KCC000536A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000536A_C01 KCC000536A_c01
aggtgctttGTTCCTTGTAAGGCCTGAAAGATTGTTTAGCGACAGCCCGCTTTTTGCACG
CAGCTGCTCAATTGAGCGTGAGTTCTCAATTGTACACTCTCCCTAAATGCTTTAGTATAT
ATATATATATATATATATATATATATATTTACTTCTCTTCTACGACAGCCTTGGCGACGA
CACTTTCGGCATAGGATTCACGGCGGCGAGCCCCCGCGACTTGGCACAAGGCAGGAGTCG
TTTATAGCCAACATGAGCGCAAGGTCGGGAGCTCGAAGTGCTCGGATTGGTCCGGTTGAC
CGCGGCACCTCCAGCGGCGGGCGACCAGCGTTCCCGCATGGCCCCTCCAGCGCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000536A_C01 KCC000536A_c01
         (354 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_702839.1| hypothetical protein [Plasmodium falciparum 3D7...    38  0.041
ref|XP_283632.1| hypothetical protein XP_283632 [Mus musculus] g...    36  0.12
gb|AAF14554.1|AF176353_1 F-box protein 26 [Xenopus laevis]             35  0.21
ref|NP_700530.1| hypothetical protein [Plasmodium falciparum 3D7...    35  0.21
pir||H72173 D5L protein - variola minor virus (strain Garcia-196...    35  0.35

>ref|NP_702839.1| hypothetical protein [Plasmodium falciparum 3D7]
           gi|23498255|emb|CAD49226.1| hypothetical protein
           [Plasmodium falciparum 3D7]
          Length = 455

 Score = 37.7 bits (86), Expect = 0.041
 Identities = 17/30 (56%), Positives = 21/30 (69%)
 Frame = +2

Query: 71  IEREFSIVHSP*ML*YIYIYIYIYIYLLLF 160
           IE+ FS  H   +  YIYIYIYIYIY+ +F
Sbjct: 404 IEKPFSTYHHVCIYIYIYIYIYIYIYIYIF 433

>ref|XP_283632.1| hypothetical protein XP_283632 [Mus musculus]
           gi|26338029|dbj|BAC32700.1| unnamed protein product [Mus
           musculus]
          Length = 137

 Score = 36.2 bits (82), Expect = 0.12
 Identities = 18/33 (54%), Positives = 22/33 (66%)
 Frame = +3

Query: 54  LHAAAQLSVSSQLYTLPKCFSIYIYIYIYIYIY 152
           +  +A+L +S Q  T   C  IYIYIYIYIYIY
Sbjct: 5   VQTSARLDISLQFTT---CSCIYIYIYIYIYIY 34

 Score = 30.4 bits (67), Expect = 6.6
 Identities = 12/15 (80%), Positives = 13/15 (86%)
 Frame = -3

Query: 148 IYIYIYIYIYILKHL 104
           IYIYIYIYIYI  H+
Sbjct: 23  IYIYIYIYIYIYMHM 37

 Score = 30.0 bits (66), Expect = 8.6
 Identities = 11/15 (73%), Positives = 14/15 (93%)
 Frame = +2

Query: 116 YIYIYIYIYIYLLLF 160
           YIYIYIYIYIY+ ++
Sbjct: 24  YIYIYIYIYIYMHMY 38

>gb|AAF14554.1|AF176353_1 F-box protein 26 [Xenopus laevis]
          Length = 733

 Score = 35.4 bits (80), Expect = 0.21
 Identities = 16/23 (69%), Positives = 17/23 (73%)
 Frame = +3

Query: 87  QLYTLPKCFSIYIYIYIYIYIYF 155
           +L  LP    IYIYIYIYIYIYF
Sbjct: 654 KLVFLPDTHFIYIYIYIYIYIYF 676

 Score = 30.8 bits (68), Expect = 5.1
 Identities = 13/16 (81%), Positives = 13/16 (81%)
 Frame = +2

Query: 116 YIYIYIYIYIYLLLFY 163
           YIYIYIYIYIY L  Y
Sbjct: 665 YIYIYIYIYIYFLGVY 680

>ref|NP_700530.1| hypothetical protein [Plasmodium falciparum 3D7]
           gi|23494919|gb|AAN35254.1|AE014829_54 hypothetical
           protein [Plasmodium falciparum 3D7]
          Length = 316

 Score = 35.4 bits (80), Expect = 0.21
 Identities = 15/24 (62%), Positives = 18/24 (74%)
 Frame = +2

Query: 116 YIYIYIYIYIYLLLFYDSLGDDTF 187
           YIYIYIYIYIY+ L  DS+ +  F
Sbjct: 39  YIYIYIYIYIYIFLLVDSVLEKKF 62

 Score = 32.3 bits (72), Expect = 1.7
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +1

Query: 103 LNALVYIYIYIYIYIFTSLL 162
           +N  +YIYIYIYIYI+  LL
Sbjct: 34  INIYIYIYIYIYIYIYIFLL 53

 Score = 32.3 bits (72), Expect = 1.7
 Identities = 16/27 (59%), Positives = 20/27 (73%)
 Frame = +3

Query: 72  LSVSSQLYTLPKCFSIYIYIYIYIYIY 152
           +SV++  Y   K  +IYIYIYIYIYIY
Sbjct: 22  ISVNNYKYEY-KYINIYIYIYIYIYIY 47

>pir||H72173 D5L protein - variola minor virus (strain Garcia-1966)
           gi|885781|gb|AAA69395.1| D4L [Variola virus]
           gi|1150673|emb|CAA50966.1| unnamed protein product
           [Variola virus] gi|5830747|emb|CAB54786.1| D5L protein
           [Variola minor virus]
          Length = 97

 Score = 34.7 bits (78), Expect = 0.35
 Identities = 14/15 (93%), Positives = 15/15 (99%)
 Frame = -3

Query: 148 IYIYIYIYIYILKHL 104
           IYIYIYIYIYILKH+
Sbjct: 14  IYIYIYIYIYILKHM 28

 Score = 31.2 bits (69), Expect = 3.9
 Identities = 14/32 (43%), Positives = 21/32 (64%), Gaps = 2/32 (6%)
 Frame = +1

Query: 115 VYIYIYIYIYIFTSLLRQPW--RRHFRHRIHG 204
           +YIYIYIYIYI+  +L+     + HF +  +G
Sbjct: 10  IYIYIYIYIYIYIYILKHMCNNQHHFSNIFYG 41

 Score = 30.8 bits (68), Expect = 5.1
 Identities = 11/15 (73%), Positives = 14/15 (93%)
 Frame = +2

Query: 116 YIYIYIYIYIYLLLF 160
           YIYIYIYIYIY+ ++
Sbjct: 9   YIYIYIYIYIYIYIY 23

 Score = 30.8 bits (68), Expect = 5.1
 Identities = 12/13 (92%), Positives = 13/13 (99%)
 Frame = +2

Query: 116 YIYIYIYIYIYLL 154
           YIYIYIYIYIY+L
Sbjct: 13  YIYIYIYIYIYIL 25

 Score = 30.8 bits (68), Expect = 5.1
 Identities = 11/15 (73%), Positives = 14/15 (93%)
 Frame = +2

Query: 116 YIYIYIYIYIYLLLF 160
           YIYIYIYIYIY+ ++
Sbjct: 7   YIYIYIYIYIYIYIY 21

 Score = 30.0 bits (66), Expect = 8.6
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +3

Query: 117 IYIYIYIYIYIY 152
           IYIYIYIYIYIY
Sbjct: 6   IYIYIYIYIYIY 17



EST assemble image


clone accession position
1 HCL050c08_r AV642352 1 210
2 HCL023c06_r AV640841 10 289
3 CL39a06_r AV395183 38 354




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research