KCC000534A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000534A_C01 KCC000534A_c01
caaaacattgcacCAGGACTTCACGAGCCATAGCGTTGGAGAGTTTCGCTCCTGCAAGTG
CGCAGGACTCCCCCATTTTTGCGTTTTTCGCATTTGAGGGCGATAGTGGACTCTGATACC
GCACAGTGTTCACCAACGTCATATCTATCTAATTACAGAGCGGAGGTGCTCGGTGCGGGG
CGTCAGCGTCAGTCGTCACAGTCCGCAACTCCCTTCAAAGATCGTCCTCTGAGTGCAACG
CCGAGTGTCTTGGTCAGTAGCTATTGAGAAATGCTTAGGCTCCTTACGCGGCTAGGCGTG
GGCGCAAGCGACGGCGATGGCGAACAGGTTGTGTCAACGGGCTCGCTGTCCACAAACCGG
CTCGGCAGCCAGCCGGCTGACGTCGTTGAGGTGCTTTGTCGGTATTTGGACATGCGGGAC
ATTGTGGCGCTCGCTCGGACCTCGAAGCACCTCCACAGGGTGGCGTCATCGCGCCGCGTG
TG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000534A_C01 KCC000534A_c01
         (482 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAC38049.1| unnamed protein product [Mus musculus]                 36  0.27
ref|ZP_00031303.1| COG2200: FOG: EAL domain [Burkholderia fungorum]    35  0.47
pir||S27981 homoserine kinase (EC 2.7.1.39) - Pseudomonas aerugi...    35  0.61
ref|NP_280568.1| Vng1842h [Halobacterium sp. NRC-1] gi|25410344|...    34  0.80
ref|XP_322516.1| hypothetical protein [Neurospora crassa] gi|289...    33  1.4

>dbj|BAC38049.1| unnamed protein product [Mus musculus]
          Length = 160

 Score = 35.8 bits (81), Expect = 0.27
 Identities = 26/61 (42%), Positives = 29/61 (46%)
 Frame = -2

Query: 472 AMTPPCGGASRSERAPQCPACPNTDKAPQRRQPAGCRAGLWTASPLTQPVRHRRRLRPRL 293
           A  P  G  SRS R P CPA P   +  +R   AG RA  W       P+R R   RPRL
Sbjct: 80  ARGPEQGEGSRSSRRPSCPASPTARR--RRECQAGARA--W-------PLRARGGSRPRL 128

Query: 292 A 290
           A
Sbjct: 129 A 129

>ref|ZP_00031303.1| COG2200: FOG: EAL domain [Burkholderia fungorum]
          Length = 306

 Score = 35.0 bits (79), Expect = 0.47
 Identities = 17/37 (45%), Positives = 24/37 (63%)
 Frame = +1

Query: 352 TNRLGSQPADVVEVLCRYLDMRDIVALARTSKHLHRV 462
           T+RL + P+DV +   R  D RD+VAL R S+ LH +
Sbjct: 111 THRLDAAPSDVFDPFDRIADDRDLVALDRMSRALHAI 147

>pir||S27981 homoserine kinase (EC 2.7.1.39) - Pseudomonas aeruginosa
           gi|45425|emb|CAA46169.1| homoserine kinase [Pseudomonas
           aeruginosa]
          Length = 316

 Score = 34.7 bits (78), Expect = 0.61
 Identities = 19/55 (34%), Positives = 22/55 (39%), Gaps = 3/55 (5%)
 Frame = -2

Query: 463 PPCGGASRSERAPQCPACPN---TDKAPQRRQPAGCRAGLWTASPLTQPVRHRRR 308
           PP G +S +     CP C N   T     R +PA C    W  SP   P   R R
Sbjct: 130 PPAGASSNARATVACPGCWNKVPTSPRDYRNRPAPCSPRPWRRSPRWMPSVQRCR 184

>ref|NP_280568.1| Vng1842h [Halobacterium sp. NRC-1] gi|25410344|pir||D84335
           hypothetical protein Vng1842h [imported] - Halobacterium
           sp. NRC-1 gi|10581288|gb|AAG20048.1| Vng1842h
           [Halobacterium sp. NRC-1]
          Length = 433

 Score = 34.3 bits (77), Expect = 0.80
 Identities = 31/89 (34%), Positives = 38/89 (41%), Gaps = 5/89 (5%)
 Frame = -2

Query: 430 APQCPACPNTDKAPQRRQPAGCRAG-LWTASPLTQPVRHRRRL----RPRLAA*GA*AFL 266
           A  C AC  + + P+RRQPA    G      P   P RHRRRL     P LAA    + L
Sbjct: 84  ADACSAC-RSPRRPERRQPADALGGPARETRPRRPPARHRRRLTRGATPILAAPRDHSML 142

Query: 265 NSY*PRHSALHSEDDL*RELRTVTTDADA 179
           +    R       DDL  E  ++    DA
Sbjct: 143 DDLLGRTELKARIDDLEAEADSLQQQLDA 171

>ref|XP_322516.1| hypothetical protein [Neurospora crassa] gi|28917768|gb|EAA27458.1|
           hypothetical protein [Neurospora crassa]
          Length = 1018

 Score = 33.5 bits (75), Expect = 1.4
 Identities = 15/41 (36%), Positives = 26/41 (62%)
 Frame = +1

Query: 112 SDTAQCSPTSYLSNYRAEVLGAGRQRQSSQSATPFKDRPLS 234
           SDTA+ SP+  L+  R  V  + ++R S ++A+P++  P S
Sbjct: 574 SDTARLSPSDALTTRRRSVRKSEKERSSDETASPYEPSPTS 614



EST assemble image


clone accession position
1 HCL006f11_r AV639886 1 423
2 CL38f02_r AV395297 14 482




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research