KCC000537A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000537A_C01 KCC000537A_c01
ctGATATTAGCCTGCTTCATGCAAACAAGCTCGCAAAGGATACGTTCAACAATTTGTTGA
CCTATTTCAAGCTTGCCGTCACAGGATGGTATTACAATGTTGCTTACGATAGCTACACTG
GTAACACCCGTTGAGTCGCAAGCTTGGGCGCGAGGTTTAGGGGAGACCGCGTTCAGCGGT
AGCTCCCTCGGCAACGGCATCCAGCCAAACCCTGACATAAAATGGGCTCAGGAGCATCGA
CACAAGTGCAGCCCCGATACAAATGGGACGCGGACCACACGCTGAAGGGCCCATGGACCT
TTCTCTTCAAGGAGAAAGTCCAATTCGCTCGCGAAGGCAGCAAATGGTGCACGCGCGAAA
ACCCCGCCAAGCAGAAAGCGCCCAACGCCATCGCGGGCCTGCACGCAAGCTGGGTGGGTG
ACAAGGTGTTGGCCATGGCGCGGCCGTGGCAGGCCTACGTGGAGCAGTACCGGCTGGTGG
ACGCATTCAAGCAGGCCAACATCGGCATGATCTTAAACCTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000537A_C01 KCC000537A_c01
         (521 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAD13382.1| bA490F3.2.1 (novel protein isoform 1) [Homo sapi...    55  4e-07
dbj|BAB01622.1| unnamed protein product [Macaca fascicularis]          55  4e-07
gb|AAO13168.1| protein tyrosine phosphatase [Homo sapiens]             55  4e-07
ref|NP_818931.1| protein tyrosine phosphatase PTP9Q22 isoform 2 ...    55  4e-07
ref|NP_689635.3| protein tyrosine phosphatase PTP9Q22 isoform 1 ...    55  4e-07

>emb|CAD13382.1| bA490F3.2.1 (novel protein isoform 1) [Homo sapiens]
          Length = 698

 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
 Frame = +3

Query: 336 GSKWCTRENPAK-QKAPNAIAGLHASWVGDKVLAMARPWQAYVEQYRLVDAFKQANIGMI 512
           G + C  ENPA+  +   AI G+++SWV D +LAMARP    +E+Y ++D F    I  I
Sbjct: 8   GGRACKYENPARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTI 67

Query: 513 LNL 521
           +NL
Sbjct: 68  INL 70

>dbj|BAB01622.1| unnamed protein product [Macaca fascicularis]
          Length = 683

 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
 Frame = +3

Query: 336 GSKWCTRENPAK-QKAPNAIAGLHASWVGDKVLAMARPWQAYVEQYRLVDAFKQANIGMI 512
           G + C  ENPA+  +   AI G+++SWV D +LAMARP    +E+Y ++D F    I  I
Sbjct: 8   GGRACKYENPARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTI 67

Query: 513 LNL 521
           +NL
Sbjct: 68  INL 70

>gb|AAO13168.1| protein tyrosine phosphatase [Homo sapiens]
          Length = 754

 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
 Frame = +3

Query: 336 GSKWCTRENPAK-QKAPNAIAGLHASWVGDKVLAMARPWQAYVEQYRLVDAFKQANIGMI 512
           G + C  ENPA+  +   AI G+++SWV D +LAMARP    +E+Y ++D F    I  I
Sbjct: 59  GGRACKYENPARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTI 118

Query: 513 LNL 521
           +NL
Sbjct: 119 INL 121

>ref|NP_818931.1| protein tyrosine phosphatase PTP9Q22 isoform 2 [Homo sapiens]
          Length = 754

 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
 Frame = +3

Query: 336 GSKWCTRENPAK-QKAPNAIAGLHASWVGDKVLAMARPWQAYVEQYRLVDAFKQANIGMI 512
           G + C  ENPA+  +   AI G+++SWV D +LAMARP    +E+Y ++D F    I  I
Sbjct: 59  GGRACKYENPARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTI 118

Query: 513 LNL 521
           +NL
Sbjct: 119 INL 121

>ref|NP_689635.3| protein tyrosine phosphatase PTP9Q22 isoform 1 [Homo sapiens]
          Length = 806

 Score = 55.5 bits (132), Expect = 4e-07
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
 Frame = +3

Query: 336 GSKWCTRENPAK-QKAPNAIAGLHASWVGDKVLAMARPWQAYVEQYRLVDAFKQANIGMI 512
           G + C  ENPA+  +   AI G+++SWV D +LAMARP    +E+Y ++D F    I  I
Sbjct: 111 GGRACKYENPARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTI 170

Query: 513 LNL 521
           +NL
Sbjct: 171 INL 173



EST assemble image


clone accession position
1 MXL043f04_r BP095545 1 379
2 CL39d04_r AV395185 3 521




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research