KCC000533A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000533A_C01 KCC000533A_c01
gtgccaaacaatctcacagcttacctgtgcaggcaggcatccagctcgccaaggtcgcgc
gtcctctcataacaaattgcGCACAGGCAGCGCATCTGTGCGCATGGGCACCAGACTCCA
GAGTCTCTCGCTGTCTCGTCGGCACGCCGCGATTCCTTGCACTACTAAGACATGTTGAAG
CGACCAATCAGCGCGTGGGTCGAGTGCGCGCGACGAATTCGGCTGCTCACAACAAATGCG
TCCAGCAGCCGGCGTAGGACAGATCGCTCTCTGGGCTGCGACCATCACCGTTGAGGTTGT
GCTTCCGGAGCTCAGCAATATTAAACACCGCATAGGCACCAGTCGAGTCTCTCCACGAGC
CGGGCGCTCGTTCTTGTGCCTCTGAAATTCAACACAAATAGTCTCCATTTGCTAGGCGGG
CGAGCAGGCGGGGCAGCCGGCAGATGGGCCGCTCACGCTCACGCTCACGCTCGCCGGCAG
CAAAGCGGGAGCGCTCACGCAGCCCTGAGCGTGGGAGTAAGCGCAGCCGCCCTGATAGGG
ACGATCGGCGGGACCGGGATCGCGAGGAGGAGCGCCGTGACCGTGGCCGTGACGAGGAGG
CCCGGCGGGGAGGAGACCGGGACCGCCGCGGTGACCGGCCCGACCGTGACCGTGAGCGGG
ATCGCGACCGCGAGAGGGATCGTGACCGAGACCGCGAGCGGCCAGATCGCAGTGACAGGG
ACAAGGAGCGGGAGCGTGTCGACAGGGACCGGGATGGGCCCGAGCGGGACCGCCGGGATG
ACGGAGGCCGCAAGCGC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000533A_C01 KCC000533A_c01
         (797 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_701490.1| eukaryotic translation initiation factor 3 subu...   110  3e-23
ref|NP_702803.1| Plasmodium falciparum protein kinase, putative ...   108  1e-22
gb|EAA16423.1| eukaryotic translation initiation factor 3 subuni...   107  2e-22
ref|NP_055885.2| KIAA0853 protein [Homo sapiens] gi|30908950|gb|...    97  3e-19
emb|CAD38544.1| hypothetical protein [Homo sapiens]                    97  3e-19

>ref|NP_701490.1| eukaryotic translation initiation factor 3 subunit 10, putative
            [Plasmodium falciparum 3D7]
            gi|23496658|gb|AAN36214.1|AE014846_13 eukaryotic
            translation initiation factor 3 subunit 10, putative
            [Plasmodium falciparum 3D7]
          Length = 1377

 Score =  110 bits (275), Expect = 3e-23
 Identities = 70/128 (54%), Positives = 80/128 (61%), Gaps = 1/128 (0%)
 Frame = +3

Query: 417  RASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEERRDRGRDE 596
            R  R   R+  R R R R     RER R  +R  +R R DRD  RDRDR+ ER DR RD 
Sbjct: 1096 RRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDR-DRDRERDRDRDRER-DRDRDR 1153

Query: 597  EARRGGDRDRRGDRP-DRDRERDRDRERDRDRDRERPDRSDRDKERERVDRDRDGPERDR 773
            E  R  DR+ R DR  DR+R+RDRDRERDRDRDRER    DRD++RER DRDRD  ER+R
Sbjct: 1154 ERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRER----DRDRDRER-DRDRD-RERER 1207

Query: 774  RDDGGRKR 797
              D  R R
Sbjct: 1208 DRDRDRDR 1215

 Score =  108 bits (271), Expect = 8e-23
 Identities = 71/154 (46%), Positives = 85/154 (55%), Gaps = 6/154 (3%)
 Frame = +3

Query: 354  HEPGARSCASEIQHK*SPFARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP 533
            H  G     SE++ +     R   R   R   R R R       R+R R  +R  +R R 
Sbjct: 1057 HHDGTHRDRSEMRDRRDWSGRDRDRDRERDRDRDRDREHRRDRDRDRERDRDRDRERDR- 1115

Query: 534  DRDDRRDRDREEE-RRDRGRDEEARRGGDRDRRGDRP-----DRDRERDRDRERDRDRDR 695
            DRD  RDRDR+ E RRDR RD E  R  DR+R  DR      DRDRE  RDR+RDR+RDR
Sbjct: 1116 DRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDRDRERDR 1175

Query: 696  ERPDRSDRDKERERVDRDRDGPERDRRDDGGRKR 797
            +R    DRD++RER DRDRD  ERDR  D  R+R
Sbjct: 1176 DRDRERDRDRDRER-DRDRD-RERDRDRDRERER 1207

 Score =  107 bits (266), Expect = 3e-22
 Identities = 71/144 (49%), Positives = 81/144 (55%), Gaps = 14/144 (9%)
 Frame = +3

Query: 408  FARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEER---- 575
            + R           RS  R R   + R+R R  ER   R R DR+ RRDRDR+ ER    
Sbjct: 1051 YRRHDDHHDGTHRDRSEMRDRRDWSGRDRDRDRERDRDRDR-DREHRRDRDRDRERDRDR 1109

Query: 576  ---RDRGRDEEARRGGDRDRRGDRP-DRDRERDRDRERDRDRDRE------RPDRSDRDK 725
               RDR RD E  R  DR+ R DR  DR+R+RDRDRERDRDRDRE      R  R DRD+
Sbjct: 1110 DRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDR 1169

Query: 726  ERERVDRDRDGPERDRRDDGGRKR 797
            +RER DRDRD  ERDR  D  R R
Sbjct: 1170 DRER-DRDRD-RERDRDRDRERDR 1191

 Score =  102 bits (255), Expect = 5e-21
 Identities = 59/134 (44%), Positives = 77/134 (57%), Gaps = 6/134 (4%)
 Frame = +3

Query: 414  RRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP-DRDDRRDRDREEER----- 575
            R   R   R+  R R R R     R+R R  +R  +R R  DR+ RRDRDR+ ER     
Sbjct: 1119 RERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRD 1178

Query: 576  RDRGRDEEARRGGDRDRRGDRPDRDRERDRDRERDRDRDRERPDRSDRDKERERVDRDRD 755
            R+R RD +  R  DRDR  DR DRDRER+RDR+RDRDRD +R DR  +    +++DRD  
Sbjct: 1179 RERDRDRDRERDRDRDRERDR-DRDRERERDRDRDRDRDIKRSDRDHKKDRDDKLDRDSR 1237

Query: 756  GPERDRRDDGGRKR 797
              ER  + +  +KR
Sbjct: 1238 RRERSGKPENEKKR 1251

 Score = 85.9 bits (211), Expect = 7e-16
 Identities = 55/126 (43%), Positives = 67/126 (52%), Gaps = 6/126 (4%)
 Frame = +3

Query: 414  RRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP---DRDDRRDRDREEERRDR 584
            R   R   R   R R R R    +R+R R  ER   R R    DRD  RDRDR+ ER DR
Sbjct: 1141 RDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDRER-DR 1199

Query: 585  GRDEEARRGGDRDRRGD--RPDRDRERDRDRERDRD-RDRERPDRSDRDKERERVDRDRD 755
             RD E  R  DRDR  D  R DRD ++DRD + DRD R RER  + + +K+RE     R+
Sbjct: 1200 DRDRERERDRDRDRDRDIKRSDRDHKKDRDDKLDRDSRRRERSGKPENEKKRENDISKRN 1259

Query: 756  GPERDR 773
            G   +R
Sbjct: 1260 GTTEER 1265

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 56/141 (39%), Positives = 72/141 (50%), Gaps = 14/141 (9%)
 Frame = +3

Query: 417  RASRRGSRQMGRSRSRSRSPAAKRERS------------RSPERGSKRSRPDRDDRRDRD 560
            +A R    +M     R +  + + ERS            R  ++G  ++  D   R D  
Sbjct: 998  KAQRERDLEMDLQMKRKKEESRRSERSHRKSSIDDDLTWRRGDKGGSQNGDDSYRRHDDH 1057

Query: 561  REEERRDRGRDEEARRGGDRDRRGDRPDRDRERDRDRE--RDRDRDRERPDRSDRDKERE 734
             +   RDR    + R    RDR  DR +RDR+RDRDRE  RDRDRDRER    DRD++RE
Sbjct: 1058 HDGTHRDRSEMRDRRDWSGRDRDRDR-ERDRDRDRDREHRRDRDRDRER----DRDRDRE 1112

Query: 735  RVDRDRDGPERDRRDDGGRKR 797
            R DRDRD  ERDR  D   +R
Sbjct: 1113 R-DRDRD-RERDRDRDREHRR 1131

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 62/157 (39%), Positives = 77/157 (48%), Gaps = 10/157 (6%)
 Frame = +3

Query: 357  EPGARSCASEIQHK*SPFARRASRRGSR-QMGRSRSRSRSPAAKRERSRSPERGSKRSRP 533
            E   R    E++ K    AR+     S+ Q  R          K+E SR  ER  ++S  
Sbjct: 971  EEEERLLKEEMERKKKEEARKKLEEISKAQRERDLEMDLQMKRKKEESRRSERSHRKSSI 1030

Query: 534  DRD---DRRDRDREEERRDRGRDEEARRGG---DRDRRGDRPD---RDRERDRDRERDRD 686
            D D    R D+   +   D  R  +    G   DR    DR D   RDR+RDR+R+RDRD
Sbjct: 1031 DDDLTWRRGDKGGSQNGDDSYRRHDDHHDGTHRDRSEMRDRRDWSGRDRDRDRERDRDRD 1090

Query: 687  RDRERPDRSDRDKERERVDRDRDGPERDRRDDGGRKR 797
            RDRE   R DRD++RER DRDRD  ERDR  D  R R
Sbjct: 1091 RDREH--RRDRDRDRER-DRDRD-RERDRDRDRERDR 1123

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 36/130 (27%), Positives = 58/130 (43%), Gaps = 11/130 (8%)
 Frame = +3

Query: 414  RRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRD-REEERRDRGR 590
            R   R   R+  R R R R     R+R R  +R  +  + DRDD+ DRD R  ER  +  
Sbjct: 1187 RERDRDRDRERDRDRDRERERDRDRDRDRDIKRSDRDHKKDRDDKLDRDSRRRERSGKPE 1246

Query: 591  DEEARRGGDRDRRGDRPDRDRE----RDRDRERDRDRDRERPDRSDR------DKERERV 740
            +E+ R      R G   +R +     ++ D  + +    E   +S R      D E E+ 
Sbjct: 1247 NEKKRENDISKRNGTTEERTKNAWNLKEDDDSKAKHETSEENTKSWRNNNKVIDNEIEKA 1306

Query: 741  DRDRDGPERD 770
            ++ +DG ++D
Sbjct: 1307 EKYKDGEKKD 1316

 Score = 41.2 bits (95), Expect = 0.020
 Identities = 36/104 (34%), Positives = 41/104 (38%), Gaps = 1/104 (0%)
 Frame = -2

Query: 736  RSRSLSLSLRSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASSSRPRSR-RSSSR 560
            R R      R  R R R R   R R R R R  R   R R    R    R R R R   R
Sbjct: 1121 RDRDRDREHRRDRDRDRERDRDRDRERDRDRD-RERDRDRDREHRRDRDRDRERDRDRDR 1179

Query: 559  SRSRRSSLSGRLRLLPRSGLRERSRFAAGERERERERPICRLPR 428
             R R      R R   R   R+R R    +R+R+R+R I R  R
Sbjct: 1180 ERDRDRDRE-RDRDRDRERDRDRDRERERDRDRDRDRDIKRSDR 1222

 Score = 40.4 bits (93), Expect = 0.033
 Identities = 30/89 (33%), Positives = 34/89 (37%), Gaps = 5/89 (5%)
 Frame = -2

Query: 700  RSRSRSRSLSRSRSRSRSRSGRSPR-----RSRSPPRRASSSRPRSRRSSSRSRSRRSSL 536
            R R R R   R R R R R  R  R     R R   R     R R R        RR   
Sbjct: 1109 RDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRD 1168

Query: 535  SGRLRLLPRSGLRERSRFAAGERERERER 449
              R R   R   R+R R    +R+R+RER
Sbjct: 1169 RDRERDRDRDRERDRDRDRERDRDRDRER 1197

 Score = 39.7 bits (91), Expect = 0.057
 Identities = 33/88 (37%), Positives = 37/88 (41%), Gaps = 3/88 (3%)
 Frame = -2

Query: 706  SGRSRSRSRSLSRSRSRSRS-RSGRSPRRSRSPPRRASSSRPRSR-RSSSRSRS-RRSSL 536
            SGR R R R   R R R R  R  R   R R   R     R R R R   R R  RR   
Sbjct: 1075 SGRDRDRDRERDRDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRD 1134

Query: 535  SGRLRLLPRSGLRERSRFAAGERERERE 452
              R R   R   R+R R    +R+R+RE
Sbjct: 1135 RDRERDRDRDRERDRDRDRERDRDRDRE 1162

 Score = 39.7 bits (91), Expect = 0.057
 Identities = 35/117 (29%), Positives = 39/117 (32%), Gaps = 1/117 (0%)
 Frame = -2

Query: 796  RLRPPSSRRSRSGPSRSLSTRSRSLSLSLRSGRSRSRSRSLSRSRSRSRSRS-GRSPRRS 620
            R R    RR R         R R         R R R R   R R R R R   R   R 
Sbjct: 1089 RDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDREHRRDRDRDRERDRDRDRERD 1148

Query: 619  RSPPRRASSSRPRSRRSSSRSRSRRSSLSGRLRLLPRSGLRERSRFAAGERERERER 449
            R   R     R R  R        R     R R   R   R+R R    +R+R+RER
Sbjct: 1149 RDRDRERDRDRDREHRRDRDRDRERDRDRDRERDRDRDRERDRDRDRERDRDRDRER 1205

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 23/86 (26%), Positives = 39/86 (44%), Gaps = 2/86 (2%)
 Frame = +3

Query: 498  RSPERGSKRSRPDRDDRRDRDREEERRDRGRDEEARRGGDRDRRGDRPDRDRERDRDRER 677
            R+ ER  +  R  + +   + REEE     ++E  R+  +  R+        +R+RD E 
Sbjct: 948  RAKERRDQHIRKLKAEEERKRREEEEERLLKEEMERKKKEEARKKLEEISKAQRERDLEM 1007

Query: 678  D--RDRDRERPDRSDRDKERERVDRD 749
            D    R +E   RS+R   +  +D D
Sbjct: 1008 DLQMKRKKEESRRSERSHRKSSIDDD 1033

>ref|NP_702803.1| Plasmodium falciparum protein kinase, putative [Plasmodium falciparum
            3D7] gi|23498219|emb|CAD49190.1| Plasmodium falciparum
            protein kinase, putative [Plasmodium falciparum 3D7]
          Length = 1339

 Score =  108 bits (269), Expect = 1e-22
 Identities = 69/132 (52%), Positives = 87/132 (65%), Gaps = 1/132 (0%)
 Frame = +3

Query: 405  PFARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEER-RD 581
            P+ RR SR   R+  R R R R    +R+R R  +R  +R R DRD  R+RDR  ER RD
Sbjct: 1199 PYGRR-SRDRDRERDRDRERDRERDRERDRDRERDRERERDR-DRDRDRERDRNRERDRD 1256

Query: 582  RGRDEEARRGGDRDRRGDRPDRDRERDRDRERDRDRDRERPDRSDRDKERERVDRDRDGP 761
            R RD E  R  +RDR  DR DRDR+RDRDR+RDRDRDR+R DR DR+KER+R D+D+D  
Sbjct: 1257 RERDRERDRNRERDRDRDR-DRDRDRDRDRDRDRDRDRDR-DR-DREKERKR-DKDKD-K 1311

Query: 762  ERDRRDDGGRKR 797
            E D+  D  +K+
Sbjct: 1312 ENDKSKDADQKK 1323

 Score =  100 bits (250), Expect = 2e-20
 Identities = 66/124 (53%), Positives = 78/124 (62%), Gaps = 8/124 (6%)
 Frame = +3

Query: 450  RSRSRS--RSPAAKRERSRSPERGSKRSRP-DRDDRRDRDREEER-----RDRGRDEEAR 605
            RSR R   + P  +R R R  ER   R R  +RD  RDRDRE +R     RDR RD E  
Sbjct: 1189 RSREREWYKKPYGRRSRDRDRERDRDRERDRERDRERDRDRERDRERERDRDRDRDRERD 1248

Query: 606  RGGDRDRRGDRPDRDRERDRDRERDRDRDRERPDRSDRDKERERVDRDRDGPERDRRDDG 785
            R  +RDR  DR +RDRERDR+RERDRDRDR+R    DRD++R+R DRDRD   RDR  + 
Sbjct: 1249 RNRERDR--DR-ERDRERDRNRERDRDRDRDRDRDRDRDRDRDR-DRDRD---RDRDREK 1301

Query: 786  GRKR 797
             RKR
Sbjct: 1302 ERKR 1305

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 53/126 (42%), Positives = 71/126 (56%), Gaps = 5/126 (3%)
 Frame = +3

Query: 414  RRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEER-RDRGR 590
            R   R   R+  R R R R     R+R R  ER   R R DRD  RDR+R+  R RDR R
Sbjct: 1215 RERDRERDRERDRDRERDRERERDRDRDRDRERDRNRER-DRDRERDRERDRNRERDRDR 1273

Query: 591  DEEARRGGDRDRRGDRPDRDRERDRDRE----RDRDRDRERPDRSDRDKERERVDRDRDG 758
            D +  R  DRDR  DR DRDR+RDRDRE    RD+D+D+E     D D+++ ++D +   
Sbjct: 1274 DRDRDRDRDRDRDRDR-DRDRDRDRDREKERKRDKDKDKENDKSKDADQKKHKLDTEELR 1332

Query: 759  PERDRR 776
             E+ ++
Sbjct: 1333 VEKKKK 1338

 Score = 75.5 bits (184), Expect = 9e-13
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 4/92 (4%)
 Frame = +3

Query: 534  DRDDRRDRDREEERRDRGRDEEARRGGDRDRRGDRP---DRDRERDRDRERDRDRDRERP 704
            DR   R R+RE  ++  GR     R  DRDR  DR    DR+R+R+RDR+R+RDR+RER 
Sbjct: 1184 DRISHRSREREWYKKPYGR-----RSRDRDRERDRDRERDRERDRERDRDRERDRERERD 1238

Query: 705  DRSDRDKERER-VDRDRDGPERDRRDDGGRKR 797
               DRD+ER+R  +RDRD  ERDR  D  R+R
Sbjct: 1239 RDRDRDRERDRNRERDRD-RERDRERDRNRER 1269

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 63/159 (39%), Positives = 72/159 (44%), Gaps = 58/159 (36%)
 Frame = +3

Query: 495  SRSPERGSK--------------------------RSRPDRDDRR--------------- 551
            +RSP    K                          RSR   DDRR               
Sbjct: 1122 NRSPSHAKKYNNEKREKEKKIEGIDNRRESNNYFRRSREGIDDRRRYSTICKTGYNNADV 1181

Query: 552  ------DRDREEE-------RRDRGRDEEARRGGDRDRRGDRP-DRDRERDRDRERDRDR 689
                   R RE E       RR R RD E  R  +RDR  DR  DRDRERDR+RERDRDR
Sbjct: 1182 YRDRISHRSREREWYKKPYGRRSRDRDRERDRDRERDRERDRERDRDRERDRERERDRDR 1241

Query: 690  DRERP-DRS-DRDKERERVDRDRD-GPERDRRDDGGRKR 797
            DR+R  DR+ +RD++RER DR+RD   ERDR  D  R R
Sbjct: 1242 DRDRERDRNRERDRDRER-DRERDRNRERDRDRDRDRDR 1279

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 38/115 (33%), Positives = 44/115 (38%), Gaps = 1/115 (0%)
 Frame = -2

Query: 790  RPPSSRRSRSGPSRSLSTRSRSLSLSLRSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSP 611
            + P  RRSR         R R         R R R R   R R R R R  R   R R  
Sbjct: 1197 KKPYGRRSRDRDRERDRDRERDRERDRERDRDRERDRERERDRDRDRDRE-RDRNRERDR 1255

Query: 610  PRRASSSRPRSR-RSSSRSRSRRSSLSGRLRLLPRSGLRERSRFAAGERERERER 449
             R     R R+R R   R R R      R R   R   R+R R    +RE+ER+R
Sbjct: 1256 DRERDRERDRNRERDRDRDRDR-----DRDRDRDRDRDRDRDRDRDRDREKERKR 1305

 Score = 40.4 bits (93), Expect = 0.033
 Identities = 35/100 (35%), Positives = 42/100 (42%), Gaps = 1/100 (1%)
 Frame = -2

Query: 745  LSTRSRSLSLSLRSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASSSRPRSR-RS 569
            +S RSR      +    RSR R   R R R R R  R   R R   R     R R R R 
Sbjct: 1186 ISHRSREREWYKKPYGRRSRDRDRERDRDRERDRE-RDRERDRDRERDRERERDRDRDRD 1244

Query: 568  SSRSRSRRSSLSGRLRLLPRSGLRERSRFAAGERERERER 449
              R R+R      R R   R   RER R    +R+R+R+R
Sbjct: 1245 RERDRNRERDRD-RERDRERDRNRERDRDRDRDRDRDRDR 1283

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 39/113 (34%), Positives = 48/113 (41%), Gaps = 4/113 (3%)
 Frame = -2

Query: 775  RRSRSGPSRSLSTRSRSLSLSLRSGRSRS---RSRSLSRSRSRSRSRSGRSPRRSRSPPR 605
            RRSR G    +  R R  S   ++G + +   R R   RSR R   +     RRSR   R
Sbjct: 1156 RRSREG----IDDRRR-YSTICKTGYNNADVYRDRISHRSREREWYKKPYG-RRSRDRDR 1209

Query: 604  RASSSRPRSR-RSSSRSRSRRSSLSGRLRLLPRSGLRERSRFAAGERERERER 449
                 R R R R   R R R      R R   R   RER R    +R+RER+R
Sbjct: 1210 ERDRDRERDRERDRERDRDRERDRE-RERDRDRDRDRERDRNRERDRDRERDR 1261

>gb|EAA16423.1| eukaryotic translation initiation factor 3 subunit 10 [Plasmodium
            yoelii yoelii]
          Length = 1268

 Score =  107 bits (267), Expect = 2e-22
 Identities = 71/151 (47%), Positives = 87/151 (57%), Gaps = 12/151 (7%)
 Frame = +3

Query: 378  ASEIQHK*SPFARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDR-RD 554
            ASE + + +   R   R   R   R R R R    +R+R R  +R  +R +  R DR +D
Sbjct: 1000 ASEKKDRKTWSGRDRERDRERDRDRDRERDRDRDRERDRDRDRDRKYRREKEYRRDRSKD 1059

Query: 555  RDREEER-RDRGRDEEARRGGDRDRRGDRP-DRDRERDRDRERDRDRDRERPDRSDRDKE 728
            R+R+ +R RDR RD E  R  DRDR  DR  DRDRERDRDRER+RDRDRER    DRD+E
Sbjct: 1060 RERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRDRERERDRDRERDRERDRDRE 1119

Query: 729  R---------ERVDRDRDGPERDRRDDGGRK 794
            R          R DR+RD  ERD R DG R+
Sbjct: 1120 RGRDYRKDKDHRRDRERD-RERDYRKDGERE 1149

 Score = 99.8 bits (247), Expect = 5e-20
 Identities = 62/132 (46%), Positives = 80/132 (59%), Gaps = 4/132 (3%)
 Frame = +3

Query: 414  RRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEERRDRGRD 593
            R AS +  R+    R R R     R+R R  +R       DRD  RDRDR+ +R+ R R+
Sbjct: 998  RDASEKKDRKTWSGRDRERDRERDRDRDRERDR-------DRDRERDRDRDRDRKYR-RE 1049

Query: 594  EEARRGGDRDRRGDRP-DRDRERDRDRERDRDRDRERPDRSDRDKERER---VDRDRDGP 761
            +E RR   +DR  DR  +RDRERDR+R+R+RDRDRER    DRD+ER+R    +RDRD  
Sbjct: 1050 KEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRDRERERDRD-R 1108

Query: 762  ERDRRDDGGRKR 797
            ERDR  D  R+R
Sbjct: 1109 ERDRERDRDRER 1120

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 58/133 (43%), Positives = 73/133 (54%), Gaps = 10/133 (7%)
 Frame = +3

Query: 414  RRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEER---RDR 584
            R   R   R+  R +   R  +  RER R  ER  +R R +RD  RDRDRE +R   RDR
Sbjct: 1036 RDRDRDRDRKYRREKEYRRDRSKDRERDRDRERDRERDR-ERDRERDRDRERDRERDRDR 1094

Query: 585  GRDEEARRGGDRDRRGDRP-DRDRER------DRDRERDRDRDRERPDRSDRDKERERVD 743
             RD +  R  DRDR  DR  DRDRER      D+D  RDR+RDRER  R D ++E  R D
Sbjct: 1095 ERDRDRERERDRDRERDRERDRDRERGRDYRKDKDHRRDRERDRERDYRKDGERENRRGD 1154

Query: 744  RDRDGPERDRRDD 782
              R   +R+++ D
Sbjct: 1155 TRRSENDREKKRD 1167

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 55/130 (42%), Positives = 77/130 (58%), Gaps = 4/130 (3%)
 Frame = +3

Query: 414  RRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP-DRDDRRDRDREEER-RDRG 587
            R   R   R   R R   R    +R+RS+  ER   R R  +RD  RDR+R+ +R RDR 
Sbjct: 1030 RDRDRERDRDRDRDRKYRREKEYRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRE 1089

Query: 588  RDEEARRGGDRDRRGDRPDRDRERDRDRERDRDRD--RERPDRSDRDKERERVDRDRDGP 761
            RD +  R  DR+R  DR DR+R+R+RDR+R+R RD  +++  R DR+++RER D  +DG 
Sbjct: 1090 RDRDRERDRDRERERDR-DRERDRERDRDRERGRDYRKDKDHRRDRERDRER-DYRKDGE 1147

Query: 762  ERDRRDDGGR 791
              +RR D  R
Sbjct: 1148 RENRRGDTRR 1157

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 55/147 (37%), Positives = 73/147 (49%), Gaps = 20/147 (13%)
 Frame = +3

Query: 408  FARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP-----DRDDRRDRDREEE 572
            + R  S+   R   R R R R     RER R  ER  +R R      DR+  RDRDRE +
Sbjct: 1052 YRRDRSKDRERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRDRERERDRDRERD 1111

Query: 573  R-----RDRGRDEEARRGGDRDRRGDRPDRDRERD--RDRERDRDRDRERPDRSDRDKER 731
            R     R+RGRD       D+D R DR +RDRERD  +D ER+  R   R   +DR+K+R
Sbjct: 1112 RERDRDRERGRDYRK----DKDHRRDR-ERDRERDYRKDGERENRRGDTRRSENDREKKR 1166

Query: 732  ERVDRDRDGPERD--------RRDDGG 788
            ++ D   +  + +        R DDGG
Sbjct: 1167 DKDDYTPNNSDNEKERNAWNIRNDDGG 1193

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 47/127 (37%), Positives = 65/127 (51%), Gaps = 13/127 (10%)
 Frame = +3

Query: 456  RSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEERRDRGRDEEARRGGDRDRRGD 635
            +S  +S A      R  E G+ +   D   R   + ++  RD    ++ +    RDR  D
Sbjct: 958  KSLRKSSADDEFTWRRHETGTSQYDDDNYKRHHENNDDHYRDASEKKDRKTWSGRDRERD 1017

Query: 636  RPDRDRERDRDRERDRDRDRERPD------------RSDRDKERERVDRDRD-GPERDRR 776
            R +RDR+RDR+R+RDRDR+R+R              R DR K+RER DRDR+   ERDR 
Sbjct: 1018 R-ERDRDRDRERDRDRDRERDRDRDRDRKYRREKEYRRDRSKDRER-DRDRERDRERDRE 1075

Query: 777  DDGGRKR 797
             D  R R
Sbjct: 1076 RDRERDR 1082

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 48/123 (39%), Positives = 58/123 (47%), Gaps = 4/123 (3%)
 Frame = +3

Query: 414  RRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDR--DREEERRDRG 587
            R   R   R   R R R R     RER R  ERG +  R D+D RRDR  DRE + R  G
Sbjct: 1088 RERDRDRERDRDRERERDRDRERDRERDRDRERG-RDYRKDKDHRRDRERDRERDYRKDG 1146

Query: 588  RDEEARRGGDRDRRGDRPDRDRERDRDRERDRDRDRERPDRSDRDKERE--RVDRDRDGP 761
              E        +RRGD     R  + DRE+ RD+D   P+ SD +KER    +  D  G 
Sbjct: 1147 ERE--------NRRGD----TRRSENDREKKRDKDDYTPNNSDNEKERNAWNIRNDDGGI 1194

Query: 762  ERD 770
            E D
Sbjct: 1195 ESD 1197

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 45/121 (37%), Positives = 60/121 (49%), Gaps = 16/121 (13%)
 Frame = +3

Query: 483  KRERSRSPERGSKRSRPDRDDRRDR---------DREEERRDRGRDEEARRGGDRDRRGD 635
            + E SRS E+  ++S  D +    R         D   +R     D+  R   ++  R  
Sbjct: 949  QNEESRSGEKSLRKSSADDEFTWRRHETGTSQYDDDNYKRHHENNDDHYRDASEKKDRKT 1008

Query: 636  RPDRDRERDRDRERDRDRDRERPDRSDRDKERERVDRDRDGP-------ERDRRDDGGRK 794
               RDRERDR+R+RDRDR+R+R    DRD+ER+R DRDRD          RDR  D  R 
Sbjct: 1009 WSGRDRERDRERDRDRDRERDR----DRDRERDR-DRDRDRKYRREKEYRRDRSKDRERD 1063

Query: 795  R 797
            R
Sbjct: 1064 R 1064

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 40/121 (33%), Positives = 46/121 (37%), Gaps = 7/121 (5%)
 Frame = -2

Query: 790  RPPSSRRSRSGPSRSLSTRSRSLSLSLRSGRSRSRSRSLSRSRSRSRS-RSGRSPRRSRS 614
            R  S ++ R   S     R R         R R R R   R R R R  R  +  RR RS
Sbjct: 998  RDASEKKDRKTWSGRDRERDRERDRDRDRERDRDRDRERDRDRDRDRKYRREKEYRRDRS 1057

Query: 613  PPRRASSSRPRSR-----RSSSRSRSR-RSSLSGRLRLLPRSGLRERSRFAAGERERERE 452
              R     R R R     R   R R R R     R R   R   RER R    +RER+R+
Sbjct: 1058 KDRERDRDRERDRERDRERDRERDRDRERDRERDRDRERDRDRERERDRDRERDRERDRD 1117

Query: 451  R 449
            R
Sbjct: 1118 R 1118

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 30/88 (34%), Positives = 35/88 (39%), Gaps = 1/88 (1%)
 Frame = -2

Query: 709  RSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASSSRPRSR-RSSSRSRSRRSSLS 533
            R  RS+ R R   R R R R R  R   R R   R     R R R R   R R R     
Sbjct: 1053 RRDRSKDRERDRDRERDRERDRE-RDRERDRDRERDRERDRDRERDRDRERERDR----- 1106

Query: 532  GRLRLLPRSGLRERSRFAAGERERERER 449
             R R   R   RER R    +++  R+R
Sbjct: 1107 DRERDRERDRDRERGRDYRKDKDHRRDR 1134

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 30/86 (34%), Positives = 35/86 (39%), Gaps = 2/86 (2%)
 Frame = -2

Query: 700  RSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASSSRPRSR-RSSSRSRSR-RSSLSGR 527
            R RS+ R   R R R R R  R   R R   R     R R R R   R R R R     R
Sbjct: 1054 RDRSKDRERDRDRERDRERD-RERDRERDRDRERDRERDRDRERDRDRERERDRDRERDR 1112

Query: 526  LRLLPRSGLRERSRFAAGERERERER 449
             R   R   R+  +     R+RER+R
Sbjct: 1113 ERDRDRERGRDYRKDKDHRRDRERDR 1138

>ref|NP_055885.2| KIAA0853 protein [Homo sapiens] gi|30908950|gb|AAP37483.1|
            hypothetical protein [Homo sapiens]
          Length = 1564

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 56/132 (42%), Positives = 79/132 (59%), Gaps = 3/132 (2%)
 Frame = +3

Query: 411  ARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP-DRDDRRDRDREEER-RDR 584
            AR   R   R   R R R R    +RE+ R  ER   R R  +R+  RDR+R+ +R  DR
Sbjct: 676  ARERDRERERDRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDR 735

Query: 585  GRDEEARRGGDRDRRGDRPDRDRERDRDRERDRDRDRERPDRSDRDKERERVDRDRDGPE 764
             R+ E  R  +++R  +R +R+RER+R+RER+R+R+RER    +RDKERE   R RD  +
Sbjct: 736  ERERERERDREKEREREREERERERERERERERERERERERARERDKERE---RQRDWED 792

Query: 765  RDR-RDDGGRKR 797
            +D+ RDD   KR
Sbjct: 793  KDKGRDDRREKR 804

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 63/159 (39%), Positives = 84/159 (52%), Gaps = 23/159 (14%)
 Frame = +3

Query: 390  QHK*SPFARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRS--RPDR-DDRRD-- 554
            Q + S F RR   R  R       R  SP   + R+   ER  +R   R DR DDRRD  
Sbjct: 616  QARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDER 675

Query: 555  ---RDREEERRDRGRDEEARRGGDRDRRGDRP---------------DRDRERDRDRERD 680
               RDRE ER DR R+ E  R  DR+R  +R                +RDRERDRDR+ D
Sbjct: 676  ARERDRERER-DRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHD 734

Query: 681  RDRDRERPDRSDRDKERERVDRDRDGPERDRRDDGGRKR 797
            R+R+RER    ++++ERER +R+R+  ER+R  +  R+R
Sbjct: 735  RERERERERDREKEREREREERERE-RERERERERERER 772

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 55/137 (40%), Positives = 77/137 (56%), Gaps = 9/137 (6%)
 Frame = +3

Query: 414  RRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEER-----R 578
            R   R   R+  + R   R  A +RER R  ER  +R R DRD  R+R+RE ER     R
Sbjct: 691  RERERERDREREKERELERERAREREREREKERDRERDR-DRDHDRERERERERDREKER 749

Query: 579  DRGRDEEAR-RGGDRDRRGDRP-DRDRERDRDRERDRDRDRERPD--RSDRDKERERVDR 746
            +R R+E  R R  +R+R  +R  +R+R R+RD+ER+R RD E  D  R DR ++RE +  
Sbjct: 750  EREREERERERERERERERERERERERARERDKERERQRDWEDKDKGRDDRREKREEIRE 809

Query: 747  DRDGPERDRRDDGGRKR 797
            DR+   RD  D+   K+
Sbjct: 810  DRN--PRDGHDERKSKK 824

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 54/121 (44%), Positives = 70/121 (57%), Gaps = 18/121 (14%)
 Frame = +3

Query: 465  SRSPAAKRERSRSPERGSKRSRPDRD----------DRRDRDREEERRDRGRDEEARRGG 614
            SRS ++ R+ SRS    S+RS P+ D          D RDR +E +R +  R+ E  R  
Sbjct: 1260 SRSTSSDRQDSRS--HSSRRSSPESDRQVHSRSGSFDSRDRLQERDRYEHDRERERERRD 1317

Query: 615  DRDRRGDRP-DRD--RERDRDRERDRDRDRERPDRSDRDKERER-----VDRDRDGPERD 770
             R R  DR  D+D  R RDRDR R+R+R+RER  R D D+ERER     V+RDRD  +RD
Sbjct: 1318 TRQREWDRDADKDWPRNRDRDRLRERERERERDKRRDLDRERERLISDSVERDRD-RDRD 1376

Query: 771  R 773
            R
Sbjct: 1377 R 1377

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 55/140 (39%), Positives = 77/140 (54%), Gaps = 9/140 (6%)
 Frame = +3

Query: 405  PFARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP----DRDDRRDRD--RE 566
            P   R   R +R   R  S  R    +R+R  + ER  + S P     R+D  +RD  RE
Sbjct: 603  PERDRYPERDNRDQARDSSFERRHG-ERDRRDNRERDQRPSSPIRHQGRNDELERDERRE 661

Query: 567  EERRDRGRDEEARRGGDRDRRGDRP---DRDRERDRDRERDRDRDRERPDRSDRDKERER 737
            E R DR  D    R  +RDR  +R    +R+RER+RDRER+++R+ ER    +R++ERE+
Sbjct: 662  ERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERAREREREREK 721

Query: 738  VDRDRDGPERDRRDDGGRKR 797
             +RDR   ERDR  D  R+R
Sbjct: 722  -ERDR---ERDRDRDHDRER 737

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 45/125 (36%), Positives = 65/125 (52%), Gaps = 12/125 (9%)
 Frame = +3

Query: 414  RRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP-DRDDRRDRDREEERRDRGR 590
            R   R   R+  R R R R     RER R  +   +R R  +RD  ++R+RE E R+R R
Sbjct: 701  REKERELERERAREREREREKERDRERDRDRDHDRERERERERDREKEREREREERERER 760

Query: 591  DEEARRGGDRDRRGDRP-DRDRERDR-----DRERDRDRDRE-----RPDRSDRDKERER 737
            + E  R  +R+R  +R  +RD+ER+R     D+++ RD  RE     R DR+ RD   ER
Sbjct: 761  ERERERERERERERERARERDKERERQRDWEDKDKGRDDRREKREEIREDRNPRDGHDER 820

Query: 738  VDRDR 752
              + R
Sbjct: 821  KSKKR 825

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 60/190 (31%), Positives = 83/190 (43%), Gaps = 64/190 (33%)
 Frame = +3

Query: 420  ASRRGSRQMGRSRSRSRSPAAKRERSRS-----PERGSKRSRPDRDD------------- 545
            +SR   R   R+ SRS     +  RSR      PE+GS+ SR  + D             
Sbjct: 538  SSRTEIRNESRNESRSEIRNDRMGRSRGRVPELPEKGSRGSRGSQIDSHSSNSNYHDSWE 597

Query: 546  ------RRDRDREEERRDRGRDEE-ARRGGDRDRRGD----------------------- 635
                   RDR  E + RD+ RD    RR G+RDRR +                       
Sbjct: 598  TRSSYPERDRYPERDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERD 657

Query: 636  --------------RPDRDRERDRDRERDRDRDRERPDRSDRDKERER-VDRDRDGP-ER 767
                          R +R RERDR+RERDR+R+RER    DR++E+ER ++R+R    ER
Sbjct: 658  ERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERARERER 717

Query: 768  DRRDDGGRKR 797
            +R  +  R+R
Sbjct: 718  EREKERDRER 727

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 71/204 (34%), Positives = 101/204 (48%), Gaps = 13/204 (6%)
 Frame = +3

Query: 198  GRVRA-TNSAAHNKCVQQPA*DRSL-SGLRPSPLRLCFRSSAILNTA*APVESLH--EPG 365
            GR+R+ +N +AH     Q    R L SG R    R   +S  I     + ++ L   EP 
Sbjct: 1204 GRLRSPSNDSAHRSGDDQSGRKRVLHSGSRD---REKTKSLEITGERKSRIDQLKRGEP- 1259

Query: 366  ARSCASEIQHK*SPFARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDD 545
            +RS +S+ Q   S  +RR+S    RQ+  SRS S     + +     E   +R R  RD 
Sbjct: 1260 SRSTSSDRQDSRSHSSRRSSPESDRQV-HSRSGSFDSRDRLQERDRYEHDRERERERRDT 1318

Query: 546  RR---DRDREEE---RRDRGRDEEARRGGDRDRRGDRPDRDRER--DRDRERDRDRDRER 701
            R+   DRD +++    RDR R  E  R  +RD+R D  DR+RER      ERDRDRDR+R
Sbjct: 1319 RQREWDRDADKDWPRNRDRDRLRERERERERDKRRDL-DRERERLISDSVERDRDRDRDR 1377

Query: 702  PDRSDRDKERERVDRDRDGP-ERD 770
               S + +  +R +   +G  ERD
Sbjct: 1378 TFESSQIESVKRCEAKLEGEHERD 1401

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 62/208 (29%), Positives = 85/208 (40%), Gaps = 13/208 (6%)
 Frame = +3

Query: 198 GRVRATNSAAHNKCVQQPA*DRSLSGLRPSPLRLCFRSSAILNTA*APVESLHEPGARSC 377
           G+  +  S+ H+    Q     S+    PSP R    S +   T   P+     P     
Sbjct: 321 GQHHSPISSRHHSSSSQSG--SSIQRHSPSPRRKRTPSPSYQRTLTPPLRRSASPYPSHS 378

Query: 378 ASEIQHK*SPFARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDR 557
            S  Q K SP   R+  R   + GR      S +  R   R  +   KR R ++D R +R
Sbjct: 379 LSSPQRKQSPPRHRSPMR---EKGRHDHERTSQSHDRRHERREDTRGKRDR-EKDSREER 434

Query: 558 DREEER---RDRGRDEEARRGGDRDRRGDRPDRDRERDRDRERDRD----RDRERPDRSD 716
           + E+++   RD   D E R G  RDRR  R  RDR   RD    RD    RD  R  +  
Sbjct: 435 EYEQDQSSSRDHRDDREPRDG--RDRRDARDTRDRRELRDSRDMRDSREMRDYSRDTKES 492

Query: 717 RDKERERVD------RDRDGPERDRRDD 782
           RD    R        RDR+G +  R++D
Sbjct: 493 RDPRDSRSTRDAHDYRDREGRDTHRKED 520

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 58/157 (36%), Positives = 78/157 (48%), Gaps = 25/157 (15%)
 Frame = +3

Query: 402  SPFARRASRRGSRQMGRSRSRSRSPAAKRERSRSPE-RGSKRSRPDR-----------DD 545
            SP    A R G  Q GR R    S +  RE+++S E  G ++SR D+            D
Sbjct: 1208 SPSNDSAHRSGDDQSGRKRVL-HSGSRDREKTKSLEITGERKSRIDQLKRGEPSRSTSSD 1266

Query: 546  RRDRDREEERR---DRGRDEEARRGG--DRDRRGDRP----DRDRERD----RDRERDRD 686
            R+D      RR   +  R   +R G    RDR  +R     DR+RER+    R RE DRD
Sbjct: 1267 RQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQERDRYEHDRERERERRDTRQREWDRD 1326

Query: 687  RDRERPDRSDRDKERERVDRDRDGPERDRRDDGGRKR 797
             D++ P   DRD+ RER +R+R   ERD+R D  R+R
Sbjct: 1327 ADKDWPRNRDRDRLRER-ERER---ERDKRRDLDRER 1359

 Score = 52.4 bits (124), Expect = 8e-06
 Identities = 38/125 (30%), Positives = 57/125 (45%), Gaps = 12/125 (9%)
 Frame = +3

Query: 417  RASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP--------DRDDRRDRDREEE 572
            R   R  R+  R R R R    +RER R+ ER  +R R          RDDRR++ REE 
Sbjct: 749  REREREERERERERERERERERERERERARERDKERERQRDWEDKDKGRDDRREK-REEI 807

Query: 573  RRDR----GRDEEARRGGDRDRRGDRPDRDRERDRDRERDRDRDRERPDRSDRDKERERV 740
            R DR    G DE   +   R+     P +  +R R+   D D      D++++ +   +V
Sbjct: 808  REDRNPRDGHDERKSKKRYRNEGSPSPRQSPKRRREHSPDSDAYNSGDDKNEKHRLLSQV 867

Query: 741  DRDRD 755
             R ++
Sbjct: 868  VRPQE 872

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 37/126 (29%), Positives = 52/126 (40%)
 Frame = +3

Query: 417  RASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEERRDRGRDE 596
            R      R+  R R R R    +RER+R           +RD  R+R R+ E +D+GRD+
Sbjct: 751  REREERERERERERERERERERERERAR-----------ERDKERERQRDWEDKDKGRDD 799

Query: 597  EARRGGDRDRRGDRPDRDRERDRDRERDRDRDRERPDRSDRDKERERVDRDRDGPERDRR 776
              RR    + R DR  RD     D  + + R R     S R   + R +   D    +  
Sbjct: 800  --RREKREEIREDRNPRD---GHDERKSKKRYRNEGSPSPRQSPKRRREHSPDSDAYNSG 854

Query: 777  DDGGRK 794
            DD   K
Sbjct: 855  DDKNEK 860

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 38/113 (33%), Positives = 43/113 (37%), Gaps = 5/113 (4%)
 Frame = -2

Query: 772  RSRSGPSRSLSTRSRSLSLSLRSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASS 593
            R+R         R R         R R + R L R R+R R R  R   R R   R    
Sbjct: 675  RARERDRERERDRERERERERERDREREKERELERERARERERE-REKERDRERDRDRDH 733

Query: 592  SRPRSR-----RSSSRSRSRRSSLSGRLRLLPRSGLRERSRFAAGERERERER 449
             R R R     R   R R R      R R   R   RER R  A ER++ERER
Sbjct: 734  DRERERERERDREKEREREREERERERERERERERERERERERARERDKERER 786

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 45/122 (36%), Positives = 58/122 (46%), Gaps = 11/122 (9%)
 Frame = -2

Query: 781  SSRRSRSGPSRSLSTRSRSLSLSLRSGRSR-----SRSRSLSRSRSRSRSRSGRSPRRSR 617
            S+R   SG  RS S  S   S   +SGR R     SR R  ++S   +  R  R  +  R
Sbjct: 1197 SNRSHTSGRLRSPSNDSAHRSGDDQSGRKRVLHSGSRDREKTKSLEITGERKSRIDQLKR 1256

Query: 616  SPPRRASSSRPR------SRRSSSRSRSRRSSLSGRLRLLPRSGLRERSRFAAGERERER 455
              P R++SS  +      SRRSS  S  +  S SG      R  L+ER R+   +RERER
Sbjct: 1257 GEPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGSFD--SRDRLQERDRY-EHDRERER 1313

Query: 454  ER 449
            ER
Sbjct: 1314 ER 1315

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 42/129 (32%), Positives = 51/129 (38%), Gaps = 17/129 (13%)
 Frame = +3

Query: 456 RSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEER---------RDRGRDEEARR 608
           R   R      E SRS  R   R    R + R+  R E R         R RGR  E   
Sbjct: 513 RDTHRKEDTYPEESRSYGRNHLREESSRTEIRNESRNESRSEIRNDRMGRSRGRVPELPE 572

Query: 609 GGDRDRRGDRPD--------RDRERDRDRERDRDRDRERPDRSDRDKERERVDRDRDGPE 764
            G R  RG + D         D    R    +RDR    P+R +RD+ R+     R G E
Sbjct: 573 KGSRGSRGSQIDSHSSNSNYHDSWETRSSYPERDR---YPERDNRDQARDSSFERRHG-E 628

Query: 765 RDRRDDGGR 791
           RDRRD+  R
Sbjct: 629 RDRRDNRER 637

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 39/125 (31%), Positives = 51/125 (40%), Gaps = 13/125 (10%)
 Frame = +3

Query: 414  RRASRRGSRQMGRSRS------RSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEER 575
            R   RR +RQ    R       R+R     RER R  E         RD RRD DRE ER
Sbjct: 1311 RERERRDTRQREWDRDADKDWPRNRDRDRLRERERERE---------RDKRRDLDRERER 1361

Query: 576  -------RDRGRDEEARRGGDRDRRGDRPDRDRERDRDRERDRDRDRERPDRSDRDKERE 734
                   RDR RD       DR     + +  +  +   E + +RD E   R     ++E
Sbjct: 1362 LISDSVERDRDRDR------DRTFESSQIESVKRCEAKLEGEHERDLESTSRDSLALDKE 1415

Query: 735  RVDRD 749
            R+D+D
Sbjct: 1416 RMDKD 1420

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 40/124 (32%), Positives = 55/124 (44%), Gaps = 7/124 (5%)
 Frame = -2

Query: 787 PPSSRRSRSGPSRSLSTRSRSLSLSLRSGRSRSRSRSLS----RSRSRSRSRSGRSPRRS 620
           P SSR   S      S +  S S   +   S S  R+L+    RS S   S S  SP+R 
Sbjct: 326 PISSRHHSSSSQSGSSIQRHSPSPRRKRTPSPSYQRTLTPPLRRSASPYPSHSLSSPQRK 385

Query: 619 RSPPRRASSSRPRSRRS---SSRSRSRRSSLSGRLRLLPRSGLRERSRFAAGERERERER 449
           +SPPR  S  R + R     +S+S  RR       R     G R+R + +  ERE E+++
Sbjct: 386 QSPPRHRSPMREKGRHDHERTSQSHDRRHE-----RREDTRGKRDREKDSREEREYEQDQ 440

Query: 448 PICR 437
              R
Sbjct: 441 SSSR 444

 Score = 39.3 bits (90), Expect = 0.074
 Identities = 35/102 (34%), Positives = 43/102 (41%), Gaps = 3/102 (2%)
 Frame = -2

Query: 733  SRSLSLSLRSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPR---RASSSRPRSRRSSS 563
            SRS S   +  RS S  RS   S  +  SRSG    R R   R        R R RR + 
Sbjct: 1260 SRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQERDRYEHDRERERERRDTR 1319

Query: 562  RSRSRRSSLSGRLRLLPRSGLRERSRFAAGERERERERPICR 437
            +    R +     R   R  LRER R    ERER++ R + R
Sbjct: 1320 QREWDRDADKDWPRNRDRDRLRERER----ERERDKRRDLDR 1357

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 31/88 (35%), Positives = 34/88 (38%), Gaps = 1/88 (1%)
 Frame = -2

Query: 709 RSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASSSRPRSR-RSSSRSRSRRSSLS 533
           R  R+R R R   R R R R R  R   R R   R     R R R R   + R R     
Sbjct: 672 RDERARERDRERERDRERERERE-RERDREREKERELERERAREREREREKERDRE---- 726

Query: 532 GRLRLLPRSGLRERSRFAAGERERERER 449
                      R+R R    ERERERER
Sbjct: 727 -----------RDRDRDHDRERERERER 743

 Score = 37.7 bits (86), Expect = 0.22
 Identities = 26/84 (30%), Positives = 31/84 (35%)
 Frame = -2

Query: 700 RSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASSSRPRSRRSSSRSRSRRSSLSGRLR 521
           R + R+  L R   R   R  R   R     R     R R R         R     + R
Sbjct: 646 RHQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKER 705

Query: 520 LLPRSGLRERSRFAAGERERERER 449
            L R   RER R    ER+RER+R
Sbjct: 706 ELERERAREREREREKERDRERDR 729

 Score = 37.7 bits (86), Expect = 0.22
 Identities = 27/87 (31%), Positives = 31/87 (35%)
 Frame = -2

Query: 709 RSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASSSRPRSRRSSSRSRSRRSSLSG 530
           R  R ++R  S  R       R  R   +  S P R         R   R   R   +  
Sbjct: 611 RDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRVDD 670

Query: 529 RLRLLPRSGLRERSRFAAGERERERER 449
           R     R   RER R    ERERERER
Sbjct: 671 RRDERARERDRERERDRERERERERER 697

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 43/124 (34%), Positives = 51/124 (40%), Gaps = 8/124 (6%)
 Frame = -2

Query: 796  RLRPPSSRRSRSGPSRSLSTRSRS----LSLSLRSGRSRSRSRSLSRSR---SRSRSRSG 638
            R  P  S  S    SRS S+R  S      +  RSG   SR R   R R    R R R  
Sbjct: 1256 RGEPSRSTSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQERDRYEHDRERERER 1315

Query: 637  RSPRRSRSPPRRASSSRPRSR-RSSSRSRSRRSSLSGRLRLLPRSGLRERSRFAAGERER 461
            R  R+ R   R A    PR+R R   R R R      R R L R   R  S     +R+R
Sbjct: 1316 RDTRQ-REWDRDADKDWPRNRDRDRLRERERERERDKR-RDLDRERERLISDSVERDRDR 1373

Query: 460  ERER 449
            +R+R
Sbjct: 1374 DRDR 1377

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 31/88 (35%), Positives = 34/88 (38%), Gaps = 1/88 (1%)
 Frame = -2

Query: 709 RSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASSSRPRSR-RSSSRSRSRRSSLS 533
           R  R  S  R   R+    R       R  R   RR   +R R R R   R R R     
Sbjct: 637 RDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERE-- 694

Query: 532 GRLRLLPRSGLRERSRFAAGERERERER 449
            R R   R   RE  R  A ERERERE+
Sbjct: 695 -RERDREREKERELERERAREREREREK 721

>emb|CAD38544.1| hypothetical protein [Homo sapiens]
          Length = 796

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 56/132 (42%), Positives = 79/132 (59%), Gaps = 3/132 (2%)
 Frame = +3

Query: 411 ARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP-DRDDRRDRDREEER-RDR 584
           AR   R   R   R R R R    +RE+ R  ER   R R  +R+  RDR+R+ +R  DR
Sbjct: 501 ARERDRERERDRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHDR 560

Query: 585 GRDEEARRGGDRDRRGDRPDRDRERDRDRERDRDRDRERPDRSDRDKERERVDRDRDGPE 764
            R+ E  R  +++R  +R +R+RER+R+RER+R+R+RER    +RDKERE   R RD  +
Sbjct: 561 ERERERERDREKEREREREERERERERERERERERERERERARERDKERE---RQRDWED 617

Query: 765 RDR-RDDGGRKR 797
           +D+ RDD   KR
Sbjct: 618 KDKGRDDRREKR 629

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 63/159 (39%), Positives = 84/159 (52%), Gaps = 23/159 (14%)
 Frame = +3

Query: 390 QHK*SPFARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRS--RPDR-DDRRD-- 554
           Q + S F RR   R  R       R  SP   + R+   ER  +R   R DR DDRRD  
Sbjct: 441 QARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDER 500

Query: 555 ---RDREEERRDRGRDEEARRGGDRDRRGDRP---------------DRDRERDRDRERD 680
              RDRE ER DR R+ E  R  DR+R  +R                +RDRERDRDR+ D
Sbjct: 501 ARERDRERER-DRERERERERERDREREKERELERERAREREREREKERDRERDRDRDHD 559

Query: 681 RDRDRERPDRSDRDKERERVDRDRDGPERDRRDDGGRKR 797
           R+R+RER    ++++ERER +R+R+  ER+R  +  R+R
Sbjct: 560 RERERERERDREKEREREREERERE-RERERERERERER 597

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 55/137 (40%), Positives = 77/137 (56%), Gaps = 9/137 (6%)
 Frame = +3

Query: 414 RRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEER-----R 578
           R   R   R+  + R   R  A +RER R  ER  +R R DRD  R+R+RE ER     R
Sbjct: 516 RERERERDREREKERELERERAREREREREKERDRERDR-DRDHDRERERERERDREKER 574

Query: 579 DRGRDEEAR-RGGDRDRRGDRP-DRDRERDRDRERDRDRDRERPD--RSDRDKERERVDR 746
           +R R+E  R R  +R+R  +R  +R+R R+RD+ER+R RD E  D  R DR ++RE +  
Sbjct: 575 EREREERERERERERERERERERERERARERDKERERQRDWEDKDKGRDDRREKREEIRE 634

Query: 747 DRDGPERDRRDDGGRKR 797
           DR+   RD  D+   K+
Sbjct: 635 DRN--PRDGHDERKSKK 649

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 55/140 (39%), Positives = 77/140 (54%), Gaps = 9/140 (6%)
 Frame = +3

Query: 405 PFARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP----DRDDRRDRD--RE 566
           P   R   R +R   R  S  R    +R+R  + ER  + S P     R+D  +RD  RE
Sbjct: 428 PERDRYPERDNRDQARDSSFERRHG-ERDRRDNRERDQRPSSPIRHQGRNDELERDERRE 486

Query: 567 EERRDRGRDEEARRGGDRDRRGDRP---DRDRERDRDRERDRDRDRERPDRSDRDKERER 737
           E R DR  D    R  +RDR  +R    +R+RER+RDRER+++R+ ER    +R++ERE+
Sbjct: 487 ERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERAREREREREK 546

Query: 738 VDRDRDGPERDRRDDGGRKR 797
            +RDR   ERDR  D  R+R
Sbjct: 547 -ERDR---ERDRDRDHDRER 562

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 45/125 (36%), Positives = 65/125 (52%), Gaps = 12/125 (9%)
 Frame = +3

Query: 414 RRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP-DRDDRRDRDREEERRDRGR 590
           R   R   R+  R R R R     RER R  +   +R R  +RD  ++R+RE E R+R R
Sbjct: 526 REKERELERERAREREREREKERDRERDRDRDHDRERERERERDREKEREREREERERER 585

Query: 591 DEEARRGGDRDRRGDRP-DRDRERDR-----DRERDRDRDRE-----RPDRSDRDKERER 737
           + E  R  +R+R  +R  +RD+ER+R     D+++ RD  RE     R DR+ RD   ER
Sbjct: 586 ERERERERERERERERARERDKERERQRDWEDKDKGRDDRREKREEIREDRNPRDGHDER 645

Query: 738 VDRDR 752
             + R
Sbjct: 646 KSKKR 650

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 60/190 (31%), Positives = 83/190 (43%), Gaps = 64/190 (33%)
 Frame = +3

Query: 420 ASRRGSRQMGRSRSRSRSPAAKRERSRS-----PERGSKRSRPDRDD------------- 545
           +SR   R   R+ SRS     +  RSR      PE+GS+ SR  + D             
Sbjct: 363 SSRTEIRNESRNESRSEIRNDRMGRSRGRVPELPEKGSRGSRGSQIDSHSSNSNYHDSWE 422

Query: 546 ------RRDRDREEERRDRGRDEE-ARRGGDRDRRGD----------------------- 635
                  RDR  E + RD+ RD    RR G+RDRR +                       
Sbjct: 423 TRSSYPERDRYPERDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERD 482

Query: 636 --------------RPDRDRERDRDRERDRDRDRERPDRSDRDKERER-VDRDRDGP-ER 767
                         R +R RERDR+RERDR+R+RER    DR++E+ER ++R+R    ER
Sbjct: 483 ERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERARERER 542

Query: 768 DRRDDGGRKR 797
           +R  +  R+R
Sbjct: 543 EREKERDRER 552

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 62/208 (29%), Positives = 85/208 (40%), Gaps = 13/208 (6%)
 Frame = +3

Query: 198 GRVRATNSAAHNKCVQQPA*DRSLSGLRPSPLRLCFRSSAILNTA*APVESLHEPGARSC 377
           G+  +  S+ H+    Q     S+    PSP R    S +   T   P+     P     
Sbjct: 146 GQHHSPISSRHHSSSSQSG--SSIQRHSPSPRRKRTPSPSYQRTLTPPLRRSASPYPSHS 203

Query: 378 ASEIQHK*SPFARRASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDR 557
            S  Q K SP   R+  R   + GR      S +  R   R  +   KR R ++D R +R
Sbjct: 204 LSSPQRKQSPPRHRSPMR---EKGRHDHERTSQSHDRRHERREDTRGKRDR-EKDSREER 259

Query: 558 DREEER---RDRGRDEEARRGGDRDRRGDRPDRDRERDRDRERDRD----RDRERPDRSD 716
           + E+++   RD   D E R G  RDRR  R  RDR   RD    RD    RD  R  +  
Sbjct: 260 EYEQDQSSSRDHRDDREPRDG--RDRRDARDTRDRRELRDSRDMRDSREMRDYSRDTKES 317

Query: 717 RDKERERVD------RDRDGPERDRRDD 782
           RD    R        RDR+G +  R++D
Sbjct: 318 RDPRDSRSTRDAHDYRDREGRDTHRKED 345

 Score = 52.4 bits (124), Expect = 8e-06
 Identities = 38/125 (30%), Positives = 57/125 (45%), Gaps = 12/125 (9%)
 Frame = +3

Query: 417 RASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRP--------DRDDRRDRDREEE 572
           R   R  R+  R R R R    +RER R+ ER  +R R          RDDRR++ REE 
Sbjct: 574 REREREERERERERERERERERERERERARERDKERERQRDWEDKDKGRDDRREK-REEI 632

Query: 573 RRDR----GRDEEARRGGDRDRRGDRPDRDRERDRDRERDRDRDRERPDRSDRDKERERV 740
           R DR    G DE   +   R+     P +  +R R+   D D      D++++ +   +V
Sbjct: 633 REDRNPRDGHDERKSKKRYRNEGSPSPRQSPKRRREHSPDSDAYNSGDDKNEKHRLLSQV 692

Query: 741 DRDRD 755
            R ++
Sbjct: 693 VRPQE 697

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 37/126 (29%), Positives = 52/126 (40%)
 Frame = +3

Query: 417 RASRRGSRQMGRSRSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEERRDRGRDE 596
           R      R+  R R R R    +RER+R           +RD  R+R R+ E +D+GRD+
Sbjct: 576 REREERERERERERERERERERERERAR-----------ERDKERERQRDWEDKDKGRDD 624

Query: 597 EARRGGDRDRRGDRPDRDRERDRDRERDRDRDRERPDRSDRDKERERVDRDRDGPERDRR 776
             RR    + R DR  RD     D  + + R R     S R   + R +   D    +  
Sbjct: 625 --RREKREEIREDRNPRD---GHDERKSKKRYRNEGSPSPRQSPKRRREHSPDSDAYNSG 679

Query: 777 DDGGRK 794
           DD   K
Sbjct: 680 DDKNEK 685

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 38/113 (33%), Positives = 43/113 (37%), Gaps = 5/113 (4%)
 Frame = -2

Query: 772 RSRSGPSRSLSTRSRSLSLSLRSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASS 593
           R+R         R R         R R + R L R R+R R R  R   R R   R    
Sbjct: 500 RARERDRERERDRERERERERERDREREKERELERERARERERE-REKERDRERDRDRDH 558

Query: 592 SRPRSR-----RSSSRSRSRRSSLSGRLRLLPRSGLRERSRFAAGERERERER 449
            R R R     R   R R R      R R   R   RER R  A ER++ERER
Sbjct: 559 DRERERERERDREKEREREREERERERERERERERERERERERARERDKERER 611

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 42/129 (32%), Positives = 51/129 (38%), Gaps = 17/129 (13%)
 Frame = +3

Query: 456 RSRSRSPAAKRERSRSPERGSKRSRPDRDDRRDRDREEER---------RDRGRDEEARR 608
           R   R      E SRS  R   R    R + R+  R E R         R RGR  E   
Sbjct: 338 RDTHRKEDTYPEESRSYGRNHLREESSRTEIRNESRNESRSEIRNDRMGRSRGRVPELPE 397

Query: 609 GGDRDRRGDRPD--------RDRERDRDRERDRDRDRERPDRSDRDKERERVDRDRDGPE 764
            G R  RG + D         D    R    +RDR    P+R +RD+ R+     R G E
Sbjct: 398 KGSRGSRGSQIDSHSSNSNYHDSWETRSSYPERDR---YPERDNRDQARDSSFERRHG-E 453

Query: 765 RDRRDDGGR 791
           RDRRD+  R
Sbjct: 454 RDRRDNRER 462

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 40/124 (32%), Positives = 55/124 (44%), Gaps = 7/124 (5%)
 Frame = -2

Query: 787 PPSSRRSRSGPSRSLSTRSRSLSLSLRSGRSRSRSRSLS----RSRSRSRSRSGRSPRRS 620
           P SSR   S      S +  S S   +   S S  R+L+    RS S   S S  SP+R 
Sbjct: 151 PISSRHHSSSSQSGSSIQRHSPSPRRKRTPSPSYQRTLTPPLRRSASPYPSHSLSSPQRK 210

Query: 619 RSPPRRASSSRPRSRRS---SSRSRSRRSSLSGRLRLLPRSGLRERSRFAAGERERERER 449
           +SPPR  S  R + R     +S+S  RR       R     G R+R + +  ERE E+++
Sbjct: 211 QSPPRHRSPMREKGRHDHERTSQSHDRRHE-----RREDTRGKRDREKDSREEREYEQDQ 265

Query: 448 PICR 437
              R
Sbjct: 266 SSSR 269

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 31/88 (35%), Positives = 34/88 (38%), Gaps = 1/88 (1%)
 Frame = -2

Query: 709 RSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASSSRPRSR-RSSSRSRSRRSSLS 533
           R  R+R R R   R R R R R  R   R R   R     R R R R   + R R     
Sbjct: 497 RDERARERDRERERDRERERERE-RERDREREKERELERERAREREREREKERDRE---- 551

Query: 532 GRLRLLPRSGLRERSRFAAGERERERER 449
                      R+R R    ERERERER
Sbjct: 552 -----------RDRDRDHDRERERERER 568

 Score = 37.7 bits (86), Expect = 0.22
 Identities = 27/87 (31%), Positives = 31/87 (35%)
 Frame = -2

Query: 709 RSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASSSRPRSRRSSSRSRSRRSSLSG 530
           R  R ++R  S  R       R  R   +  S P R         R   R   R   +  
Sbjct: 436 RDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERREERRVDRVDD 495

Query: 529 RLRLLPRSGLRERSRFAAGERERERER 449
           R     R   RER R    ERERERER
Sbjct: 496 RRDERARERDRERERDRERERERERER 522

 Score = 37.7 bits (86), Expect = 0.22
 Identities = 26/84 (30%), Positives = 31/84 (35%)
 Frame = -2

Query: 700 RSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASSSRPRSRRSSSRSRSRRSSLSGRLR 521
           R + R+  L R   R   R  R   R     R     R R R         R     + R
Sbjct: 471 RHQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERERERDREREKER 530

Query: 520 LLPRSGLRERSRFAAGERERERER 449
            L R   RER R    ER+RER+R
Sbjct: 531 ELERERAREREREREKERDRERDR 554

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 31/88 (35%), Positives = 34/88 (38%), Gaps = 1/88 (1%)
 Frame = -2

Query: 709 RSGRSRSRSRSLSRSRSRSRSRSGRSPRRSRSPPRRASSSRPRSR-RSSSRSRSRRSSLS 533
           R  R  S  R   R+    R       R  R   RR   +R R R R   R R R     
Sbjct: 462 RDQRPSSPIRHQGRNDELERDERREERRVDRVDDRRDERARERDRERERDRERERERE-- 519

Query: 532 GRLRLLPRSGLRERSRFAAGERERERER 449
            R R   R   RE  R  A ERERERE+
Sbjct: 520 -RERDREREKERELERERAREREREREK 546



EST assemble image


clone accession position
1 CL38e08_r AV395315 1 370
2 LCL067d09_r AV629847 235 625
3 LCL032f03_r AV627827 248 550
4 LCL035b04_r AV627998 248 735
5 MXL089f02_r BP098222 259 626
6 LCL053d10_r AV629164 265 665
7 LCL008b08_r AV626381 267 688
8 LCL002g12_r AV626129 271 577
9 LCL001g03_r AV626053 271 493
10 LCL002d05_r AV626101 279 592
11 LCL098h03_r AV631729 280 613
12 LCL077h02_r AV630365 295 537
13 MXL090h02_r BP098286 300 576
14 HCL034d07_r AV641482 315 797




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research