGTTGCCGTTCAACCTGCAGAATGCCAA
CGGGGCTGTGCTGTGCTGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000541A_C01 KCC000541A_c01
         (739 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAK31375.1|AC084329_1 ppg3 [Leishmania major]                       35  0.002
pir||T46707 proteophosphoglycan, membrane-associated [imported] ...    35  0.034
ref|NP_775604.1| subcommissural organ spondin; SCO-spondin [Mus ...    40  0.038
ref|XP_162416.2| SCO-spondin [Mus musculus]                            40  0.038
ref|XP_324183.1| hypothetical protein [Neurospora crassa] gi|289...    36  0.040

>gb|AAK31375.1|AC084329_1 ppg3 [Leishmania major]
          Length = 1325

 Score = 35.4 bits (80), Expect(2) = 0.002
 Identities = 29/141 (20%), Positives = 57/141 (39%)
 Frame = +1

Query: 130  PAASGPKGPQYCKARTTTFRGSLTPSCFIKKATPNESSRIPSPDATPCVARGLPPATGFS 309
            P+AS    P    +   +   S  PS      + + SS   S  + P  +    P++  S
Sbjct: 931  PSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 990

Query: 310  VRWHVRWPSSPPTAPSRVH*RARNSPLNRAGRRPATADSTFSLKTTRTTQAARADKSASS 489
                    S+P  + S     + ++P   +   P+++ S  S  ++    ++ +  SASS
Sbjct: 991  --------SAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS 1042

Query: 490  LR*SQRTSVTPWATGAATPTS 552
                  +S  P A+ ++ P+S
Sbjct: 1043 SSAPSSSSSAPSASSSSAPSS 1063

 Score = 32.7 bits (73), Expect = 6.1
 Identities = 39/154 (25%), Positives = 61/154 (39%), Gaps = 7/154 (4%)
 Frame = +1

Query: 130  PAASGPKGPQYCKARTTTFRGSLTPSCFIKKATPNESSRIPSPDAT--PCVARGLPPATG 303
            P+AS    P            S  PS     A  + SS  PS  ++  P  +   P A+ 
Sbjct: 962  PSASSSSAPS---------SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASS 1012

Query: 304  FSVRWHVRWPSSPPTAPSRVH*RARNSPLNRAGRRPATADSTFSLKTTRTTQAARADK-- 477
             S       PSS  +APS     A +S  +      ++A S+ S   + ++ +A +    
Sbjct: 1013 SSA------PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 1066

Query: 478  ---SASSLR*SQRTSVTPWATGAATPTSQVQVLS 570
               SASS      +S  P A+ ++ P+S    LS
Sbjct: 1067 SAPSASSSSAPSSSSSAPSASSSSAPSSSSSFLS 1100

 Score = 32.3 bits (72), Expect(2) = 0.087
 Identities = 28/141 (19%), Positives = 56/141 (38%)
 Frame = +1

Query: 130  PAASGPKGPQYCKARTTTFRGSLTPSCFIKKATPNESSRIPSPDATPCVARGLPPATGFS 309
            P+AS    P    +  +    S   S      + + SS   S  + P  +    P++  S
Sbjct: 746  PSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 805

Query: 310  VRWHVRWPSSPPTAPSRVH*RARNSPLNRAGRRPATADSTFSLKTTRTTQAARADKSASS 489
                    S+P  + S     + ++P   +   P+++ S  S  ++    ++ +  SASS
Sbjct: 806  --------SAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS 857

Query: 490  LR*SQRTSVTPWATGAATPTS 552
                  +S  P A+ ++ P+S
Sbjct: 858  SSAPSSSSSAPSASSSSAPSS 878

 Score = 31.6 bits (70), Expect(2) = 0.66
 Identities = 35/143 (24%), Positives = 60/143 (41%), Gaps = 2/143 (1%)
 Frame = +1

Query: 130  PAASGPKGPQYCKARTTTFRGSLTPSCFIKKATPNESSRIPSPDAT--PCVARGLPPATG 303
            P+AS    P            S  PS     A P+ SS  PS  ++  P  +   P A+ 
Sbjct: 823  PSASSSSAPS---------SSSSAPSASSSSA-PSSSSSAPSASSSSAPSSSSSAPSASS 872

Query: 304  FSVRWHVRWPSSPPTAPSRVH*RARNSPLNRAGRRPATADSTFSLKTTRTTQAARADKSA 483
             S       PSS  +APS     A +S  + A    +++  + S  +  +  ++ A  S+
Sbjct: 873  SSA------PSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSS 926

Query: 484  SSLR*SQRTSVTPWATGAATPTS 552
            SS   S  +S  P ++ ++ P++
Sbjct: 927  SSSAPSASSSSAPSSSSSSAPSA 949

 Score = 29.3 bits (64), Expect(2) = 0.14
 Identities = 30/117 (25%), Positives = 52/117 (43%), Gaps = 7/117 (5%)
 Frame = +1

Query: 223  ATPNESSRIPSPDAT--PCVARGLPPATGFSVRWHVRWPSSPPTAPSRVH*RARNSPLNR 396
            + P+ SS  PS  ++  P  +   P A+  S       PSS  +APS     A +S  + 
Sbjct: 692  SAPSSSSSAPSASSSSAPSSSSSAPSASSSSA------PSSSSSAPSASSSSAPSSSSSA 745

Query: 397  AGRRPATADSTFSLKTTRTTQAARADK-----SASSLR*SQRTSVTPWATGAATPTS 552
                 ++A S+ S   + ++ +A +       SASS      +S  P A+ ++ P+S
Sbjct: 746  PSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS 802

 Score = 29.3 bits (64), Expect(2) = 0.40
 Identities = 35/148 (23%), Positives = 61/148 (40%), Gaps = 8/148 (5%)
 Frame = +1

Query: 133  AASGPKGPQYCKARTTTFRGSLTPSCFIKKATPNESSRIPSPDAT--PCVARGLPPATGF 306
            A+S         + +     S  PS     A P+ SS  PS  ++  P  +   P A+  
Sbjct: 678  ASSSSSSAPSASSSSAPSSSSSAPSASSSSA-PSSSSSAPSASSSSAPSSSSSAPSASSS 736

Query: 307  SVRWHVRWPSSPPTAPSRVH*RARNSPLNRAGRRPATADSTFS------LKTTRTTQAAR 468
            S       PSS  +APS     A +S  +      ++A S+ S        ++  + ++ 
Sbjct: 737  SA------PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 790

Query: 469  ADKSASSLR*SQRTSVTPWATGAATPTS 552
            A  ++SS   S  +S  P A+ ++ P+S
Sbjct: 791  APSASSSSAPSSSSSSAPSASSSSAPSS 818

 Score = 28.9 bits (63), Expect(2) = 0.087
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = +3

Query: 555 SSSSILAPTAAAP*AR*SSS*AMAARRPAAPSTTRTRATGSSERS 689
           SSSS  AP+A++  A  SSS A +A   +APS++ + A  +S  S
Sbjct: 770 SSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSS 814

 Score = 28.9 bits (63), Expect(2) = 0.087
 Identities = 32/131 (24%), Positives = 53/131 (40%), Gaps = 1/131 (0%)
 Frame = +1

Query: 163 CKARTTTFRGSLTPSCFIKKATPNESSR-IPSPDATPCVARGLPPATGFSVRWHVRWPSS 339
           CK  T +   S  PS     A+ + SS    S  + P  +   P A+  S       PSS
Sbjct: 660 CKPETES--SSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSA------PSS 711

Query: 340 PPTAPSRVH*RARNSPLNRAGRRPATADSTFSLKTTRTTQAARADKSASSLR*SQRTSVT 519
             +APS             +   P+++ S  S  ++    ++ +  SASS      +S  
Sbjct: 712 SSSAPSA-----------SSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSA 760

Query: 520 PWATGAATPTS 552
           P A+ ++ P+S
Sbjct: 761 PSASSSSAPSS 771

 Score = 27.7 bits (60), Expect(2) = 0.14
 Identities = 18/42 (42%), Positives = 27/42 (63%)
 Frame = +3

Query: 555 SSSSILAPTAAAP*AR*SSS*AMAARRPAAPSTTRTRATGSS 680
           SSSS  AP+A++  A  SSS A +A   +APS++ +  + SS
Sbjct: 801 SSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS 842

 Score = 27.7 bits (60), Expect(2) = 0.002
 Identities = 18/41 (43%), Positives = 27/41 (64%)
 Frame = +3

Query: 555  SSSSILAPTAAAP*AR*SSS*AMAARRPAAPSTTRTRATGS 677
            SSSS  AP+A++  A  SSS A +A   +APS++ +  +GS
Sbjct: 1062 SSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSFLSGS 1102

 Score = 26.2 bits (56), Expect(2) = 0.40
 Identities = 17/41 (41%), Positives = 26/41 (62%)
 Frame = +3

Query: 558 SSSILAPTAAAP*AR*SSS*AMAARRPAAPSTTRTRATGSS 680
           SSS  AP+A++  A  SSS A +A   +APS++ +  + SS
Sbjct: 832 SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS 872

 Score = 25.4 bits (54), Expect(2) = 0.087
 Identities = 20/56 (35%), Positives = 28/56 (49%)
 Frame = +3

Query: 555  SSSSILAPTAAAP*AR*SSS*AMAARRPAAPSTTRTRATGSSERSLRCRSTCRMPT 722
            SSSS  AP+A       SSS A ++   +APS + + A  SS  S    S+   P+
Sbjct: 908  SSSSSSAPSA-------SSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS 956

 Score = 23.1 bits (48), Expect(2) = 0.66
 Identities = 17/46 (36%), Positives = 28/46 (59%)
 Frame = +3

Query: 552  TSSSSILAPTAAAP*AR*SSS*AMAARRPAAPSTTRTRATGSSERS 689
            +SSS+  A +++AP    SSS A +A   +APS++ + A  +S  S
Sbjct: 957  SSSSAPSASSSSAP---SSSSSAPSASSSSAPSSSSSSAPSASSSS 999

>pir||T46707 proteophosphoglycan, membrane-associated [imported] - Leishmania
           major (fragment) gi|5420389|emb|CAB46680.1|
           proteophosphoglycan [Leishmania major]
          Length = 383

 Score = 34.7 bits (78), Expect(2) = 0.034
 Identities = 35/143 (24%), Positives = 62/143 (42%), Gaps = 2/143 (1%)
 Frame = +1

Query: 130 PAASGPKGPQYCKARTTTFRGSLTPSCFIKKATPNESSRIPSPDAT--PCVARGLPPATG 303
           P++S    P    +   +   S  PS     A P+ SS  PS  ++  P  +   P A+ 
Sbjct: 49  PSSSSSSAPSASSSSAPSSSSSSAPSASSSSA-PSSSSSAPSASSSSAPSSSSSAPSASS 107

Query: 304 FSVRWHVRWPSSPPTAPSRVH*RARNSPLNRAGRRPATADSTFSLKTTRTTQAARADKSA 483
            S       PSS  +APS     A +S  +      ++A S+ S  +  +  ++ A  S+
Sbjct: 108 SSA------PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS-SSSSAPSASSSSAPSSS 160

Query: 484 SSLR*SQRTSVTPWATGAATPTS 552
           SS   S  +S  P ++ ++ P++
Sbjct: 161 SSSAPSASSSSAPSSSSSSAPSA 183

 Score = 32.7 bits (73), Expect(2) = 0.71
 Identities = 31/143 (21%), Positives = 60/143 (41%), Gaps = 2/143 (1%)
 Frame = +1

Query: 130 PAASGPKGPQYCKARTTTFRGSLTPSCFIKKATPNESSRIPSPDATPCVARGLPPATGFS 309
           P+AS    P    +   +   S  PS      + + SS   S  + P  +    P++  S
Sbjct: 57  PSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 116

Query: 310 V--RWHVRWPSSPPTAPSRVH*RARNSPLNRAGRRPATADSTFSLKTTRTTQAARADKSA 483
                    PSS  +APS     + ++P + +   P+ + S     +  ++ ++ A  ++
Sbjct: 117 APSASSSSAPSSSSSAPSA---SSSSAPSSSSSSAPSASSS-----SAPSSSSSSAPSAS 168

Query: 484 SSLR*SQRTSVTPWATGAATPTS 552
           SS   S  +S  P A+ ++ P+S
Sbjct: 169 SSSAPSSSSSSAPSASSSSAPSS 191

 Score = 32.7 bits (73), Expect = 6.1
 Identities = 35/147 (23%), Positives = 62/147 (41%), Gaps = 8/147 (5%)
 Frame = +1

Query: 136 ASGPKGPQYCKARTTTFRGSLTPSCFIKKATPNESSRIPSPDAT--PCVARGLPPATGFS 309
           +S    P    +   +   S  PS     A  + SS  PS  ++  P  +   P A+  S
Sbjct: 35  SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSS 94

Query: 310 VRWHVRWPSSPPTAPSRVH*RARNS----PLNRAGRRPATADS--TFSLKTTRTTQAARA 471
                  PSS  +APS     A +S    P   +   P+++ S  + S  +  ++ ++ A
Sbjct: 95  A------PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSA 148

Query: 472 DKSASSLR*SQRTSVTPWATGAATPTS 552
             ++SS   S  +S  P A+ ++ P+S
Sbjct: 149 PSASSSSAPSSSSSSAPSASSSSAPSS 175

 Score = 31.2 bits (69), Expect(2) = 0.20
 Identities = 27/141 (19%), Positives = 56/141 (39%)
 Frame = +1

Query: 130 PAASGPKGPQYCKARTTTFRGSLTPSCFIKKATPNESSRIPSPDATPCVARGLPPATGFS 309
           P+AS    P    +  +    S   S     +  + S+   S  + P  +    P++  S
Sbjct: 11  PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSS 70

Query: 310 VRWHVRWPSSPPTAPSRVH*RARNSPLNRAGRRPATADSTFSLKTTRTTQAARADKSASS 489
                   S+P  + S     + ++P   +   P+++ S  S  ++    ++ +  SASS
Sbjct: 71  --------SAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS 122

Query: 490 LR*SQRTSVTPWATGAATPTS 552
                 +S  P A+ ++ P+S
Sbjct: 123 SSAPSSSSSAPSASSSSAPSS 143

 Score = 25.4 bits (54), Expect(2) = 0.20
 Identities = 20/56 (35%), Positives = 28/56 (49%)
 Frame = +3

Query: 555 SSSSILAPTAAAP*AR*SSS*AMAARRPAAPSTTRTRATGSSERSLRCRSTCRMPT 722
           SSSS  AP+A       SSS A ++   +APS + + A  SS  S    S+   P+
Sbjct: 142 SSSSSSAPSA-------SSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS 190

 Score = 24.6 bits (52), Expect(2) = 0.034
 Identities = 17/51 (33%), Positives = 28/51 (54%)
 Frame = +3

Query: 555 SSSSILAPTAAAP*AR*SSS*AMAARRPAAPSTTRTRATGSSERSLRCRST 707
           S+SS  AP++++     SSS A ++   +APS + + A  SS  +    ST
Sbjct: 182 SASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSSSST 232

 Score = 21.9 bits (45), Expect(2) = 0.71
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +3

Query: 555 SSSSILAPTAAAP*AR*SSS*AMAARRPAAPSTTRTRAT 671
           S+SS  AP++++  A  +SS +  +   +APS++ T  T
Sbjct: 197 SASSSSAPSSSSSSAPSASSSSAPSSSSSAPSSSSTTTT 235

>ref|NP_775604.1| subcommissural organ spondin; SCO-spondin [Mus musculus]
            gi|27527438|emb|CAD42654.1| SCO-spondin [Mus musculus]
          Length = 4998

 Score = 40.0 bits (92), Expect = 0.038
 Identities = 20/57 (35%), Positives = 25/57 (43%)
 Frame = -2

Query: 543  CRSTGCPWGHTRPLASPQTGRRLVCSGCLGRTCCF*GKRRIGCCRASSGTVQRGIAC 373
            CR TGCP G       P  G    C+   G+  CF  + + G C    GT Q  +AC
Sbjct: 3528 CRETGCPAGRLYRECQPSDGCPFSCAHVTGQVACFSERCKEG-CHCPEGTFQHHVAC 3583

>ref|XP_162416.2| SCO-spondin [Mus musculus]
          Length = 3795

 Score = 40.0 bits (92), Expect = 0.038
 Identities = 20/57 (35%), Positives = 25/57 (43%)
 Frame = -2

Query: 543  CRSTGCPWGHTRPLASPQTGRRLVCSGCLGRTCCF*GKRRIGCCRASSGTVQRGIAC 373
            CR TGCP G       P  G    C+   G+  CF  + + G C    GT Q  +AC
Sbjct: 2325 CRETGCPAGRLYRECQPSDGCPFSCAHVTGQVACFSERCKEG-CHCPEGTFQHHVAC 2380

>ref|XP_324183.1| hypothetical protein [Neurospora crassa] gi|28921875|gb|EAA31149.1|
           hypothetical protein [Neurospora crassa]
          Length = 1422

 Score = 35.8 bits (81), Expect(2) = 0.040
 Identities = 36/148 (24%), Positives = 58/148 (38%), Gaps = 1/148 (0%)
 Frame = +1

Query: 130 PAASGPKGPQYCKARTTT-FRGSLTPSCFIKKATPNESSRIPSPDATPCVARGLPPATGF 306
           P  + PK P     RTTT   G+   +   +++    +S    P A+          T  
Sbjct: 85  PKTASPKSPTTAAKRTTTGTTGTTGTTATARRSATGTTSTATKPTASSATRTSTTTGTAT 144

Query: 307 SVRWHVRWPSSPPTAPSRVH*RARNSPLNRAGRRPATADSTFSLKTTRTTQAARADKSAS 486
           S       P+S  +AP                +RP TA ST +   +  T+ + ++  + 
Sbjct: 145 SKTTR---PASISSAP----------------KRPTTAASTTT--ASHRTRPSSSEIDSK 183

Query: 487 SLR*SQRTSVTPWATGAATPTSQVQVLS 570
           S   S+RTS  P +TGA+      +V S
Sbjct: 184 STTASRRTSAVPSSTGASPTKPSARVSS 211

 Score = 23.1 bits (48), Expect(2) = 0.040
 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 2/27 (7%)
 Frame = +3

Query: 606 SSS*AMAARRPAAPSTT--RTRATGSS 680
           +SS   AAR+PA+ ST   RT  TG S
Sbjct: 213 TSSTTAAARKPASSSTVSPRTSTTGVS 239



EST assemble image


clone accession position
1 CL39h12_r AV395212 1 516
2 HCL093g04_r AV644785 329 739




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research