KCC000532A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000532A_C01 KCC000532A_c01
GCTATCGGTACCAAGCCTCTTGCTTTCGCTTTCGCTTCGCATCCTAGCTGAACCTAGTTC
AAAATAATCTAGAATGTGCCAGTTTGGCTTCATAGCAAACAATATACTGGAAAAGATATA
GTTGATTTCGCTTAGCGCGCTACGAACCAGCAGGGTGCGGGCGGGAGCACGATGCCAAAC
CGGGGCGACCGCACCTCCCCAACCACCCCCCGAACGGACGAGCCAAGCTCGCTGGCGGTA
GAGCAGCCCAATGTGTTTCGGCTGCAGTTACGACCCGTGGAGGACCCGGAAGGATTCAAG
CCTAGCGTGCAGCTTGTGTCGAGGGAGTTCGCCACGCGGTACCTGGAGCAAGTCGGGGTT
AGGCCAAGCAAGGCGACCCTTGACCTGGTGAACCGGAATGTGCCACTCTCGGAGGCCCAT
ATCAAAACTACGCTGCGAGCTAAGGGCCATGTGGAGGACGAGTTGCATATCACGGTGCCG
CCCGTGAACCACTCAT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000532A_C01 KCC000532A_c01
         (496 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAB17968.1| protein tyrosine phosphatase CRYP-2 [Gallus gallus]     39  0.035
ref|XP_352411.1| similar to KIAA0649 gene product [Homo sapiens]       37  0.10
ref|ZP_00014396.1| COG2207: AraC-type DNA-binding domain-contain...    36  0.30
pir||T28678 polyketide synthase - Streptomyces ambofaciens (frag...    35  0.39
ref|NP_522093.1| PUTATIVE AMINOPEPTIDASE TRANSMEMBRANE PROTEIN [...    35  0.66

>gb|AAB17968.1| protein tyrosine phosphatase CRYP-2 [Gallus gallus]
          Length = 1267

 Score = 38.9 bits (89), Expect = 0.035
 Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +3

Query: 144 EPAGCGREHDAKPGR-PHLPNHPPNGRAKLAGGRAAQCVSAAVTTRGGPG 290
           EP G GR   A  GR    P  PP GR++  G RA +C +AA   RGGPG
Sbjct: 13  EPGG-GRRGAAARGRGAEEPQPPPPGRSRGRGRRAPRCPTAAGGARGGPG 61

>ref|XP_352411.1| similar to KIAA0649 gene product [Homo sapiens]
          Length = 714

 Score = 37.4 bits (85), Expect = 0.10
 Identities = 30/91 (32%), Positives = 34/91 (36%), Gaps = 14/91 (15%)
 Frame = -1

Query: 409 RVAHSGSPGQGSPCLA*PRLAPGTAWRTPSTQAAR--------*A*ILPGP------PRV 272
           +   SG PGQ  PCL  P LA     R+P+ Q               LP P      P +
Sbjct: 490 KAKESGVPGQAQPCLWKPTLAGEEGLRSPAKQEGAWCYDSQDPKCGCLPDPTPTPKAPVL 549

Query: 271 VTAAETHWAALPPASLARPFGGWLGRCGRPG 179
           V A  THW  L PA            CG PG
Sbjct: 550 VPAVPTHWKKLAPA------------CGGPG 568

>ref|ZP_00014396.1| COG2207: AraC-type DNA-binding domain-containing proteins
           [Rhodospirillum rubrum]
          Length = 576

 Score = 35.8 bits (81), Expect = 0.30
 Identities = 41/114 (35%), Positives = 50/114 (42%), Gaps = 6/114 (5%)
 Frame = -2

Query: 480 RHRDMQLVLHMALSSQR-SFDMGLRE----W-HIPVHQVKGRLAWPNPDLLQVPRGELPR 319
           RHR  + +L +    +R +FD   R     W H  VH   GR   P P+    PR  LPR
Sbjct: 54  RHRHRRHLLGLVHFHRRPAFDRQYRHHVGLWRHRHVHHEHGRPLPPAPERAG-PRPSLPR 112

Query: 318 HKLHARLESFRVLHGS*LQPKHIGLLYRQRAWLVRSGGGWGGAVAPVWHRAPAR 157
             L   +   R  HG   +P H  LL     W VR   G G AV P+ HR  AR
Sbjct: 113 PVLSG-VSGDRPGHGGG-RPDHHDLLQPDGLWPVRRADGSGLAVLPL-HRPSAR 163

>pir||T28678 polyketide synthase - Streptomyces ambofaciens (fragment)
           gi|1228093|emb|CAA87011.1| polyketide synthase
           [Streptomyces ambofaciens]
          Length = 1198

 Score = 35.4 bits (80), Expect = 0.39
 Identities = 33/112 (29%), Positives = 43/112 (37%), Gaps = 1/112 (0%)
 Frame = +2

Query: 152 RVRAGARCQTGATAPPQPPPERTSQARWR*SSPMCFGCSYDPWRTRKDSSLACSLCRGS- 328
           R  A  R  T AT+ P PPP  +++ RW   SP C  C      T   +S   S+  G+ 
Sbjct: 519 RSPASGRPSTRATSSPWPPPRASTRRRW---SPCCRPCRPG---TATPASTRPSVPGGTG 572

Query: 329 SPRGTWSKSGLGQARRPLTW*TGMCHSRRPISKLRCELRAMWRTSCISRCRP 484
           SP   W       AR    W      +RR     R       R++C S   P
Sbjct: 573 SPGSPWRSRPRRPARDGGFWWLRTTPTRRSTPAARRSPNGRARSTCSSSTPP 624

>ref|NP_522093.1| PUTATIVE AMINOPEPTIDASE TRANSMEMBRANE PROTEIN [Ralstonia
           solanacearum] gi|17431002|emb|CAD17683.1| PUTATIVE
           AMINOPEPTIDASE TRANSMEMBRANE PROTEIN [Ralstonia
           solanacearum]
          Length = 748

 Score = 34.7 bits (78), Expect = 0.66
 Identities = 30/111 (27%), Positives = 45/111 (40%)
 Frame = +1

Query: 148 QQGAGGSTMPNRGDRTSPTTPRTDEPSSLAVEQPNVFRLQLRPVEDPEGFKPSVQLVSRE 327
           Q  AG S   + G  TS T   T  P+  A   P      ++PV     F+P+  L    
Sbjct: 64  QANAGTSPGTSTGTGTSTTGASTQTPAVDATVPPLELPAHIKPVNYKLWFRPNADLTG-- 121

Query: 328 FATRYLEQVGVRPSKATLDLVNRNVPLSEAHIKTTLRAKGHVEDELHITVP 480
           F+ R   ++ V      + L  RN+    A +  TL A G    ++ + VP
Sbjct: 122 FSGRADVEIKVTKQTGEITLAARNLRFDPARV--TLTATGSNTTQMLVPVP 170



EST assemble image


clone accession position
1 LCL016g11_r AV626860 1 190
2 CL38c12_r AV395328 1 496




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research