KCC000540A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000540A_C01 KCC000540A_c01
gtgaaTTTGTCGCGTACCATAGAATAGCCAGCCATGGGTCTGATTCGCAACATCGCGACC
TTTGCGACCGCTGTTGTCGGGTGGAGCGTCGGTATCCCCTTCGTTGTCCAGGCGCGGATG
AACGGCTACGTTGAGCGCAACCTTGCCACCTACGACGCAGCACAACGACAAAAGGCCGAG
GAGGCGGCTATCGGCGGCCCTATCACGTCTAGCGGAGGTCATCACTGAGGCGAGCGATGT
TCGCTAGAGAGAGTCGCTAGCGAGCGGAAGTGAGGGGCTCTGGCTGTGTATGGGAGGCTT
GCGAGTAGAGGGAGCTGGTGTTCACTAGTGGGGAGGCAGGGAGGAGCGGCTTAGCGTGTC
AGGTCGTGCCGTAGTGTGTTTTTTTTTGGCACGCGGTCACGCAAGGGGCAGGGGACAAGA
ACTGGGTAGGAATGGTAGAGCTTACACGGTGTGCTGTGGTTGTAGATGTTGTGTGAATCC
GATGAAGGCAGGACTCTTTTTCCGAATG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000540A_C01 KCC000540A_c01
         (508 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_323817.1| predicted protein [Neurospora crassa] gi|289181...    35  0.41
emb|CAD11404.1| hypothetical protein [Neurospora crassa]               34  0.92
ref|XP_323510.1| hypothetical protein [Neurospora crassa] gi|289...    34  0.92
dbj|BAC98592.1| hypothetical protein [Oryza sativa (japonica cul...    34  1.2
ref|NP_189083.1| protein kinase -related [Arabidopsis thaliana]        34  1.2

>ref|XP_323817.1| predicted protein [Neurospora crassa] gi|28918117|gb|EAA27797.1|
           predicted protein [Neurospora crassa]
          Length = 717

 Score = 35.4 bits (80), Expect = 0.41
 Identities = 29/91 (31%), Positives = 42/91 (45%), Gaps = 4/91 (4%)
 Frame = -3

Query: 488 PSSDSHNIYNHSTPCKLYHSYPVLVPCPLR--DRVPKKNTLRHDLTR*AAPPCLPTSEH- 318
           P   SH  ++ S P    H+   L   PL    R P  ++LR+  +R ++PP  PT  H 
Sbjct: 325 PKPSSHASHSSSKPSIRSHTSRRLDLNPLSPGSRAPSHHSLRYAASRHSSPPQSPTRSHH 384

Query: 317 -QLPLLASLPYTARAPHFRSLATLSSEHRSP 228
            Q+P   S P      + RS +  +S H SP
Sbjct: 385 SQIP---SSPNRHSRSYSRSHSNPTSRHSSP 412

>emb|CAD11404.1| hypothetical protein [Neurospora crassa]
          Length = 2117

 Score = 34.3 bits (77), Expect = 0.92
 Identities = 38/123 (30%), Positives = 47/123 (37%)
 Frame = -1

Query: 469  TSTTTAHRVSSTIPTQFLSPAPCVTACQKKTHYGTT*HAKPLLPASPLVNTSSLYSQASH 290
            TSTTTA  V+ST       PAP  T     T   TT     L   S    T++  +  + 
Sbjct: 1757 TSTTTAAAVTST------DPAPVTTTTTTATS-STTNTTPVLFTTSTTTTTAAAVATTAP 1809

Query: 289  TQPEPLTSAR*RLSLANIARLSDDLR*T**GRR*PPPRPFVVVLRRRWQGCAQRSRSSAP 110
            TQ     +     S  NIA  S             P  P VV     +QGCA  S ++AP
Sbjct: 1810 TQATTTIATAATTSTTNIASAS-------------PTIPAVV--NWDYQGCASDSNTAAP 1854

Query: 109  GQR 101
              R
Sbjct: 1855 TAR 1857

>ref|XP_323510.1| hypothetical protein [Neurospora crassa] gi|28922247|gb|EAA31492.1|
            hypothetical protein [Neurospora crassa]
          Length = 2076

 Score = 34.3 bits (77), Expect = 0.92
 Identities = 38/123 (30%), Positives = 47/123 (37%)
 Frame = -1

Query: 469  TSTTTAHRVSSTIPTQFLSPAPCVTACQKKTHYGTT*HAKPLLPASPLVNTSSLYSQASH 290
            TSTTTA  V+ST       PAP  T     T   TT     L   S    T++  +  + 
Sbjct: 1716 TSTTTAAAVTST------DPAPVTTTTTTATS-STTNTTPVLFTTSTTTTTAAAVATTAP 1768

Query: 289  TQPEPLTSAR*RLSLANIARLSDDLR*T**GRR*PPPRPFVVVLRRRWQGCAQRSRSSAP 110
            TQ     +     S  NIA  S             P  P VV     +QGCA  S ++AP
Sbjct: 1769 TQATTTIATAATTSTTNIASAS-------------PTIPAVV--NWDYQGCASDSNTAAP 1813

Query: 109  GQR 101
              R
Sbjct: 1814 TAR 1816

>dbj|BAC98592.1| hypothetical protein [Oryza sativa (japonica cultivar-group)]
          Length = 193

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 21/71 (29%), Positives = 31/71 (43%)
 Frame = +2

Query: 74  LSGGASVSPSLSRRG*TATLSATLPPTTQHNDKRPRRRLSAALSRLAEVITEASDVR*RE 253
           ++  AS    + RRG T T S   PP T+  D+  RRR+     R +    +A     R+
Sbjct: 56  VASAASPPERIWRRGGTTTASTAGPPLTRARDEEKRRRIKEKEERASAAFVDAG----RD 111

Query: 254 SLASGSEGLWL 286
            +   S   WL
Sbjct: 112 RMPRSSGPFWL 122

>ref|NP_189083.1| protein kinase -related [Arabidopsis thaliana]
          Length = 694

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 21/58 (36%), Positives = 25/58 (42%)
 Frame = -2

Query: 438 LPFLPSSCPLPLA*PRAKKKHTTARPDTLSRSSLPPH**TPAPSTRKPPIHSQSPSLP 265
           LP  P   PLP+  P        A P     ++LPP    P P T  PPI   +PS P
Sbjct: 18  LPIPPPPQPLPVTPPPPPTALPPALPPPPPPTALPPALPPPPPPTTVPPIPPSTPSPP 75



EST assemble image


clone accession position
1 MX245h08_r BP091901 1 509
2 CL49f02_r AV397764 2 503
3 CL39h11_r AV395218 31 408




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research