KCC000539A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000539A_C01 KCC000539A_c01
gtcgtcgccaattgtgtgtacgtttgtctttGCTAAAATACCAGCTATCTTCAAAGACAG
CGGCTTCACACTTTGTGAACCCAAACTACAGTAAACAAACCCGTCCTACACAGCCGGCTC
TATTTTGACGCATATTATTGGACGTTACTATCTTGTCGAAGTTTCAGGCAGACCGCTGCC
TTCCCTGAGGCTTTTGGGGGCTTGAAAAGTTCGCCTGACTCTGCGAAGCCGGTGGAGTAT
GCGGCAAGGCTATCTGCTAGTAGCCCTTGTGGCCACAGCGCTGCTGGTGGGGTGCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000539A_C01 KCC000539A_c01
         (296 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAF87691.1| X protein [Hepatitis B virus]                           32  2.5
gb|AAN62911.1| variable region-containing chitin-binding protein...    31  4.2
ref|NP_746933.1| precorrin-8X methylmutase [Pseudomonas putida K...    30  9.3

>gb|AAF87691.1| X protein [Hepatitis B virus]
          Length = 154

 Score = 32.0 bits (71), Expect = 2.5
 Identities = 18/38 (47%), Positives = 20/38 (52%), Gaps = 2/38 (5%)
 Frame = +1

Query: 181 FPEAFGGLKSSPDSAKPVEYAARLSASS--PCGHSAAG 288
           F    GGL SSP SA P +Y A LS      C  S+AG
Sbjct: 30  FSGPLGGLPSSPPSALPTDYGAHLSLRGLPVCAFSSAG 67

>gb|AAN62911.1| variable region-containing chitin-binding protein 5 [Branchiostoma
           floridae]
          Length = 356

 Score = 31.2 bits (69), Expect = 4.2
 Identities = 14/46 (30%), Positives = 26/46 (56%)
 Frame = -1

Query: 293 TPPAALWPQGLLADSLAAYSTGFAESGELFKPPKASGKAAVCLKLR 156
           TPP   W +G+ AD+       ++ SGE++  P+ +G+ +V  + R
Sbjct: 65  TPPTITWLKGVFADADRQVVYKWSSSGEVYVHPEFAGRVSVQSRTR 110

>ref|NP_746933.1| precorrin-8X methylmutase [Pseudomonas putida KT2440]
           gi|24986589|gb|AAN70397.1|AE016681_6 precorrin-8X
           methylmutase [Pseudomonas putida KT2440]
          Length = 208

 Score = 30.0 bits (66), Expect = 9.3
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 7/68 (10%)
 Frame = +2

Query: 11  IVCTFVFAKIPAIFKDSGFTLCEPKLQ*TNPSYTAGSILTHIIGR-----YYLVEV--SG 169
           ++CT     +P + KD+G T     L+   P Y  GS++  +IG      +YL+E+  +G
Sbjct: 94  VICTLRDPSVPGLAKDAGNTRSAVALELWRP-YLEGSVV--VIGNAPTALFYLLEMLDAG 150

Query: 170 RPLPSLRL 193
            P P+L L
Sbjct: 151 APKPALIL 158

  Database: nr
    Posted date:  Oct 14, 2003 12:26 AM
  Number of letters in database: 498,525,298
  Number of sequences in database:  1,537,769
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 294,868,701
Number of Sequences: 1537769
Number of extensions: 5706659
Number of successful extensions: 15012
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 14655
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15005
length of database: 498,525,298
effective HSP length: 74
effective length of database: 384,730,392
effective search space used: 9233529408
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)


EST assemble image


clone accession position
1 LCL061a06_r AV629561 1 292
2 LCL075h10_r AV630239 32 258
3 LCL058e03_r AV629422 33 293
4 MXL045f02_r BP095672 42 290
5 LCL087d09_r AV630998 49 293
6 CL39f12_r AV395211 50 296
7 HCL040c06_r AV641788 50 294
8 MXL098f05_r BP098759 81 295
9 HCL043e03_r AV641986 114 294




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research