KCC000538A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000538A_C01 KCC000538A_c01
GACGAGTGTCCAGCTAGGAGGAGCGTATCCACACATTACATTTAGGTCTTAAGAGTAGGC
AAAATGGCTTACCAGAGTGGTCAGTATGTCCCTCCGCATCTCCGGGGTATGGCTATGGGG
GCGCCTCCTCCCCCGCCTCCGGGTGGTCCGGGGCCTGTGATGGGCGGCTACGGCGGCTTC
CCTGTCGCCGGCGCGGGCGCGGCTGTTCCGGGTGCTGCACCTTTTGGCGATGATCGCGGT
CCTCGCGGCGGCTATGGCGGGGGCTATGGTGCTCCTCGCGGTGGCTATGGCCGGTGGTGG
CTACGGTGGTGGTGGTCGTGGTGGCTTTGGTGGCGAGCGCGGTGGCTACGCGGGCCGCGG
TGGTGCTGGTCGCGGCGAGGGAGGCATCGGCTTCAACCGGCCCTATGACGATCCTTTCAA
GAAGGCTGAGGCGGAAAAGGCGGAGATCGATGCGCTCTACGGCGCTGAGAACACGGGTAT
TAACTTCGAGGCTTATGAGGATATTCCCGTGGAGACCAGCGGCAAGGACGTGCCGCCGCC
GGTGCACAGCTTCGAGGACCTCCAGCTGCCTGCGTGCATGATGGAGAACATCAAGCGCTG
CAAGTTCACCAAGCCCACGCCCGTGCAGAAGCACTCGATTACCATTGGTCTGGCTGGTCG
CGACCTGATGGCTTGCGCCCAGACCGGCTCGGGCAAGACCGCCGCGTTCTGCTTCCCCAT
CATCGCGTCCATGCTCATGAAGGGCTACCAGCCCGCGGCCGGCCGCAACAGCCGCAAGGC
GCTGCCTGGCGCCCTGGTGCTGGCTCCCACCCGTGAGCTGACCAGCCAGATTTACGACGA
GGCCCGCAAGTTCACGTACATGACGGGCCTGCGCCCCGTGGTCATCTATGGTGGCGCCCC
CGCGCCCAACCAGCTGCGTGACCTGGAGCGCGGCTGCGACATCCTGGTCGCCACGCCCGG
CCGCCTGAGCGACTTCATTGAGCGCGGCCGCGTGGGCCTGTCCTCCATCGTGTTCCTGTG
CCTGGACGAGGCGGACCGCATGCTGGACATGGGCTTCGAGCCCCAGATCCGCCGCATCGT
GGAGCAGGAGGACATGCCGCCCGTGGGCCACCGCCAGACGCTGATGTTCAGCGCCACCTT
CCCCAAGGAGATCCAGCGCCTGGCCTCCGACTTCCTGGCCAACTACGTCTTCCTGACGGT
GGGCCGCGTGGGCTCCTCCACCGACCTGATCGTGCAGC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000538A_C01 KCC000538A_c01
         (1238 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAC83834.1| putative DEAD-box RNA helicase DEAD3(i|6753620) ...   408  e-112
ref|NP_181780.1| DEAD box RNA helicase, putative [Arabidopsis th...   380  e-104
gb|AAO42134.1| putative DEAD/DEAH box RNA helicase [Arabidopsis ...   379  e-104
ref|NP_567067.1| DEAD box RNA helicase, putative [Arabidopsis th...   378  e-103
pir||T45671 ATP-dependent RNA helicase-like protein - Arabidopsi...   378  e-103

>dbj|BAC83834.1| putative DEAD-box RNA helicase DEAD3(i|6753620) [Oryza sativa
            (japonica cultivar-group)]
          Length = 638

 Score =  408 bits (1048), Expect = e-112
 Identities = 228/389 (58%), Positives = 270/389 (68%), Gaps = 31/389 (7%)
 Frame = +2

Query: 164  AATAASLSPARARLFRVL----HLLAMIAVLAAAMAGAMVLLAVA---------MAGG-- 298
            +A AA+ +   +RL R      HL    A  A A AGA+   A A         + GG  
Sbjct: 15   SAPAAAANHGNSRLPRSSYVPPHLRGQAAPAAPAQAGALPSAAAAAQPSVGQPGVVGGPR 74

Query: 299  ------GYGGGGRGGFGGERGGYA--GRGGAGRGEGGIGFNRP--------YDDPFKKAE 430
                  G GGGG G  GG R G+   GRGG G G GG   +RP          DPF  +E
Sbjct: 75   WAGIVNGGGGGGGGSVGGSRQGFGAGGRGGGGGGGGGAWNSRPGGWDRRDREPDPFANSE 134

Query: 431  AEKAEIDALYGAENTGINFEAYEDIPVETSGKDVPPPVHSFEDLQLPACMMENIKRCKFT 610
            A  AE+D  +  ENTGINFEAYEDIPVETSG DVPPP ++F ++ L   + ENI+RCK+ 
Sbjct: 135  A--AEVD--FEGENTGINFEAYEDIPVETSGHDVPPPANTFAEIDLGDALNENIRRCKYV 190

Query: 611  KPTPVQKHSITIGLAGRDLMACAQTGSGKTAAFCFPIIASMLMKGYQPAAGRNSRKALPG 790
            KPTPVQ+++I I +AGRDLMACAQTGSGKTAAFCFPII+  +M+   P   R SR A P 
Sbjct: 191  KPTPVQRYAIPISIAGRDLMACAQTGSGKTAAFCFPIISG-IMRSRPPPRSRGSRTAYPL 249

Query: 791  ALVLAPTRELTSQIYDEARKFTYMTGLRPVVIYGGAPAPNQLRDLERGCDILVATPGRLS 970
            AL+L+PTREL+ QI++EARKF Y TG++ VV YGGAP   QLR+LERG +ILVATPGRL 
Sbjct: 250  ALILSPTRELSVQIHEEARKFAYQTGVKVVVAYGGAPITQQLRELERGVEILVATPGRLM 309

Query: 971  DFIERGRVGLSSIVFLCLDEADRMLDMGFEPQIRRIVEQEDMPPVGHRQTLMFSATFPKE 1150
            D +ER RV L  I +L LDEADRMLDMGFEPQIR+IVEQ DMPP G RQT++FSATFPKE
Sbjct: 310  DLLERARVSLQMIKYLALDEADRMLDMGFEPQIRKIVEQMDMPPRGERQTMLFSATFPKE 369

Query: 1151 IQRLASDFLANYVFLTVGRVGSSTDLIVQ 1237
            IQR+ASDFLA+Y+FL VGRVGSSTDLIVQ
Sbjct: 370  IQRMASDFLADYIFLAVGRVGSSTDLIVQ 398

 Score = 44.7 bits (104), Expect(2) = 2e-04
 Identities = 25/46 (54%), Positives = 28/46 (60%), Gaps = 7/46 (15%)
 Frame = +2

Query: 293 GGGYGGGGRGGFGGERGGYAGRGGAG-------RGEGGIGFNRPYD 409
           GGGYGGGG GG+GG  GGY G GG G        G GG GF+  +D
Sbjct: 596 GGGYGGGG-GGYGG--GGYGGGGGGGGYGGGSSYGGGGQGFSSAWD 638

 Score = 42.0 bits (97), Expect = 0.022
 Identities = 29/78 (37%), Positives = 30/78 (38%)
 Frame = +1

Query: 58  GKMAYQSGQYVPPHLRGMAMGAPPPPPPGGPGPVMGGYGGFPVAGAGAAVPGAAPFGDDR 237
           G        YVPPHLRG A  AP  P   G  P        P  G    V G    G   
Sbjct: 24  GNSRLPRSSYVPPHLRGQA--APAAPAQAGALP-SAAAAAQPSVGQPGVVGGPRWAGIVN 80

Query: 238 GPRGGYGGGYGAPRGGYG 291
           G  GG GG  G  R G+G
Sbjct: 81  GGGGGGGGSVGGSRQGFG 98

 Score = 36.6 bits (83), Expect = 0.93
 Identities = 18/34 (52%), Positives = 19/34 (54%), Gaps = 1/34 (2%)
 Frame = +2

Query: 308 GGGRGGFGGERGGYAGRG-GAGRGEGGIGFNRPY 406
           G G GG+GG  GGY G G G G G GG G    Y
Sbjct: 593 GSGGGGYGGGGGGYGGGGYGGGGGGGGYGGGSSY 626

 Score = 23.9 bits (50), Expect(2) = 2e-04
 Identities = 16/48 (33%), Positives = 21/48 (43%)
 Frame = +3

Query: 69  LPEWSVCPSASPGYGYGGASSPASGWSGACDGRLRRLPCRRRGRGCSG 212
           +P+W    +A   +G GG  +  SG      GR  R   R RG G  G
Sbjct: 554 VPQWLERYAARSSFGGGGGRNRRSGGGARFGGRDFR---RDRGSGGGG 598

>ref|NP_181780.1| DEAD box RNA helicase, putative [Arabidopsis thaliana]
            gi|25290840|pir||H84854 probable ATP-dependent RNA
            helicase [imported] - Arabidopsis thaliana
            gi|4559339|gb|AAD23001.1| putative ATP-dependent RNA
            helicase [Arabidopsis thaliana]
          Length = 633

 Score =  380 bits (975), Expect = e-104
 Identities = 200/326 (61%), Positives = 240/326 (73%), Gaps = 8/326 (2%)
 Frame = +2

Query: 284  AMAGGGYGGGGRGGFGGERG------GYAGRGGAGRGEGGIGFNRPYDD--PFKKAEAEK 439
            A  G G G GG GG+  + G      GY GRGG G      G++R   +  PF+  ++E 
Sbjct: 66   APGGSGVGVGGGGGYRADAGRPGSGSGYGGRGGGGWNNRSGGWDRREREVNPFENDDSEP 125

Query: 440  AEIDALYGAENTGINFEAYEDIPVETSGKDVPPPVHSFEDLQLPACMMENIKRCKFTKPT 619
                A    +NT INF+AYEDIP+ETSG +VPPPV++F ++ L   +  NI+RCK+ KPT
Sbjct: 126  EP--AFTEQDNTVINFDAYEDIPIETSGDNVPPPVNTFAEIDLGEALNLNIRRCKYVKPT 183

Query: 620  PVQKHSITIGLAGRDLMACAQTGSGKTAAFCFPIIASMLMKGYQPAAGRNSRKALPGALV 799
            PVQ+H+I I L GRDLMACAQTGSGKTAAFCFPII+  +MK       R SR   P A++
Sbjct: 184  PVQRHAIPILLEGRDLMACAQTGSGKTAAFCFPIISG-IMKDQHVQRPRGSRTVYPLAVI 242

Query: 800  LAPTRELTSQIYDEARKFTYMTGLRPVVIYGGAPAPNQLRDLERGCDILVATPGRLSDFI 979
            L+PTREL SQI+DEA+KF+Y TG++ VV YGG P   QLR+LERG DILVATPGRL+D +
Sbjct: 243  LSPTRELASQIHDEAKKFSYQTGVKVVVAYGGTPINQQLRELERGVDILVATPGRLNDLL 302

Query: 980  ERGRVGLSSIVFLCLDEADRMLDMGFEPQIRRIVEQEDMPPVGHRQTLMFSATFPKEIQR 1159
            ER RV +  I FL LDEADRMLDMGFEPQIR+IVEQ DMPP G RQTL+FSATFP+EIQR
Sbjct: 303  ERARVSMQMIRFLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTLLFSATFPREIQR 362

Query: 1160 LASDFLANYVFLTVGRVGSSTDLIVQ 1237
            LA+DFLANY+FL VGRVGSSTDLIVQ
Sbjct: 363  LAADFLANYIFLAVGRVGSSTDLIVQ 388

 Score = 41.6 bits (96), Expect = 0.029
 Identities = 21/31 (67%), Positives = 22/31 (70%)
 Frame = +2

Query: 293 GGGYGGGGRGGFGGERGGYAGRGGAGRGEGG 385
           GGGYGGG  GG+GG  GGY G GG G G GG
Sbjct: 591 GGGYGGG--GGYGG-GGGYGGGGGYGGGYGG 618

 Score = 40.4 bits (93), Expect = 0.065
 Identities = 25/51 (49%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +1

Query: 142 GGPGPVMGGYGGFPVAGAGAAVPGAAPFGDDRGPRGGYGGGY-GAPRGGYG 291
           G  G   GGYGG    G G    G    G   G  GGYGGGY GA  GGYG
Sbjct: 578 GSFGSGRGGYGG---GGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYG 625

 Score = 40.0 bits (92), Expect = 0.085
 Identities = 22/32 (68%), Positives = 23/32 (71%)
 Frame = +2

Query: 296 GGYGGGGRGGFGGERGGYAGRGGAGRGEGGIG 391
           GGYGGGG GG+GG  GGY G GG G G GG G
Sbjct: 585 GGYGGGG-GGYGG-GGGYGGGGGYG-GGGGYG 613

 Score = 39.3 bits (90), Expect = 0.14
 Identities = 31/89 (34%), Positives = 37/89 (40%), Gaps = 19/89 (21%)
 Frame = +1

Query: 85  YVPPHLRGMAMGAPPPPP-------------------PGGPGPVMGGYGGFPVAGAGAAV 207
           YVPPHLR     + P  P                   PGG G  +GG GG+    A A  
Sbjct: 30  YVPPHLRNRPAASEPVAPLPANDRVGYGGPPSGSRWAPGGSGVGVGGGGGYR---ADAGR 86

Query: 208 PGAAPFGDDRGPRGGYGGGYGAPRGGYGR 294
           PG+   G   G RGG  GG+    GG+ R
Sbjct: 87  PGS---GSGYGGRGG--GGWNNRSGGWDR 110

 Score = 38.9 bits (89), Expect = 0.19
 Identities = 19/31 (61%), Positives = 20/31 (64%)
 Frame = +2

Query: 299 GYGGGGRGGFGGERGGYAGRGGAGRGEGGIG 391
           G  G GRGG+GG  GGY G GG G G GG G
Sbjct: 578 GSFGSGRGGYGGGGGGYGGGGGYG-GGGGYG 607

 Score = 37.7 bits (86), Expect = 0.42
 Identities = 18/29 (62%), Positives = 18/29 (62%), Gaps = 1/29 (3%)
 Frame = +2

Query: 293 GGGYGGGGR-GGFGGERGGYAGRGGAGRG 376
           GGGYGGGG  GG GG  GGY G    G G
Sbjct: 597 GGGYGGGGGYGGGGGYGGGYGGASSGGYG 625

 Score = 35.8 bits (81), Expect = 1.6
 Identities = 18/37 (48%), Positives = 20/37 (53%), Gaps = 3/37 (8%)
 Frame = +2

Query: 290 AGGGYGGGG---RGGFGGERGGYAGRGGAGRGEGGIG 391
           +GG +GG      G FG  RGGY G GG   G GG G
Sbjct: 565 SGGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYG 601

>gb|AAO42134.1| putative DEAD/DEAH box RNA helicase [Arabidopsis thaliana]
          Length = 633

 Score =  379 bits (972), Expect = e-104
 Identities = 199/326 (61%), Positives = 240/326 (73%), Gaps = 8/326 (2%)
 Frame = +2

Query: 284  AMAGGGYGGGGRGGFGGERG------GYAGRGGAGRGEGGIGFNRPYDD--PFKKAEAEK 439
            A  G G G GG GG+  + G      GY GRGG G      G++R   +  PF+  ++E 
Sbjct: 66   APGGSGVGVGGGGGYRADAGRPGSGSGYGGRGGGGWNNRSGGWDRREREVNPFENDDSEP 125

Query: 440  AEIDALYGAENTGINFEAYEDIPVETSGKDVPPPVHSFEDLQLPACMMENIKRCKFTKPT 619
                A    +NT INF+AYEDIP+ETSG +VPPPV++F ++ L   +  NI+RCK+ KPT
Sbjct: 126  EP--AFTEQDNTVINFDAYEDIPIETSGDNVPPPVNTFAEIDLGEALNLNIRRCKYVKPT 183

Query: 620  PVQKHSITIGLAGRDLMACAQTGSGKTAAFCFPIIASMLMKGYQPAAGRNSRKALPGALV 799
            PVQ+H+I I L GRDLMACAQTGSGKTAAFCFPII+  +MK       R SR   P A++
Sbjct: 184  PVQRHAIPILLEGRDLMACAQTGSGKTAAFCFPIISG-IMKDQHVQRPRGSRTVYPLAVI 242

Query: 800  LAPTRELTSQIYDEARKFTYMTGLRPVVIYGGAPAPNQLRDLERGCDILVATPGRLSDFI 979
            L+PTREL SQI+DEA++F+Y TG++ VV YGG P   QLR+LERG DILVATPGRL+D +
Sbjct: 243  LSPTRELASQIHDEAKRFSYQTGVKVVVAYGGTPINQQLRELERGVDILVATPGRLNDLL 302

Query: 980  ERGRVGLSSIVFLCLDEADRMLDMGFEPQIRRIVEQEDMPPVGHRQTLMFSATFPKEIQR 1159
            ER RV +  I FL LDEADRMLDMGFEPQIR+IVEQ DMPP G RQTL+FSATFP+EIQR
Sbjct: 303  ERARVSMQMIRFLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTLLFSATFPREIQR 362

Query: 1160 LASDFLANYVFLTVGRVGSSTDLIVQ 1237
            LA+DFLANY+FL VGRVGSSTDLIVQ
Sbjct: 363  LAADFLANYIFLAVGRVGSSTDLIVQ 388

 Score = 41.6 bits (96), Expect = 0.029
 Identities = 21/31 (67%), Positives = 22/31 (70%)
 Frame = +2

Query: 293 GGGYGGGGRGGFGGERGGYAGRGGAGRGEGG 385
           GGGYGGG  GG+GG  GGY G GG G G GG
Sbjct: 591 GGGYGGG--GGYGG-GGGYGGGGGYGGGYGG 618

 Score = 40.4 bits (93), Expect = 0.065
 Identities = 25/51 (49%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +1

Query: 142 GGPGPVMGGYGGFPVAGAGAAVPGAAPFGDDRGPRGGYGGGY-GAPRGGYG 291
           G  G   GGYGG    G G    G    G   G  GGYGGGY GA  GGYG
Sbjct: 578 GSFGSGRGGYGG---GGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYG 625

 Score = 40.0 bits (92), Expect = 0.085
 Identities = 22/32 (68%), Positives = 23/32 (71%)
 Frame = +2

Query: 296 GGYGGGGRGGFGGERGGYAGRGGAGRGEGGIG 391
           GGYGGGG GG+GG  GGY G GG G G GG G
Sbjct: 585 GGYGGGG-GGYGG-GGGYGGGGGYG-GGGGYG 613

 Score = 39.3 bits (90), Expect = 0.14
 Identities = 31/89 (34%), Positives = 37/89 (40%), Gaps = 19/89 (21%)
 Frame = +1

Query: 85  YVPPHLRGMAMGAPPPPP-------------------PGGPGPVMGGYGGFPVAGAGAAV 207
           YVPPHLR     + P  P                   PGG G  +GG GG+    A A  
Sbjct: 30  YVPPHLRNRPAASEPVAPLPANDRVGYGGPPSGSRWAPGGSGVGVGGGGGYR---ADAGR 86

Query: 208 PGAAPFGDDRGPRGGYGGGYGAPRGGYGR 294
           PG+   G   G RGG  GG+    GG+ R
Sbjct: 87  PGS---GSGYGGRGG--GGWNNRSGGWDR 110

 Score = 38.9 bits (89), Expect = 0.19
 Identities = 19/31 (61%), Positives = 20/31 (64%)
 Frame = +2

Query: 299 GYGGGGRGGFGGERGGYAGRGGAGRGEGGIG 391
           G  G GRGG+GG  GGY G GG G G GG G
Sbjct: 578 GSFGSGRGGYGGGGGGYGGGGGYG-GGGGYG 607

 Score = 37.7 bits (86), Expect = 0.42
 Identities = 18/29 (62%), Positives = 18/29 (62%), Gaps = 1/29 (3%)
 Frame = +2

Query: 293 GGGYGGGGR-GGFGGERGGYAGRGGAGRG 376
           GGGYGGGG  GG GG  GGY G    G G
Sbjct: 597 GGGYGGGGGYGGGGGYGGGYGGASSGGYG 625

 Score = 35.8 bits (81), Expect = 1.6
 Identities = 18/37 (48%), Positives = 20/37 (53%), Gaps = 3/37 (8%)
 Frame = +2

Query: 290 AGGGYGGGG---RGGFGGERGGYAGRGGAGRGEGGIG 391
           +GG +GG      G FG  RGGY G GG   G GG G
Sbjct: 565 SGGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYG 601

>ref|NP_567067.1| DEAD box RNA helicase, putative [Arabidopsis thaliana]
            gi|21593670|gb|AAM65637.1| ATP-dependent RNA
            helicase-like protein [Arabidopsis thaliana]
          Length = 612

 Score =  378 bits (971), Expect = e-103
 Identities = 199/319 (62%), Positives = 238/319 (74%), Gaps = 3/319 (0%)
 Frame = +2

Query: 290  AGGGY-GGGGRGGFG-GERGGYAGRGGAGRGEGGIGFNRPYDDPFKKAEAEKAEIDALY- 460
            +GGGY   GGR G+G G  GG  G GG     GG        +PF     + AE++ ++ 
Sbjct: 67   SGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGGWDRREREVNPF----GDDAELEPVFT 122

Query: 461  GAENTGINFEAYEDIPVETSGKDVPPPVHSFEDLQLPACMMENIKRCKFTKPTPVQKHSI 640
              ENTGINF+AYEDIPVETSG DVPPPV++F D+ L   +  NI+RCK+ +PTPVQ+H+I
Sbjct: 123  EQENTGINFDAYEDIPVETSGGDVPPPVNTFADIDLGDALNLNIRRCKYVRPTPVQRHAI 182

Query: 641  TIGLAGRDLMACAQTGSGKTAAFCFPIIASMLMKGYQPAAGRNSRKALPGALVLAPTREL 820
             I LA RDLMACAQTGSGKTAAFCFPII S +MK       R SR   P A++L+PTREL
Sbjct: 183  PILLAERDLMACAQTGSGKTAAFCFPII-SGIMKDQHVERPRGSRAVYPFAVILSPTREL 241

Query: 821  TSQIYDEARKFTYMTGLRPVVIYGGAPAPNQLRDLERGCDILVATPGRLSDFIERGRVGL 1000
              QI+DEA+KF+Y TG++ VV YGG P   QLR+LERGCDILVATPGRL+D +ER RV +
Sbjct: 242  ACQIHDEAKKFSYQTGVKVVVAYGGTPIHQQLRELERGCDILVATPGRLNDLLERARVSM 301

Query: 1001 SSIVFLCLDEADRMLDMGFEPQIRRIVEQEDMPPVGHRQTLMFSATFPKEIQRLASDFLA 1180
              I FL LDEADRMLDMGFEPQIR+IVEQ DMPP G RQT++FSATFP +IQRLA+DF++
Sbjct: 302  QMIRFLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTMLFSATFPSQIQRLAADFMS 361

Query: 1181 NYVFLTVGRVGSSTDLIVQ 1237
            NY+FL VGRVGSSTDLI Q
Sbjct: 362  NYIFLAVGRVGSSTDLITQ 380

 Score = 42.4 bits (98), Expect = 0.017
 Identities = 35/79 (44%), Positives = 36/79 (45%), Gaps = 8/79 (10%)
 Frame = +1

Query: 85  YVPPHLRGMAMGAPPPPPPGGPGPVM--GGYGGFPVAGAGAAVP----GAAPFGDDR--G 240
           YVPPHLR       P  P   P P     GYGG P AG+  A P    G A  G  R  G
Sbjct: 22  YVPPHLRNR-----PSEPVAAPLPQNDHAGYGGQP-AGSRWAPPSSGGGGASGGGYRNDG 75

Query: 241 PRGGYGGGYGAPRGGYGRW 297
            R GYG G G   GG G W
Sbjct: 76  GRTGYGYGAGGGGGGGGGW 94

 Score = 36.2 bits (82), Expect = 1.2
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +2

Query: 293 GGGYGGGGRGGFGGERGGYAGRGGAGRGEGGIG 391
           GGG GGGG   +GG  GGY G G  G   GG G
Sbjct: 574 GGGGGGGGSDYYGG--GGYGGGGYGGAPSGGYG 604

>pir||T45671 ATP-dependent RNA helicase-like protein - Arabidopsis thaliana
            gi|6735368|emb|CAB68189.1| ATP-dependent RNA
            helicase-like protein [Arabidopsis thaliana]
          Length = 603

 Score =  378 bits (971), Expect = e-103
 Identities = 199/319 (62%), Positives = 238/319 (74%), Gaps = 3/319 (0%)
 Frame = +2

Query: 290  AGGGY-GGGGRGGFG-GERGGYAGRGGAGRGEGGIGFNRPYDDPFKKAEAEKAEIDALY- 460
            +GGGY   GGR G+G G  GG  G GG     GG        +PF     + AE++ ++ 
Sbjct: 67   SGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGGWDRREREVNPF----GDDAELEPVFT 122

Query: 461  GAENTGINFEAYEDIPVETSGKDVPPPVHSFEDLQLPACMMENIKRCKFTKPTPVQKHSI 640
              ENTGINF+AYEDIPVETSG DVPPPV++F D+ L   +  NI+RCK+ +PTPVQ+H+I
Sbjct: 123  EQENTGINFDAYEDIPVETSGGDVPPPVNTFADIDLGDALNLNIRRCKYVRPTPVQRHAI 182

Query: 641  TIGLAGRDLMACAQTGSGKTAAFCFPIIASMLMKGYQPAAGRNSRKALPGALVLAPTREL 820
             I LA RDLMACAQTGSGKTAAFCFPII S +MK       R SR   P A++L+PTREL
Sbjct: 183  PILLAERDLMACAQTGSGKTAAFCFPII-SGIMKDQHVERPRGSRAVYPFAVILSPTREL 241

Query: 821  TSQIYDEARKFTYMTGLRPVVIYGGAPAPNQLRDLERGCDILVATPGRLSDFIERGRVGL 1000
              QI+DEA+KF+Y TG++ VV YGG P   QLR+LERGCDILVATPGRL+D +ER RV +
Sbjct: 242  ACQIHDEAKKFSYQTGVKVVVAYGGTPIHQQLRELERGCDILVATPGRLNDLLERARVSM 301

Query: 1001 SSIVFLCLDEADRMLDMGFEPQIRRIVEQEDMPPVGHRQTLMFSATFPKEIQRLASDFLA 1180
              I FL LDEADRMLDMGFEPQIR+IVEQ DMPP G RQT++FSATFP +IQRLA+DF++
Sbjct: 302  QMIRFLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTMLFSATFPSQIQRLAADFMS 361

Query: 1181 NYVFLTVGRVGSSTDLIVQ 1237
            NY+FL VGRVGSSTDLI Q
Sbjct: 362  NYIFLAVGRVGSSTDLITQ 380

 Score = 42.4 bits (98), Expect = 0.017
 Identities = 35/79 (44%), Positives = 36/79 (45%), Gaps = 8/79 (10%)
 Frame = +1

Query: 85  YVPPHLRGMAMGAPPPPPPGGPGPVM--GGYGGFPVAGAGAAVP----GAAPFGDDR--G 240
           YVPPHLR       P  P   P P     GYGG P AG+  A P    G A  G  R  G
Sbjct: 22  YVPPHLRNR-----PSEPVAAPLPQNDHAGYGGQP-AGSRWAPPSSGGGGASGGGYRNDG 75

Query: 241 PRGGYGGGYGAPRGGYGRW 297
            R GYG G G   GG G W
Sbjct: 76  GRTGYGYGAGGGGGGGGGW 94

 Score = 36.2 bits (82), Expect = 1.2
 Identities = 18/33 (54%), Positives = 19/33 (57%)
 Frame = +2

Query: 293 GGGYGGGGRGGFGGERGGYAGRGGAGRGEGGIG 391
           GGG GGGG   +GG  GGY G G  G   GG G
Sbjct: 565 GGGGGGGGSDYYGG--GGYGGGGYGGAPSGGYG 595



EST assemble image


clone accession position
1 CL53b08_r AV396007 1 509
2 MXL044e02_r BP095603 95 413
3 HCL062f11_r AV643040 95 603
4 HCL068f04_r AV643381 96 541
5 HCL083a05_r AV644155 116 542
6 CL39e11_r AV395215 185 681
7 HCL034a02_r AV641455 334 721
8 LCL053a03_r AV629143 371 823
9 CL67c12_r AV396711 390 850
10 LCL058g12_r AV629443 409 958
11 MXL098a06_r BP098723 510 868
12 MXL082d12_r BP097858 510 871
13 LCL040f08_r AV628367 525 833
14 MXL018d09_r BP094120 625 1052
15 CL61d04_r AV396343 629 1115
16 LCL077c10_r AV630328 659 1149
17 HCL038a07_r AV641647 795 1332




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research