KCC000531A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000531A_C01 KCC000531A_c01
caccgagtcgcgcaacctgctgtgggacgaccaaaagatcgtggcgccgctcagtaccta
ctaCAACAGCTCCTACGTCCGCAACATCGTCTCTGCCGGCCGGCGCATGCTCGGATCCGT
CGACCTGAGCAAGTACCCTAACCTTAAGGGCATGTGCGAGGACACGTCGCTGTACGCCAA
CTGCTCCGCCATCGTGAACAGCAATGTCAACCGTGACCTTACAAGCGCACAATTCCATAT
GGCCTTCAAGAGCGAGTGGACTTTCGGAAACGCCAACTCCACCACGAAGGCGGACATCGC
AAACTCCAAGATCACCCGCCTACTGTTCGAGCGGCCCGTGCGCAAATACCTGTCGGAGTG
CTCAGAGACGCCCAACGCCACCACCTGCTACATTGGCGCAAACCTGGTGGACGTGTCGGG
CTGCCTGCCGTGCTACTGCTACGGGCTGAGCTAGCTGAACACCCAGGCCGCCACCACTGA
CTTCATCAACCACGTCAGCGACACGTGCAAGCAGTACTGGCAGCCCTTTGACCTGCAGCG
CGACGGCATCAAGGTTGCCATCTCTTTCGTGATCGCCATCATCAACTCCATCTTGGTGAC
CACGCTGCGCATTTCTAAGTTCTACATTGAACGCCACT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000531A_C01 KCC000531A_c01
         (638 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_523475.2| Salivary gland secretion 1 CG3047-PA [Drosophil...    69  8e-11
emb|CAC83675.1| mucin 5 [Homo sapiens]                                 65  1e-09
ref|XP_318717.1| ENSANGP00000004655 [Anopheles gambiae] gi|30174...    63  4e-09
pir||JW0067 chitinase (EC 3.2.1.14) A - Emericella nidulans            62  7e-09
dbj|BAA36223.1| chitinase [Aspergillus nidulans]                       61  1e-08

>ref|NP_523475.2| Salivary gland secretion 1 CG3047-PA [Drosophila melanogaster]
           gi|28380257|gb|AAF50957.3| CG3047-PA [Drosophila
           melanogaster]
          Length = 1225

 Score = 68.6 bits (166), Expect = 8e-11
 Identities = 64/208 (30%), Positives = 89/208 (42%), Gaps = 12/208 (5%)
 Frame = +3

Query: 3   PSRATCCGTTKRSWRRSVPTTTAPT-SATSSLPAGACSDPST*ASTLTLRACARTRRCTP 179
           P+  T   TT  + RR  PTTT P  + T+S  A   + P +  +T T R    T RCT 
Sbjct: 251 PTTTTPRSTTTTTTRR--PTTTTPRCTTTTSTCAPTTTTPRSTTTTTTSRPTTTTPRCTT 308

Query: 180 T----APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAY-CSSGPCA 344
           T    +P   T  ST T         +     + + T  RR T+ TPRS    C+SGP  
Sbjct: 309 TTSTCSPTRTTPRSTTTTSTSRPTTTTPRCTTTPSTTCTRRPTTTTPRSTTTTCTSGPTT 368

Query: 345 NTCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTS------STTSATR 506
            T RS     T  P T      T R+    + +G  + TPR    TS      +T  +T 
Sbjct: 369 TTPRSTTTTCTSGPTTT-----TPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTT 423

Query: 507 ASSTGSPLTCSATASRLPSLS*SPSSTP 590
            +ST  P T +  ++   S S   ++TP
Sbjct: 424 TTSTSGPTTTTPRSTTTTSTSGPTTTTP 451

 Score = 61.6 bits (148), Expect = 9e-09
 Identities = 57/180 (31%), Positives = 77/180 (42%), Gaps = 1/180 (0%)
 Frame = +3

Query: 51   SVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAMSTVTLQAH 230
            S PTTT P S T++  +G         +T T R+  +T  C PT     T  ST T    
Sbjct: 908  SCPTTTTPRSTTTTCTSGP--------TTTTPRSTTKTSTCAPTTT---TPRSTTTTSTS 956

Query: 231  NSIWPSRASGLSETPTPPRRRTSQTPRSPAYCS-SGPCANTCRSAQRRPTPPPATLAQTW 407
                P+  +  S T T   R T+ TPRS    S S P   T RS     T  P T     
Sbjct: 957  R---PTTTTPRSTTTTTTSRPTTTTPRSTTTPSTSRPTTTTPRSTTTTSTSRPTTTTPRS 1013

Query: 408  WTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCSATASRLPSLS*SPSST 587
             T  + C  T T     TPR     S+TT+ T   +T +P + + T +  P+ + +P ST
Sbjct: 1014 TTKTSTCAPTTT-----TPR-----STTTTTTSRPTTTTPRSTTTTTTSRPTTT-TPRST 1062

 Score = 55.1 bits (131), Expect = 9e-07
 Identities = 55/202 (27%), Positives = 81/202 (39%), Gaps = 7/202 (3%)
 Frame = +3

Query: 6   SRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTA 185
           S  T C +   +      TTT+ +  T++ P    +  ++  +T T R+   T    PT 
Sbjct: 373 STTTTCTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTT 432

Query: 186 PPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCS-SGPCANTCRSA 362
               T  ST T        P+  +  S T T     T+ TPRS    S SGP   T RS 
Sbjct: 433 T---TPRSTTTTSTSG---PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRST 486

Query: 363 QRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTS------STTSATRASSTGS 524
               T  P T      T R+    + +G  + TPR    TS      +T  +T  +ST  
Sbjct: 487 TTTSTSGPTTT-----TPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG 541

Query: 525 PLTCSATASRLPSLS*SPSSTP 590
           P T +  ++   S S   ++TP
Sbjct: 542 PTTTTPRSTTTTSTSGPTTTTP 563

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 55/202 (27%), Positives = 80/202 (39%), Gaps = 7/202 (3%)
 Frame = +3

Query: 6   SRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTA 185
           S  T C +   +      TTT  +  T++ P    +  ++  +T T R+   T    PT 
Sbjct: 357 STTTTCTSGPTTTTPRSTTTTCTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTT 416

Query: 186 PPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCS-SGPCANTCRSA 362
               T  ST T        P+  +  S T T     T+ TPRS    S SGP   T RS 
Sbjct: 417 T---TPRSTTTTSTSG---PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRST 470

Query: 363 QRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTS------STTSATRASSTGS 524
               T  P T      T R+    + +G  + TPR    TS      +T  +T  +ST  
Sbjct: 471 TTTSTSGPTTT-----TPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG 525

Query: 525 PLTCSATASRLPSLS*SPSSTP 590
           P T +  ++   S S   ++TP
Sbjct: 526 PTTTTPRSTTTTSTSGPTTTTP 547

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 56/190 (29%), Positives = 81/190 (42%), Gaps = 1/190 (0%)
 Frame = +3

Query: 27   TTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAM 206
            TT RS      TTT+ +  T++ P    +  ++  +T T R+   T    PT     T  
Sbjct: 817  TTPRS-----TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSCPTTT---TPR 868

Query: 207  STVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRS-PAYCSSGPCANTCRSAQRRPTPP 383
            ST T        P+  +  S T T     T+ TPRS    C+S P   T RS     T  
Sbjct: 869  STTTTCTSG---PTTTTPRSTTTTCTSCPTTTTPRSTTTTCTSCPTTTTPRSTTTTCTSG 925

Query: 384  PATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCSATASRLPS 563
            P T      T  + C  T T     TPR    +++TTS +R ++T    T + T SR  +
Sbjct: 926  PTTTTPRSTTKTSTCAPTTT-----TPR----STTTTSTSRPTTTTPRSTTTTTTSRPTT 976

Query: 564  LS*SPSSTPS 593
             +   ++TPS
Sbjct: 977  TTPRSTTTPS 986

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 57/205 (27%), Positives = 88/205 (42%), Gaps = 1/205 (0%)
 Frame = +3

Query: 27   TTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAM 206
            TT RS      TTT+ +  T++ P    +  ++  +T T R+   T    PT     T  
Sbjct: 721  TTPRS-----TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT---TPR 772

Query: 207  STVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCS-SGPCANTCRSAQRRPTPP 383
            ST T        P+  +  S T T     T+ TPRS    S SGP   T RS     T  
Sbjct: 773  STTTTSTSG---PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG 829

Query: 384  PATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCSATASRLPS 563
            P T      T R+    + +G  + TPR     S+TT++T   +T +P + + T +  P+
Sbjct: 830  PTTT-----TPRSTTTTSTSGPTTTTPR-----STTTTSTSCPTTTTPRSTTTTCTSGPT 879

Query: 564  LS*SPSSTPSW*PRCAFLSSTLNAT 638
             + +P ST +    C   ++  + T
Sbjct: 880  TT-TPRSTTTTCTSCPTTTTPRSTT 903

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 56/195 (28%), Positives = 80/195 (40%), Gaps = 7/195 (3%)
 Frame = +3

Query: 27   TTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAM 206
            TT RS      TTT+ +  T++ P    +  ++  +T T R+   T    PT     T  
Sbjct: 657  TTPRS-----TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT---TPR 708

Query: 207  STVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCS-SGPCANTCRSAQRRPTPP 383
            ST T        P+  +  S T T     T+ TPRS    S SGP   T RS     T  
Sbjct: 709  STTTTSTSG---PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG 765

Query: 384  PATLAQTWWTCRAACRATATG*AS*TPRPPPLTS------STTSATRASSTGSPLTCSAT 545
            P T      T R+    + +G  + TPR    TS      +T  +T  +ST  P T +  
Sbjct: 766  PTTT-----TPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPR 820

Query: 546  ASRLPSLS*SPSSTP 590
            ++   S S   ++TP
Sbjct: 821  STTTTSTSGPTTTTP 835

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 56/195 (28%), Positives = 80/195 (40%), Gaps = 7/195 (3%)
 Frame = +3

Query: 27   TTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAM 206
            TT RS      TTT+ +  T++ P    +  ++  +T T R+   T    PT     T  
Sbjct: 625  TTPRS-----TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT---TPR 676

Query: 207  STVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCS-SGPCANTCRSAQRRPTPP 383
            ST T        P+  +  S T T     T+ TPRS    S SGP   T RS     T  
Sbjct: 677  STTTTSTSG---PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG 733

Query: 384  PATLAQTWWTCRAACRATATG*AS*TPRPPPLTS------STTSATRASSTGSPLTCSAT 545
            P T      T R+    + +G  + TPR    TS      +T  +T  +ST  P T +  
Sbjct: 734  PTTT-----TPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPR 788

Query: 546  ASRLPSLS*SPSSTP 590
            ++   S S   ++TP
Sbjct: 789  STTTTSTSGPTTTTP 803

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 56/195 (28%), Positives = 80/195 (40%), Gaps = 7/195 (3%)
 Frame = +3

Query: 27   TTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAM 206
            TT RS      TTT+ +  T++ P    +  ++  +T T R+   T    PT     T  
Sbjct: 609  TTPRS-----TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT---TPR 660

Query: 207  STVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCS-SGPCANTCRSAQRRPTPP 383
            ST T        P+  +  S T T     T+ TPRS    S SGP   T RS     T  
Sbjct: 661  STTTTSTSG---PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG 717

Query: 384  PATLAQTWWTCRAACRATATG*AS*TPRPPPLTS------STTSATRASSTGSPLTCSAT 545
            P T      T R+    + +G  + TPR    TS      +T  +T  +ST  P T +  
Sbjct: 718  PTTT-----TPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPR 772

Query: 546  ASRLPSLS*SPSSTP 590
            ++   S S   ++TP
Sbjct: 773  STTTTSTSGPTTTTP 787

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 56/195 (28%), Positives = 80/195 (40%), Gaps = 7/195 (3%)
 Frame = +3

Query: 27   TTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAM 206
            TT RS      TTT+ +  T++ P    +  ++  +T T R+   T    PT     T  
Sbjct: 545  TTPRS-----TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT---TPR 596

Query: 207  STVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCS-SGPCANTCRSAQRRPTPP 383
            ST T        P+  +  S T T     T+ TPRS    S SGP   T RS     T  
Sbjct: 597  STTTTSTSG---PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG 653

Query: 384  PATLAQTWWTCRAACRATATG*AS*TPRPPPLTS------STTSATRASSTGSPLTCSAT 545
            P T      T R+    + +G  + TPR    TS      +T  +T  +ST  P T +  
Sbjct: 654  PTTT-----TPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPR 708

Query: 546  ASRLPSLS*SPSSTP 590
            ++   S S   ++TP
Sbjct: 709  STTTTSTSGPTTTTP 723

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 58/189 (30%), Positives = 75/189 (38%), Gaps = 11/189 (5%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAP--------TSATSSLPAGACSDPST*ASTLTLRA-- 152
            P+  T   TT  S  R  PTTT P        +  T++ P    +  ++  +T T R+  
Sbjct: 942  PTTTTPRSTTTTSTSR--PTTTTPRSTTTTTTSRPTTTTPRSTTTPSTSRPTTTTPRSTT 999

Query: 153  CARTRRCTPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRS-PAYCS 329
               T R T T P S T  ST          P+  +  S T T   R T+ TPRS     +
Sbjct: 1000 TTSTSRPTTTTPRSTTKTSTCA--------PTTTTPRSTTTTTTSRPTTTTPRSTTTTTT 1051

Query: 330  SGPCANTCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRA 509
            S P   T RS     T  P T      T     R T T   S T  P P T+ + S TR 
Sbjct: 1052 SRPTTTTPRSTTTPCTSRPTTTTPRSTTTTTTSRPTTTTPRS-TTTPCPTTTPSASPTRT 1110

Query: 510  SSTGSPLTC 536
            ++T  P  C
Sbjct: 1111 TTTRRPCPC 1119

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 56/195 (28%), Positives = 80/195 (40%), Gaps = 7/195 (3%)
 Frame = +3

Query: 27  TTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAM 206
           TT RS      TTT+ +  T++ P    +  ++  +T T R+   T    PT     T  
Sbjct: 449 TTPRS-----TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT---TPR 500

Query: 207 STVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCS-SGPCANTCRSAQRRPTPP 383
           ST T        P+  +  S T T     T+ TPRS    S SGP   T RS     T  
Sbjct: 501 STTTTSTSG---PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG 557

Query: 384 PATLAQTWWTCRAACRATATG*AS*TPRPPPLTS------STTSATRASSTGSPLTCSAT 545
           P T      T R+    + +G  + TPR    TS      +T  +T  +ST  P T +  
Sbjct: 558 PTTT-----TPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPR 612

Query: 546 ASRLPSLS*SPSSTP 590
           ++   S S   ++TP
Sbjct: 613 STTTTSTSGPTTTTP 627

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 56/195 (28%), Positives = 80/195 (40%), Gaps = 7/195 (3%)
 Frame = +3

Query: 27   TTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAM 206
            TT RS      TTT+ +  T++ P    +  ++  +T T R+   T    PT     T  
Sbjct: 513  TTPRS-----TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT---TPR 564

Query: 207  STVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCS-SGPCANTCRSAQRRPTPP 383
            ST T        P+  +  S T T     T+ TPRS    S SGP   T RS     T  
Sbjct: 565  STTTTSTSG---PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG 621

Query: 384  PATLAQTWWTCRAACRATATG*AS*TPRPPPLTS------STTSATRASSTGSPLTCSAT 545
            P T      T R+    + +G  + TPR    TS      +T  +T  +ST  P T +  
Sbjct: 622  PTTT-----TPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPR 676

Query: 546  ASRLPSLS*SPSSTP 590
            ++   S S   ++TP
Sbjct: 677  STTTTSTSGPTTTTP 691

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 57/205 (27%), Positives = 84/205 (40%), Gaps = 1/205 (0%)
 Frame = +3

Query: 27   TTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAM 206
            TT RS      TTT+ +  T++ P    +  ++  +T T R+   T    PT     T  
Sbjct: 737  TTPRS-----TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT---TPR 788

Query: 207  STVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCS-SGPCANTCRSAQRRPTPP 383
            ST T        P+  +  S T T     T+ TPRS    S SGP   T RS     T  
Sbjct: 789  STTTTSTSG---PTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSG 845

Query: 384  PATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCSATASRLPS 563
            P T      T  +    T T     TPR     S+TT+ T   +T +P + + T +  P+
Sbjct: 846  PTTTTPRSTTTTSTSCPTTT-----TPR-----STTTTCTSGPTTTTPRSTTTTCTSCPT 895

Query: 564  LS*SPSSTPSW*PRCAFLSSTLNAT 638
             + +P ST +    C   ++  + T
Sbjct: 896  TT-TPRSTTTTCTSCPTTTTPRSTT 919

 Score = 52.0 bits (123), Expect = 7e-06
 Identities = 56/200 (28%), Positives = 84/200 (42%), Gaps = 8/200 (4%)
 Frame = +3

Query: 12   ATCCGTTKRSWRRSVPTTTAPTSATSSLPAGAC-SDPST---*ASTLTLRACART---RR 170
            +T C TT      +   T+ PT+ T       C S P+T    ++T T  +C  T   R 
Sbjct: 858  STSCPTTTTPRSTTTTCTSGPTTTTPRSTTTTCTSCPTTTTPRSTTTTCTSCPTTTTPRS 917

Query: 171  CTPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRS-PAYCSSGPCAN 347
             T T     T  +  +    ++  P+  +  S T T   R T+ TPRS     +S P   
Sbjct: 918  TTTTCTSGPTTTTPRSTTKTSTCAPTTTTPRSTTTTSTSRPTTTTPRSTTTTTTSRPTTT 977

Query: 348  TCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSP 527
            T RS     T  P T      T  +  R T T     TPR     S+T ++T A +T +P
Sbjct: 978  TPRSTTTPSTSRPTTTTPRSTTTTSTSRPTTT-----TPR-----STTKTSTCAPTTTTP 1027

Query: 528  LTCSATASRLPSLS*SPSST 587
             + + T +  P+ + +P ST
Sbjct: 1028 RSTTTTTTSRPTTT-TPRST 1046

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 61/227 (26%), Positives = 88/227 (37%), Gaps = 35/227 (15%)
 Frame = +3

Query: 15  TCCGTTKRSWRRSVPTTTAPTSATSSLPAG---------ACSDPST*ASTLTLRACARTR 167
           TC  TT     RS  TTT+ +  T++ P             + P +  +T T R    T 
Sbjct: 216 TCAQTTTTP--RST-TTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTTTTRRPTTTTP 272

Query: 168 RCTPT----APPS*TAMSTVTLQAH-------------NSIWPSRASGLSETPTPPRRRT 296
           RCT T    AP + T  ST T                 ++  P+R +  S T T   R T
Sbjct: 273 RCTTTTSTCAPTTTTPRSTTTTTTSRPTTTTPRCTTTTSTCSPTRTTPRSTTTTSTSRPT 332

Query: 297 SQTPRSPAYCSSGP---CANTCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPR 467
           + TPR    C++ P   C     +   R T    T   T  T R+      +G  + TPR
Sbjct: 333 TTTPR----CTTTPSTTCTRRPTTTTPRSTTTTCTSGPTTTTPRSTTTTCTSGPTTTTPR 388

Query: 468 PPPLTS------STTSATRASSTGSPLTCSATASRLPSLS*SPSSTP 590
               TS      +T  +T  +ST  P T +  ++   S S   ++TP
Sbjct: 389 STTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTP 435

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 61/213 (28%), Positives = 87/213 (40%), Gaps = 14/213 (6%)
 Frame = +3

Query: 30  TKRSWRRSVPTTTAPTS----ATSSLPAGACSDPST*AST--LTLRACARTRRC----TP 179
           T   W   + T T P +    +++++P+  C D ST   T   T      T  C    T 
Sbjct: 152 TNTDWTTPLCTDTPPCTCSEESSTAIPSSPCIDTSTVIPTSPCTQETTTPTPTCSTQGTQ 211

Query: 180 TAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRS 359
           T P +  A +T T ++  +   SR      T T PR  T+ T       +S P   T RS
Sbjct: 212 TTPCT-CAQTTTTPRSTTTTSTSRP-----TTTTPRSTTTTT-------TSRPTTTTPRS 258

Query: 360 AQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSS---TTSATRASSTGSPL 530
                T  P T      T  + C  T T     TPR    T++   TT+  R ++T S  
Sbjct: 259 TTTTTTRRPTTTTPRCTTTTSTCAPTTT-----TPRSTTTTTTSRPTTTTPRCTTTTS-- 311

Query: 531 TCSATASRLPSLS*SPSSTP-SW*PRCAFLSST 626
           TCS T +   S + + +S P +  PRC    ST
Sbjct: 312 TCSPTRTTPRSTTTTSTSRPTTTTPRCTTTPST 344

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 58/205 (28%), Positives = 89/205 (43%), Gaps = 1/205 (0%)
 Frame = +3

Query: 27   TTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAM 206
            TT RS      TTT+ +  T++ P    +  ++  +T T R+   T  CT + P + T  
Sbjct: 849  TTPRS-----TTTTSTSCPTTTTPRSTTTTCTSGPTTTTPRSTTTT--CT-SCPTTTTPR 900

Query: 207  STVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSS-GPCANTCRSAQRRPTPP 383
            ST T     +  P+  +  S T T     T+ TPRS    S+  P   T RS     T  
Sbjct: 901  STTTT---CTSCPTTTTPRSTTTTCTSGPTTTTPRSTTKTSTCAPTTTTPRSTTTTSTSR 957

Query: 384  PATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCSATASRLPS 563
            P T      T     R T T     TPR     S+TT +T   +T +P + + T++  P+
Sbjct: 958  PTTTTPRSTTTTTTSRPTTT-----TPR-----STTTPSTSRPTTTTPRSTTTTSTSRPT 1007

Query: 564  LS*SPSSTPSW*PRCAFLSSTLNAT 638
             +   S+T +    CA  ++T  +T
Sbjct: 1008 TTTPRSTTKT--STCAPTTTTPRST 1030

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 40/137 (29%), Positives = 55/137 (39%), Gaps = 1/137 (0%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAG-ACSDPST*ASTLTLRACARTRRCTP 179
            P+  T   TTK S     PTTT P S T++  +    + P +  +T T R    T R T 
Sbjct: 1006 PTTTTPRSTTKTS--TCAPTTTTPRSTTTTTTSRPTTTTPRSTTTTTTSRPTTTTPRSTT 1063

Query: 180  TAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRS 359
            T  P  +  +T T ++  +   SR      T T PR  T+  P +    S      T R 
Sbjct: 1064 T--PCTSRPTTTTPRSTTTTTTSRP-----TTTTPRSTTTPCPTTTPSASPTRTTTTRRP 1116

Query: 360  AQRRPTPPPATLAQTWW 410
                P PP      +WW
Sbjct: 1117 CPCHPQPPYQIPPWSWW 1133

>emb|CAC83675.1| mucin 5 [Homo sapiens]
          Length = 1349

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 66/222 (29%), Positives = 100/222 (44%), Gaps = 10/222 (4%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTT-APTSATSSLPAGACSDPST*AST------LTLRACAR 161
            P  +T    T  +   S P+TT APT++T+S P  + +   T  +T       TL     
Sbjct: 1077 PQTSTTSAPTTSTIPASTPSTTSAPTTSTTSAPTTSTTSAPTHRTTSGPTTSTTLAPTTS 1136

Query: 162  TRRCTPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPC 341
            T     T+  S    ST++    ++I     S +S +PT     T QT ++ A  SS   
Sbjct: 1137 TTSAPTTSTNSAPTTSTISASTTSTISAPTTSTIS-SPTSSTTSTPQTSKTSAATSS--- 1192

Query: 342  ANTCRSAQRRPTPPPATL---AQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRAS 512
              T   +   P+P P T    A T  T  A   +T +G  + TP P P TS T++AT  +
Sbjct: 1193 --TTSGSGTTPSPVPTTSTTSASTTSTTSAPTTSTTSGPGT-TPSPVPSTSITSAAT--T 1247

Query: 513  STGSPLTCSATASRLPSLS*SPSSTPSW*PRCAFLSSTLNAT 638
            ST S  T   T++   S++  P +TPS  P  +  S+   +T
Sbjct: 1248 STTSAPTTRTTSAPTSSMTSGPGTTPSPVPTTSTTSAPTTST 1289

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 55/213 (25%), Positives = 92/213 (42%), Gaps = 3/213 (1%)
 Frame = +3

Query: 9    RATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAP 188
            RAT    +  SW++S  TT   TS TS+      S P+T  ST+     + T   T +  
Sbjct: 1049 RATSPTQSTSSWQKSRTTTLVTTSTTSTPQTSTTSAPTT--STIPASTPSTTSAPTTSTT 1106

Query: 189  PS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSAQR 368
             + T  +T       +  P+ ++ L+ T +     T+ T  +P   +      +  SA  
Sbjct: 1107 SAPTTSTTSAPTHRTTSGPTTSTTLAPTTSTTSAPTTSTNSAPTTSTISASTTSTISAPT 1166

Query: 369  RPT---PPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCS 539
              T   P  +T +    +  +A  ++ T  +  TP P P T+STTSA+  S+T +P T +
Sbjct: 1167 TSTISSPTSSTTSTPQTSKTSAATSSTTSGSGTTPSPVP-TTSTTSASTTSTTSAPTTST 1225

Query: 540  ATASRLPSLS*SPSSTPSW*PRCAFLSSTLNAT 638
             +          P +TPS  P  +  S+   +T
Sbjct: 1226 TS---------GPGTTPSPVPSTSITSAATTST 1249

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 64/228 (28%), Positives = 93/228 (40%), Gaps = 33/228 (14%)
 Frame = +3

Query: 9    RATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAP 188
            R T   TT  +   +  TT+APT++T+S P  +    ST   T T+ A   +   +PT+ 
Sbjct: 1120 RTTSGPTTSTTLAPTTSTTSAPTTSTNSAPTTSTISAST---TSTISAPTTSTISSPTSS 1176

Query: 189  PS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSAQR 368
             + T  ++ T  A +S   +  SG + +P P    TS T  S    +S P  +T      
Sbjct: 1177 TTSTPQTSKTSAATSST--TSGSGTTPSPVPT---TSTTSASTTSTTSAPTTSTTSGPGT 1231

Query: 369  RPTPPPAT----LAQTWWTCRAACRATA------TG*AS*TPRPPPLTS----------- 485
             P+P P+T     A T  T     R T+      T     TP P P TS           
Sbjct: 1232 TPSPVPSTSITSAATTSTTSAPTTRTTSAPTSSMTSGPGTTPSPVPTTSTTSAPTTSTTS 1291

Query: 486  ------------STTSATRASSTGSPLTCSATASRLPSLS*SPSSTPS 593
                        STTSA   S+T  P    +T S +P+ S + + T S
Sbjct: 1292 GPGTTPSPVPTTSTTSAPITSTTSGP---GSTPSPVPTTSTTSAPTTS 1336

 Score = 55.1 bits (131), Expect = 9e-07
 Identities = 63/217 (29%), Positives = 98/217 (45%), Gaps = 9/217 (4%)
 Frame = +3

Query: 12   ATCCGTTKRSWRRSVPTTT-APTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAP 188
            +T    T  +   S+P+TT APT++T+S P  + +   T ++T T       +  T +AP
Sbjct: 647  STTSAPTTSTTPASIPSTTSAPTTSTTSAPTTSTTSAPTTSTTST------PQTTTSSAP 700

Query: 189  PS*T--AMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSA 362
             S T  A +T T+ A     P+ ++  + T +     T+ T  +P   SS P  NT  + 
Sbjct: 701  TSSTTSAPTTSTISA-----PTTSTISAPTTSTTSAPTASTTSAPTSTSSAPTTNTTSAP 755

Query: 363  QRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSAT---RASSTGSPLT 533
                T  P T      T  A   +T +     TP+   ++S TTS T   + S+T SP T
Sbjct: 756  TTSTTSAPITS-----TISAPTTSTTS-----TPQTSTISSPTTSTTPTPQTSTTSSPTT 805

Query: 534  CSATASRLPSLS*---SPSSTPSW*PRCAFLSSTLNA 635
             + +A    + S    S +STP      A  SST +A
Sbjct: 806  STTSAPTTSTTSAPTTSTTSTPQTSISSAPTSSTTSA 842

 Score = 52.8 bits (125), Expect = 4e-06
 Identities = 52/200 (26%), Positives = 84/200 (42%)
 Frame = +3

Query: 39   SWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAMSTVT 218
            SW++S  TT   +S TS+      S P+T                TP + PS T+  T +
Sbjct: 626  SWQKSRTTTLVTSSITSTTQTSTTSAPTT--------------STTPASIPSTTSAPTTS 671

Query: 219  LQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSAQRRPTPPPATLA 398
              +  +   + A   S T TP +  TS  P S    +S P  +T  +        P T  
Sbjct: 672  TTSAPTTSTTSAPTTSTTSTP-QTTTSSAPTSST--TSAPTTSTISAPTTSTISAPTTST 728

Query: 399  QTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCSATASRLPSLS*SP 578
             +  T       T+T  A  T      T+STTSA   S+  +P T + +  +  ++S SP
Sbjct: 729  TSAPTASTTSAPTSTSSAPTTNTTSAPTTSTTSAPITSTISAPTTSTTSTPQTSTIS-SP 787

Query: 579  SSTPSW*PRCAFLSSTLNAT 638
            +++ +  P+ +  SS   +T
Sbjct: 788  TTSTTPTPQTSTTSSPTTST 807

 Score = 52.0 bits (123), Expect = 7e-06
 Identities = 47/184 (25%), Positives = 80/184 (42%), Gaps = 1/184 (0%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P+ +T    T  S   +  TT+APT++T+S P  +     T ++T T +    +   T T
Sbjct: 732  PTASTTSAPTSTSSAPTTNTTSAPTTSTTSAPITSTISAPTTSTTSTPQTSTISSPTTST 791

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSA 362
             P   T  ++ T     S   +  +  +  PT     T QT       SS P ++T  + 
Sbjct: 792  TP---TPQTSTTSSPTTSTTSAPTTSTTSAPTTSTTSTPQTS-----ISSAPTSSTTSAP 843

Query: 363  QRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRAS-STGSPLTCS 539
                   P T   ++ T       T++   S TP+    +++T+S T  S +T SP+  +
Sbjct: 844  TASTISAPTTSTTSFHTTSTTSPPTSS--TSSTPQTSKTSAATSSTTSGSGTTPSPVPTT 901

Query: 540  ATAS 551
            +TAS
Sbjct: 902  STAS 905

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 53/214 (24%), Positives = 90/214 (41%), Gaps = 3/214 (1%)
 Frame = +3

Query: 6    SRATCCGTTKRSWRRSVPTTTAPTSATSSLP-AGACSDPST*ASTLTLRACARTRRCTPT 182
            S  T   TT      +  T +APT++T+S P A   S P++ +S  T    +     T +
Sbjct: 702  SSTTSAPTTSTISAPTTSTISAPTTSTTSAPTASTTSAPTSTSSAPTTNTTSAPTTSTTS 761

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSE--TPTPPRRRTSQTPRSPAYCSSGPCANTCR 356
            AP +    ST++    ++    + S +S   T T P  +TS T       +S P  +T  
Sbjct: 762  APIT----STISAPTTSTTSTPQTSTISSPTTSTTPTPQTSTTSSPTTSTTSAPTTSTTS 817

Query: 357  SAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTC 536
            +     T  P T   +  T       TA+  ++ T       +++T++   SST S    
Sbjct: 818  APTTSTTSTPQTSISSAPTSSTTSAPTASTISAPTTSTTSFHTTSTTSPPTSSTSSTPQT 877

Query: 537  SATASRLPSLS*SPSSTPSW*PRCAFLSSTLNAT 638
            S T++   S +    +TPS  P  +  S +  +T
Sbjct: 878  SKTSAATSSTTSGSGTTPSPVPTTSTASVSKTST 911

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 53/204 (25%), Positives = 85/204 (40%)
 Frame = +3

Query: 27   TTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAM 206
            TT  S   S  T+   TS  S+      S P+T  ++    +       T +AP + T  
Sbjct: 694  TTTSSAPTSSTTSAPTTSTISAPTTSTISAPTTSTTSAPTASTTSAPTSTSSAPTTNTTS 753

Query: 207  STVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSAQRRPTPPP 386
            +  T      I  + ++  + T + P+  T  +P +    S+ P   T  S    PT   
Sbjct: 754  APTTSTTSAPITSTISAPTTSTTSTPQTSTISSPTT----STTPTPQT--STTSSPTTST 807

Query: 387  ATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCSATASRLPSL 566
             +   T  T       T+T   S +  P   TSSTTSA  AS+  +P T S T+    S 
Sbjct: 808  TSAPTTSTTSAPTTSTTSTPQTSISSAP---TSSTTSAPTASTISAP-TTSTTSFHTTST 863

Query: 567  S*SPSSTPSW*PRCAFLSSTLNAT 638
            +  P+S+ S  P+ +  S+  ++T
Sbjct: 864  TSPPTSSTSSTPQTSKTSAATSST 887

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 53/184 (28%), Positives = 74/184 (39%), Gaps = 8/184 (4%)
 Frame = +3

Query: 60  TTTAPT-SATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAMSTVTLQAHNS 236
           TT+APT S TS+  +   S P T  ++ +  +       TP+  P+ +  S  T    ++
Sbjct: 4   TTSAPTTSTTSTPTSSTTSTPQTSTTSASTTSITSGPGTTPSPVPTTSTTSAPTTSTTSA 63

Query: 237 IWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSAQRRPTPPPATLAQTWWTC 416
              S  S    T T     TS T  S A  +SG             T PP T      + 
Sbjct: 64  ATTSTISA-PTTSTTSAPTTSTTSASTASKTSGLGTTPSPIPTTSTTSPPTT------ST 116

Query: 417 RAACRATATG*AS*TPRPPPLTS-------STTSATRASSTGSPLTCSATASRLPSLS*S 575
            +A  A+ T     TP P P TS       STTSA+  S+T  P T  +      + S S
Sbjct: 117 TSASTASKTSGPGTTPSPVPTTSTIFAPRTSTTSASTTSTTPGPGTTPSPVPTTSTASVS 176

Query: 576 PSST 587
            +ST
Sbjct: 177 KTST 180

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 45/187 (24%), Positives = 77/187 (41%), Gaps = 5/187 (2%)
 Frame = +3

Query: 15  TCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT---- 182
           T   +T  S   S P T+  +++T+S+ +G  + PS   +T T  A   +     T    
Sbjct: 10  TSTTSTPTSSTTSTPQTSTTSASTTSITSGPGTTPSPVPTTSTTSAPTTSTTSAATTSTI 69

Query: 183 APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSA 362
           + P+ +  S  T    ++   S+ SGL  TP+P    ++ +P + +  S+   + T    
Sbjct: 70  SAPTTSTTSAPTTSTTSASTASKTSGLGTTPSPIPTTSTTSPPTTSTTSASTASKTSGPG 129

Query: 363 QRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTG-SPLTCS 539
               TP P     T +  R +  + +T   +  P   P    TTS    S T  S ++ S
Sbjct: 130 T---TPSPVPTTSTIFAPRTSTTSASTTSTTPGPGTTPSPVPTTSTASVSKTSTSHVSIS 186

Query: 540 ATASRLP 560
            T    P
Sbjct: 187 KTTHSQP 193

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 49/184 (26%), Positives = 73/184 (39%), Gaps = 10/184 (5%)
 Frame = +3

Query: 6    SRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTA 185
            S  T    T ++   +  TT+   +  S +P  + +  ST   T T  A   +    P  
Sbjct: 1175 SSTTSTPQTSKTSAATSSTTSGSGTTPSPVPTTSTTSAST---TSTTSAPTTSTTSGPGT 1231

Query: 186  PPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRR---TSQTPRSPAYCSSGPCANTCR 356
             PS    +++T  A  S   +  +  +  PT        T+ +P      +S P  +T  
Sbjct: 1232 TPSPVPSTSITSAATTSTTSAPTTRTTSAPTSSMTSGPGTTPSPVPTTSTTSAPTTSTTS 1291

Query: 357  SAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTS-------STTSATRASS 515
                 P+P P T      T  A   +T +G  S TP P P TS       STTSA+ AS+
Sbjct: 1292 GPGTTPSPVPTTS-----TTSAPITSTTSGPGS-TPSPVPTTSTTSAPTTSTTSASTAST 1345

Query: 516  TGSP 527
            T  P
Sbjct: 1346 TSGP 1349

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 55/193 (28%), Positives = 79/193 (40%), Gaps = 12/193 (6%)
 Frame = +3

Query: 9   RATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAP 188
           R  CC T K       P T+ P +A S+ P+G  + P+   S+      +RT     T+ 
Sbjct: 292 RVLCCETPK-----GCPVTSTPVTAPST-PSGRATSPTQSTSSWQK---SRTTTLVTTST 342

Query: 189 PS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSAQR 368
            S T  ++ T     S   +  +  +  PT     T QT  S A  SS   A T  +   
Sbjct: 343 TS-TPQTSTTSAPTTSTTSAPTTSTTSAPTTSTTSTPQTSISSAPTSSTTSAPTSSTISA 401

Query: 369 RPTP------PPATLAQTWWTCRAACRATATG*AS*TPRPPPL------TSSTTSATRAS 512
           R T          T + T  T  A   +T +   S T   P        TSSTTS+  + 
Sbjct: 402 RTTSIISAPTTSTTSSPTTSTTSATTTSTTSAPTSSTTSTPQTSKTSAATSSTTSS--SG 459

Query: 513 STGSPLTCSATAS 551
           +T SP+T ++TAS
Sbjct: 460 TTPSPVTTTSTAS 472

 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 47/186 (25%), Positives = 75/186 (40%), Gaps = 4/186 (2%)
 Frame = +3

Query: 9   RATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*A----STLTLRACARTRRCT 176
           RAT    +  SW++S  TT   TS TS+      S P+T      +T T  A   +   T
Sbjct: 318 RATSPTQSTSSWQKSRTTTLVTTSTTSTPQTSTTSAPTTSTTSAPTTSTTSAPTTSTTST 377

Query: 177 PTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCR 356
           P    S    S+ T    +S   +R + +   P      T+ T  SP   ++     +  
Sbjct: 378 PQTSISSAPTSSTTSAPTSSTISARTTSIISAP------TTSTTSSPTTSTTSATTTSTT 431

Query: 357 SAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTC 536
           SA   PT    +  QT  T  A    T++   +    P P+T+++T++   +ST      
Sbjct: 432 SA---PTSSTTSTPQTSKTSAATSSTTSSSGTT----PSPVTTTSTASVSKTSTSHVSVS 484

Query: 537 SATASR 554
             T S+
Sbjct: 485 KTTHSQ 490

 Score = 40.0 bits (92), Expect = 0.029
 Identities = 39/169 (23%), Positives = 73/169 (43%)
 Frame = +3

Query: 132 STLTLRACARTRRCTPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPR 311
           +T T  A   +   TPT+  + T  ++ T  +  SI     SG   TP+P    ++    
Sbjct: 1   TTSTTSAPTTSTTSTPTSSTTSTPQTSTTSASTTSI----TSGPGTTPSPVPTTST---- 52

Query: 312 SPAYCSSGPCANTCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSST 491
                +S P  +T  +A       P T   +  T      +TA+  +     P P+ +++
Sbjct: 53  -----TSAPTTSTTSAATTSTISAPTTSTTSAPTTSTTSASTASKTSGLGTTPSPIPTTS 107

Query: 492 TSATRASSTGSPLTCSATASRLPSLS*SPSSTPSW*PRCAFLSSTLNAT 638
           T++   +ST S  T S T+    + S  P+++  + PR +  S++  +T
Sbjct: 108 TTSPPTTSTTSASTASKTSGPGTTPSPVPTTSTIFAPRTSTTSASTTST 156

>ref|XP_318717.1| ENSANGP00000004655 [Anopheles gambiae] gi|30174516|gb|EAA13969.2|
            ENSANGP00000004655 [Anopheles gambiae str. PEST]
          Length = 3150

 Score = 62.8 bits (151), Expect = 4e-09
 Identities = 58/201 (28%), Positives = 87/201 (42%), Gaps = 4/201 (1%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSAT--SSLPAGACSDPST*ASTLTLRACARTRRCT 176
            P  +T  GTT     R+ PT   PT +T  SS+ + +  +PST            T R T
Sbjct: 2804 PEPSTTPGTT-----RTTPTRPTPTDSTMSSSMSSASTPEPST---------TPGTTRTT 2849

Query: 177  PTAP-PS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTC 353
            PT P P+ + MS+       +   +R +    TPT     +S +  S    S+ P   T 
Sbjct: 2850 PTRPTPTDSTMSSSMSSVSTTPGTTRTTPTRPTPTDSTMSSSMSSASTPEPSTTP--GTT 2907

Query: 354  RSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TP-RPPPLTSSTTSATRASSTGSPL 530
            R+   RPTP  +T++ +  +      +T  G    TP RP P  S+ +S+  ++ST  P 
Sbjct: 2908 RTTPTRPTPTDSTMSSSMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSASTPEPT 2967

Query: 531  TCSATASRLPSLS*SPSSTPS 593
            T   T    P+      ST S
Sbjct: 2968 TTPGTTRTTPTRPTPTDSTMS 2988

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 58/202 (28%), Positives = 87/202 (42%), Gaps = 7/202 (3%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATS-SLPAGACSDPST*ASTLTLRACAR--TRRC 173
            P+R T   TT  S     P+TT  T+ T+ + P    S  +T +S  T        T R 
Sbjct: 771  PTRPTSTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTSEPSTTPGTTRT 830

Query: 174  TPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGP----C 341
            TPT P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P     
Sbjct: 831  TPTRPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTT 888

Query: 342  ANTCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTG 521
            + T R+   RPTP   T++    +      +T  G    TP  P  T ST +   ++ST 
Sbjct: 889  SGTTRTTPTRPTPTDTTMS----SASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTP 944

Query: 522  SPLTCSATASRLPSLS*SPSST 587
             P T   T    P+   S  ST
Sbjct: 945  EPSTTPGTTRTTPTRPTSTEST 966

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 56/202 (27%), Positives = 85/202 (41%), Gaps = 5/202 (2%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+        T T PTS  S++ + +  +PST            T R TPT
Sbjct: 2059 PEPSTTPGTTRT-------TPTRPTSTDSTMSSASTPEPST---------TPGTTRTTPT 2102

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSS-----GPCAN 347
             P S T  +  T+ + ++  PS   G + T TP R  ++ +  S +  S+          
Sbjct: 2103 RPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTDSTMSSSMSSASTPEPSTTPG 2160

Query: 348  TCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSP 527
            T R+   RPTP  +T++ +      +  +T  G    TP  P  T ST +   ++ST  P
Sbjct: 2161 TTRTTPTRPTPTDSTMSSS-----MSSASTTPGTTRTTPTRPTSTESTDTTMSSASTPEP 2215

Query: 528  LTCSATASRLPSLS*SPSSTPS 593
             T   T    P+      ST S
Sbjct: 2216 STTPGTTRTTPTRPTPTDSTMS 2237

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 59/205 (28%), Positives = 86/205 (41%), Gaps = 8/205 (3%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACAR--TRRCT 176
            P+R T   +T  S   S  TT   T  T + P    S  +T +S  T        T R T
Sbjct: 2724 PTRPTPTDSTMSSSMSSASTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTT 2783

Query: 177  PTAP-PS*TAMSTVTLQAHNSIWPSRASGLSET----PTPPRRRTSQTPRSPAYCSSGPC 341
            PT P P+ T MS+ ++ + ++  PS   G + T    PTP     S +  S +       
Sbjct: 2784 PTRPTPTDTTMSS-SMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSASTPEPSTT 2842

Query: 342  ANTCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TP-RPPPLTSSTTSATRASST 518
              T R+   RPTP  +T++ +  +       T T     TP RP P  S+ +S+  ++ST
Sbjct: 2843 PGTTRTTPTRPTPTDSTMSSSMSSVSTTPGTTRT-----TPTRPTPTDSTMSSSMSSAST 2897

Query: 519  GSPLTCSATASRLPSLS*SPSSTPS 593
              P T   T    P+      ST S
Sbjct: 2898 PEPSTTPGTTRTTPTRPTPTDSTMS 2922

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 60/207 (28%), Positives = 87/207 (41%), Gaps = 11/207 (5%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSAT-SSLPAGACSDPST*ASTLTLRACARTRRCTP 179
            P  +T  GTT     R+ PT   PT +T SS  + A + P T              R TP
Sbjct: 2711 PEPSTTPGTT-----RTTPTRPTPTDSTMSSSMSSASTTPGT-------------TRTTP 2752

Query: 180  TAPPS*TAMSTVTLQAHNSIWPSRASGLSET----PTPPRRRTSQTPRSPAYCSSGPCAN 347
            T P S T  +  T+ + ++  PS   G + T    PTP     S +  S +         
Sbjct: 2753 TRPTS-TESTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDTTMSSSMSSASTPEPSTTPG 2811

Query: 348  TCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSP 527
            T R+   RPTP  +T++ +  +      +T  G    TP  P  T ST S++ +S + +P
Sbjct: 2812 TTRTTPTRPTPTDSTMSSSMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSVSTTP 2871

Query: 528  LTCSATASR------LPSLS*SPSSTP 590
             T   T +R        S S S +STP
Sbjct: 2872 GTTRTTPTRPTPTDSTMSSSMSSASTP 2898

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 57/229 (24%), Positives = 93/229 (39%), Gaps = 19/229 (8%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSAT--SSLPAGACSDPST*ASTLTLRACARTRRCT 176
            P  +T  GTT     R+ PT   PT +T  SS+ + +  +PST            T R T
Sbjct: 2898 PEPSTTPGTT-----RTTPTRPTPTDSTMSSSMSSASTPEPST---------TPGTTRTT 2943

Query: 177  PTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCR 356
            PT P    +  + ++ + ++  P+   G + T       T  T  S +         T R
Sbjct: 2944 PTRPTPTDSTMSSSMSSASTPEPTTTPGTTRTTPTRPTPTDSTMSSASTPKPSSTPGTTR 3003

Query: 357  SAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSST--------------- 491
            +   RPTP  +T++ +  +      +T  G    TP  P  T +T               
Sbjct: 3004 TTPTRPTPTDSTMSSSMSSACTPEPSTTPGTTRTTPTRPTPTDTTMSSASTPEPSTTPGT 3063

Query: 492  --TSATRASSTGSPLTCSATASRLPSLS*SPSSTPSW*PRCAFLSSTLN 632
              T+ TR + T S ++ S +++  P  S +P +T +   R A  SS+ N
Sbjct: 3064 TRTTPTRPTPTDSTMSSSMSSASTPEPSTTPGTTRTTPTRPATTSSSRN 3112

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 54/195 (27%), Positives = 80/195 (40%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT     R+ PT   PT +T S  + +  +PST            T R TPT
Sbjct: 665  PEPSTTPGTT-----RTTPTRPTPTDSTMS--SASTPEPST---------TPGTTRTTPT 708

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSA 362
             P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P  +T    
Sbjct: 709  RPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTTPGT 766

Query: 363  QRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCSA 542
             R     P +   T  +      +T  G    TP  P  T ST +   ++ST  P T   
Sbjct: 767  TRTTPTRPTSTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTSEPSTTPG 826

Query: 543  TASRLPSLS*SPSST 587
            T    P+   S  ST
Sbjct: 827  TTRTTPTRPTSTEST 841

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 55/198 (27%), Positives = 82/198 (40%), Gaps = 3/198 (1%)
 Frame = +3

Query: 3   PSRATCCGTTKRSWRRSVPTTTAPTSATS-SLPAGACSDPST*ASTLTLRACAR--TRRC 173
           P+R T   TT  S     P+TT  T+ T+ + P    S  +T +S  T        T R 
Sbjct: 353 PTRPTSTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT 412

Query: 174 TPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTC 353
           TPT P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P  +T 
Sbjct: 413 TPTRPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTLSSASTPEPSTT 470

Query: 354 RSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLT 533
               R     P +   T  +      +T  G    TP  P  T ST +   ++ST  P T
Sbjct: 471 PGTTRTTPTRPTSTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPST 530

Query: 534 CSATASRLPSLS*SPSST 587
              T    P+   S  ST
Sbjct: 531 TPGTTRTTPTRPTSTEST 548

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 56/198 (28%), Positives = 80/198 (40%), Gaps = 1/198 (0%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P+R T   TT  S     P+TT  T+ T+           + AST        T R TPT
Sbjct: 2540 PTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDTTMSSASTPEPSTTPGTTRTTPT 2599

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSA 362
             P S     + ++ + ++  PS   G + T TP R   + +  S +  S+     T R+ 
Sbjct: 2600 RPTSTDTTMSSSMSSASTPEPSTTPGTTRT-TPTRPTPTDSTMSSSMSSASATPGTTRTT 2658

Query: 363  QRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRAS-STGSPLTCS 539
              RPT   +T   T  +      +T  G    TP  P  T ST S++ +S ST  P T  
Sbjct: 2659 PTRPTSTEST-DTTMSSASTPEPSTTPGTTRTTPTRPTSTDSTMSSSMSSASTPEPSTTP 2717

Query: 540  ATASRLPSLS*SPSSTPS 593
             T    P+      ST S
Sbjct: 2718 GTTRTTPTRPTPTDSTMS 2735

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 53/192 (27%), Positives = 80/192 (41%), Gaps = 5/192 (2%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT     R+ PT   PT +T S            +S  +  A   T R TPT
Sbjct: 2618 PEPSTTPGTT-----RTTPTRPTPTDSTMS------------SSMSSASATPGTTRTTPT 2660

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSS-----GPCAN 347
             P S T  +  T+ + ++  PS   G + T TP R  ++ +  S +  S+          
Sbjct: 2661 RPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTDSTMSSSMSSASTPEPSTTPG 2718

Query: 348  TCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSP 527
            T R+   RPTP  +T++ +      +  +T  G    TP  P  T ST +   ++ST  P
Sbjct: 2719 TTRTTPTRPTPTDSTMSSS-----MSSASTTPGTTRTTPTRPTSTESTDTTMSSASTPEP 2773

Query: 528  LTCSATASRLPS 563
             T   T    P+
Sbjct: 2774 STTPGTTRTTPT 2785

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 58/201 (28%), Positives = 84/201 (40%), Gaps = 6/201 (2%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATS-SLPAGACSDPST*ASTLTLRACAR--TRRC 173
            P+R T   TT  S     P+TT  T+ T+ + P    S  +T +S  T        T R 
Sbjct: 896  PTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT 955

Query: 174  TPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTC 353
            TPT P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P  +T 
Sbjct: 956  TPTRPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTK 1013

Query: 354  RSAQRRPTPPPATLAQTWWTCRAACR---ATATG*AS*TPRPPPLTSSTTSATRASSTGS 524
                R     P T   T  T  +A     +T  G    TP  P  T ST +   ++ST  
Sbjct: 1014 PGTTRTTPTRPTTTESTDTTMSSASTTEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPE 1073

Query: 525  PLTCSATASRLPSLS*SPSST 587
            P T   T    P+   S  ST
Sbjct: 1074 PSTTPGTTRTTPTRPTSTEST 1094

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 55/196 (28%), Positives = 77/196 (39%), Gaps = 1/196 (0%)
 Frame = +3

Query: 3   PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
           P+R T   TT  S     P+TT  T+ T+           + AST        T R TPT
Sbjct: 112 PTRQTPTDTTMSSASTPQPSTTPGTTRTTPTRPTPTDTTMSSASTPEPSTTPGTTRTTPT 171

Query: 183 APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYC-SSGPCANTCRS 359
            P      +  T+ + ++  PS   G + T TP R   + T  S A          T R+
Sbjct: 172 RP----TPTDTTMSSESTPEPSTTPGTTRT-TPTRPTPTDTTMSSASTPEPSTTPGTTRT 226

Query: 360 AQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCS 539
              RPTP  +T++    +      +T  G    TP  P  T ST +   ++ST  P T  
Sbjct: 227 TPTRPTPTDSTMS----SASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTP 282

Query: 540 ATASRLPSLS*SPSST 587
            T    P+   S  ST
Sbjct: 283 GTTRTTPTRPTSTEST 298

 Score = 55.8 bits (133), Expect = 5e-07
 Identities = 59/213 (27%), Positives = 83/213 (38%), Gaps = 16/213 (7%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSA-----------TSSLPAGACSDPST-----*AS 134
            P  +T  GTT+ +  R  PT T  +SA           T + P    S  ST      AS
Sbjct: 1934 PDPSTTPGTTRTTPTRPTPTETTMSSASTPEPSMTPGTTRTTPTRPTSTESTDTTMSSAS 1993

Query: 135  TLTLRACARTRRCTPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRS 314
            T        T R TPT P S T  +  T+ +  +  PS   G + T TP R  ++++  +
Sbjct: 1994 TPEPSTTPGTTRTTPTRPTS-TERTDTTMSSAYTPEPSTTPGTTRT-TPTRPTSTESTDT 2051

Query: 315  PAYCSSGPCANTCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTT 494
                +S P  +T     R     P +   T  +      +T  G    TP  P  T ST 
Sbjct: 2052 TMSSASTPEPSTTPGTTRTTPTRPTSTDSTMSSASTPEPSTTPGTTRTTPTRPTSTESTD 2111

Query: 495  SATRASSTGSPLTCSATASRLPSLS*SPSSTPS 593
            +   ++ST  P T   T    P+   S  ST S
Sbjct: 2112 TTMSSASTPEPSTTPGTTRTTPTRPTSTDSTMS 2144

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 56/198 (28%), Positives = 81/198 (40%), Gaps = 3/198 (1%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+        T T PTS  +++ + +  +PST            T R TPT
Sbjct: 1232 PEPSTTPGTTRT-------TPTRPTSTDTTMSSASTPEPST---------TPGTTRTTPT 1275

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSET-PTPP--RRRTSQTPRSPAYCSSGPCANTC 353
             P S T  +  T+ + ++  PS   G++ T PT P     T  T  S +        +T 
Sbjct: 1276 RPTS-TESTDTTMSSASTPEPSTTPGITRTSPTRPTSTESTDTTMSSASTPEPTTTPDTT 1334

Query: 354  RSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLT 533
            R+   RPT   +T   T  +      +T  G    TP  P  T ST +   ++ST  P T
Sbjct: 1335 RTTPTRPTSTEST-DTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPST 1393

Query: 534  CSATASRLPSLS*SPSST 587
               T    P+   S  ST
Sbjct: 1394 TPGTTRTTPTRPTSTEST 1411

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 58/199 (29%), Positives = 83/199 (41%), Gaps = 4/199 (2%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATS-SLPAGACSDPST*ASTLTLRACAR--TRRC 173
            P+R T   +T  S     P+TT  T+ T+ + P    S  +T +S  T        T R 
Sbjct: 678  PTRPTPTDSTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT 737

Query: 174  TPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYC-SSGPCANT 350
            TPT P S T  +  T+ + ++  PS   G + T TP R  ++ T  S A          T
Sbjct: 738  TPTRPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTDTTMSSASTPEPSTTPGT 795

Query: 351  CRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPL 530
             R+   RPT   +T   T  +   +  +T  G    TP  P  T ST +   ++ST  P 
Sbjct: 796  TRTTPTRPTSTEST-DTTMSSASTSEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPS 854

Query: 531  TCSATASRLPSLS*SPSST 587
            T   T    P+   S  ST
Sbjct: 855  TTPGTTRTTPTRPTSTEST 873

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 54/198 (27%), Positives = 82/198 (41%), Gaps = 3/198 (1%)
 Frame = +3

Query: 3   PSRATCCGTTKRSWRRSVPTTTAPTSATS-SLPAGACSDPST*ASTLTLRACAR--TRRC 173
           P+R T   +T  S     P+TT  T+ T+ + P    S  +T +S  T        T R 
Sbjct: 228 PTRPTPTDSTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT 287

Query: 174 TPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTC 353
           TPT P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P  +T 
Sbjct: 288 TPTRPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTT 345

Query: 354 RSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLT 533
               R     P +   T  +      +T  G    TP  P  T ST +   ++ST  P T
Sbjct: 346 PGTTRTTPTRPTSTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPST 405

Query: 534 CSATASRLPSLS*SPSST 587
              T    P+   S  ST
Sbjct: 406 TPGTTRTTPTRPTSTEST 423

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 63/218 (28%), Positives = 89/218 (39%), Gaps = 21/218 (9%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATS-SLPAGACSDPST*ASTLTLRACAR--TRRC 173
            P+R T   TT  S     P+TT  T+ T+ + P    S  +T +S  T        T R 
Sbjct: 478  PTRPTSTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT 537

Query: 174  TPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGP----C 341
            TPT P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P     
Sbjct: 538  TPTRPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTT 595

Query: 342  ANTCRSAQRRP--------------TPPPATLAQTWWTCRAACRATATG*AS*TPRPPPL 479
              T R+   RP              TP P+T   T  T     R T+TG    TP  P  
Sbjct: 596  PGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGT--TRTTPTRPTSTG--KTTPTRPTS 651

Query: 480  TSSTTSATRASSTGSPLTCSATASRLPSLS*SPSSTPS 593
            T ST +   ++ST  P T   T    P+      ST S
Sbjct: 652  TESTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDSTMS 689

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 50/177 (28%), Positives = 74/177 (41%), Gaps = 5/177 (2%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSAT-SSLPAGACSDPST*ASTLTLRACARTRRCTP 179
            P  +T  GTT     R+ PT   PT +T SS  + A + P T              R TP
Sbjct: 2153 PEPSTTPGTT-----RTTPTRPTPTDSTMSSSMSSASTTPGT-------------TRTTP 2194

Query: 180  TAPPS*TAMSTVTLQAHNSIWPSRASGLSET----PTPPRRRTSQTPRSPAYCSSGPCAN 347
            T P S T  +  T+ + ++  PS   G + T    PTP     S +  S +         
Sbjct: 2195 TRPTS-TESTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSASTPEPSTTPG 2253

Query: 348  TCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASST 518
            T R+   RPTP   T++ +  +      +T  G    TP  P  T ST S++ +S++
Sbjct: 2254 TTRTTPTRPTPTDTTMSSSMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSAS 2310

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 59/201 (29%), Positives = 84/201 (41%), Gaps = 4/201 (1%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+ +  R  PT+T  T  T S  + +  DPST            T R TPT
Sbjct: 1902 PEPSTTPGTTRTTPTR--PTSTESTDTTMS--SASTPDPST---------TPGTTRTTPT 1948

Query: 183  AP-PS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRS 359
             P P+ T MS+ +        PS   G + T TP R  ++++  +    +S P  +T   
Sbjct: 1949 RPTPTETTMSSASTPE-----PSMTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTTPG 2002

Query: 360  AQRRPTPPPATLAQTWWTCRAACR---ATATG*AS*TPRPPPLTSSTTSATRASSTGSPL 530
              R     P +  +T  T  +A     +T  G    TP  P  T ST +   ++ST  P 
Sbjct: 2003 TTRTTPTRPTSTERTDTTMSSAYTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPS 2062

Query: 531  TCSATASRLPSLS*SPSSTPS 593
            T   T    P+   S  ST S
Sbjct: 2063 TTPGTTRTTPTRPTSTDSTMS 2083

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 61/232 (26%), Positives = 101/232 (43%), Gaps = 20/232 (8%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATS-SLPAGACSDPST*ASTLTLRACAR--TRRC 173
            P+R T   +T  S     P+TT  T+ T+ + P    S  +T +S  T        T R 
Sbjct: 2415 PTRPTPTDSTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT 2474

Query: 174  TPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGP----C 341
            TPT P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P     
Sbjct: 2475 TPTRPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMTTASTPEPSTT 2532

Query: 342  ANTCRSAQRRPTP------------PPATLAQTWWTCRAACRATATG*AS*TPRPPPLTS 485
             +T R+   RPTP            P  T   T  T         T  ++ TP P     
Sbjct: 2533 PDTTRTTPTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDTTMSSASTPEPSTTPG 2592

Query: 486  ST-TSATRASSTGSPLTCSATASRLPSLS*SPSSTPSW*PRCAFLSSTLNAT 638
            +T T+ TR +ST + ++ S +++  P  S +P +T +   R     ST++++
Sbjct: 2593 TTRTTPTRPTSTDTTMSSSMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSS 2644

 Score = 52.8 bits (125), Expect = 4e-06
 Identities = 55/198 (27%), Positives = 80/198 (39%), Gaps = 3/198 (1%)
 Frame = +3

Query: 3   PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
           P+R T   TT  S     P+TT  T+ T+           + AST        T R TPT
Sbjct: 199 PTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSASTPEPSTTPGTTRTTPT 258

Query: 183 APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSA 362
            P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P  +T    
Sbjct: 259 RPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTTPGT 316

Query: 363 QRRPTPPPATLAQTWWTCRAACR---ATATG*AS*TPRPPPLTSSTTSATRASSTGSPLT 533
            R     P +   T  T  +A     +T  G    TP  P  T +T S   ++ST  P T
Sbjct: 317 TRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTDTTMS---SASTPEPST 373

Query: 534 CSATASRLPSLS*SPSST 587
              T    P+   S  ST
Sbjct: 374 TPGTTRTTPTRPTSTEST 391

 Score = 52.8 bits (125), Expect = 4e-06
 Identities = 60/209 (28%), Positives = 80/209 (37%), Gaps = 14/209 (6%)
 Frame = +3

Query: 3   PSRATCCGTTKRSWRRSVPTTTAPTSA----TSSLPAGACSDPST*ASTLTLRACART-- 164
           P  +T  GTT+ +  R  PT T  +SA     SS P    + P+    T T  + A T  
Sbjct: 70  PEPSTTPGTTRTTPTRPTPTDTTMSSAYTPDPSSTPGTTRTTPTRQTPTDTTMSSASTPQ 129

Query: 165 -------RRCTPTAP-PS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPA 320
                   R TPT P P+ T MS+ +        PS   G + T       T  T  S +
Sbjct: 130 PSTTPGTTRTTPTRPTPTDTTMSSASTPE-----PSTTPGTTRTTPTRPTPTDTTMSSES 184

Query: 321 YCSSGPCANTCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSA 500
                    T R+   RPTP   T++    +      +T  G    TP  P  T ST S 
Sbjct: 185 TPEPSTTPGTTRTTPTRPTPTDTTMS----SASTPEPSTTPGTTRTTPTRPTPTDSTMS- 239

Query: 501 TRASSTGSPLTCSATASRLPSLS*SPSST 587
             ++ST  P T   T    P+   S  ST
Sbjct: 240 --SASTPEPSTTPGTTRTTPTRPTSTEST 266

 Score = 52.8 bits (125), Expect = 4e-06
 Identities = 52/203 (25%), Positives = 83/203 (40%), Gaps = 8/203 (3%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPA---GACSDPST*ASTLTLRACARTRRC 173
            P+R T   +T  S   SV TT   T  T + P       S   + AST        T R 
Sbjct: 2850 PTRPTPTDSTMSSSMSSVSTTPGTTRTTPTRPTPTDSTMSSSMSSASTPEPSTTPGTTRT 2909

Query: 174  TPTAPPS*TAMSTVTLQAHNSIWPSRASGLSET----PTPPRRRTSQTPRSPAYCSSGPC 341
            TPT P    +  + ++ + ++  PS   G + T    PTP     S +  S +       
Sbjct: 2910 TPTRPTPTDSTMSSSMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSASTPEPTTT 2969

Query: 342  ANTCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSST-TSATRASST 518
              T R+   RPTP  +T++                 ++ TP+P     +T T+ TR + T
Sbjct: 2970 PGTTRTTPTRPTPTDSTMS-----------------SASTPKPSSTPGTTRTTPTRPTPT 3012

Query: 519  GSPLTCSATASRLPSLS*SPSST 587
             S ++ S +++  P  S +P +T
Sbjct: 3013 DSTMSSSMSSACTPEPSTTPGTT 3035

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 60/215 (27%), Positives = 85/215 (38%), Gaps = 20/215 (9%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSAT--SSLPAGACSDPST*ASTLTLRACARTRRCT 176
            P  +T  GTT     R+ PT   PT +T  SS+ + +  +PST     T     RT   T
Sbjct: 1671 PEPSTTPGTT-----RTTPTRPTPTDSTMSSSMSSESTPEPSTTPEPSTTPGTTRT---T 1722

Query: 177  PTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGP----CA 344
            PT P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P      
Sbjct: 1723 PTRPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTTP 1780

Query: 345  NTCRSAQRRPT--------------PPPATLAQTWWTCRAACRATATG*AS*TPRPPPLT 482
             T R+   RPT              P P+T   T  T               TP  P  T
Sbjct: 1781 GTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT---------------TPTRPTST 1825

Query: 483  SSTTSATRASSTGSPLTCSATASRLPSLS*SPSST 587
             ST +   ++ST  P T   T    P+   S  ST
Sbjct: 1826 ESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTEST 1860

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 54/198 (27%), Positives = 83/198 (41%), Gaps = 3/198 (1%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+        T T PTS  +++ + +  +PST            T R TPT
Sbjct: 758  PEPSTTPGTTRT-------TPTRPTSTDTTMSSASTPEPST---------TPGTTRTTPT 801

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSA 362
             P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P  +T    
Sbjct: 802  RPTS-TESTDTTMSSASTSEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTTPGT 859

Query: 363  QRRPTPPPATLAQTWWTCRAACR---ATATG*AS*TPRPPPLTSSTTSATRASSTGSPLT 533
             R     P +   T  T  +A     +T +G    TP  P  T +T S   ++ST  P T
Sbjct: 860  TRTTPTRPTSTESTDTTMSSASTPEPSTTSGTTRTTPTRPTPTDTTMS---SASTPEPST 916

Query: 534  CSATASRLPSLS*SPSST 587
               T    P+   S  ST
Sbjct: 917  TPGTTRTTPTRPTSTEST 934

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 57/197 (28%), Positives = 85/197 (42%), Gaps = 1/197 (0%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+ +  R  PT+T  T  T S  + +  +PST            T R TPT
Sbjct: 1578 PEPSTTPGTTRTTPTR--PTSTESTDTTMS--SASTPEPST---------TPGTTRTTPT 1624

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSS-GPCANTCRS 359
             P S T  +  T+ + ++  PS   G + T TP R   + T  S A          T R+
Sbjct: 1625 RPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTPTDTTMSSASTPEPSTTPGTTRT 1682

Query: 360  AQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCS 539
               RPTP  +T++       ++  + +T   S TP P    S+T   TR + T    T S
Sbjct: 1683 TPTRPTPTDSTMS-------SSMSSESTPEPSTTPEP----STTPGTTRTTPTRPTSTES 1731

Query: 540  ATASRLPSLS*SPSSTP 590
               +   + +  PS+TP
Sbjct: 1732 TDTTMSSASTPEPSTTP 1748

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 55/196 (28%), Positives = 88/196 (44%), Gaps = 1/196 (0%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P   T  GTT+ +  R  PT +  +SA++  P+   S P T  +T T        R TPT
Sbjct: 2964 PEPTTTPGTTRTTPTRPTPTDSTMSSASTPKPS---STPGTTRTTPT--------RPTPT 3012

Query: 183  APPS*TAMSTV-TLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRS 359
                 ++MS+  T +   +   +R +    TPT     ++ TP      S+ P   T R+
Sbjct: 3013 DSTMSSSMSSACTPEPSTTPGTTRTTPTRPTPTDTTMSSASTPEP----STTP--GTTRT 3066

Query: 360  AQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCS 539
               RPTP  +T++ +  +      +T  G    T R  P   +TTS++R  S+ S  T +
Sbjct: 3067 TPTRPTPTDSTMSSSMSSASTPEPSTTPG----TTRTTPTRPATTSSSRNPSSTSWTTVT 3122

Query: 540  ATASRLPSLS*SPSST 587
              ++   +LS S  ST
Sbjct: 3123 NRSTTRTTLSSSIGST 3138

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 50/200 (25%), Positives = 81/200 (40%), Gaps = 5/200 (2%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P+R T   TT  S     P+TT  T+ T+     +     T  S+ +    + T   T T
Sbjct: 1245 PTRPTSTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGITRT 1304

Query: 183  AP--PS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCR 356
            +P  P+ T  +  T+ + ++  P+     + T TP R  ++++  +    +S P  +T  
Sbjct: 1305 SPTRPTSTESTDTTMSSASTPEPTTTPDTTRT-TPTRPTSTESTDTTMSSASTPEPSTTP 1363

Query: 357  SAQRRPTPPPATLAQTWWTCRAACR---ATATG*AS*TPRPPPLTSSTTSATRASSTGSP 527
               R     P +   T  T  +A     +T  G    TP  P  T ST +   ++ST  P
Sbjct: 1364 GTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEP 1423

Query: 528  LTCSATASRLPSLS*SPSST 587
             T   T    P+   S  ST
Sbjct: 1424 TTTPGTTRTTPTRPTSTEST 1443

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 58/198 (29%), Positives = 82/198 (41%), Gaps = 2/198 (1%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+ +  R  PT+T  T  T S  + +  +PST            T R TPT
Sbjct: 558  PEPSTTPGTTRTTPTR--PTSTESTDTTMS--SASTPEPST---------TPGTTRTTPT 604

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSET-PTPPRRRTSQTPRSPAYCSSGPCANTCRS 359
             P S T  +  T+ + ++  PS   G + T PT P      TP  P    S     T  +
Sbjct: 605  RPTS-TESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTGKTTPTRPTSTES-----TDTT 658

Query: 360  AQRRPTPPPATLAQTWWTCRAACRAT-ATG*AS*TPRPPPLTSSTTSATRASSTGSPLTC 536
                 TP P+T   T  T       T +T  ++ TP P    S+T   TR + T    T 
Sbjct: 659  MSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSASTPEP----STTPGTTRTTPTRPTSTE 714

Query: 537  SATASRLPSLS*SPSSTP 590
            S   +   + +  PS+TP
Sbjct: 715  STDTTMSSASTPEPSTTP 732

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 60/230 (26%), Positives = 94/230 (40%), Gaps = 18/230 (7%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT     R+ PT   PT +T S  + +  +PST            T R TPT
Sbjct: 2402 PEPSTTPGTT-----RTTPTRPTPTDSTMS--SASTPEPST---------TPGTTRTTPT 2445

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGP----CANT 350
             P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P       T
Sbjct: 2446 RPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTTPGT 2503

Query: 351  CRSAQRRP--------------TPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSS 488
             R+   RP              TP P+T   T  T       T T  +S +   P  T  
Sbjct: 2504 TRTTPTRPTSTESTDTTMTTASTPEPSTTPDTTRTTPTRPTPTDTTMSSASTPEPSTTPG 2563

Query: 489  TTSATRASSTGSPLTCSATASRLPSLS*SPSSTPSW*PRCAFLSSTLNAT 638
            TT  T    T +  T S+ ++  PS   +P +T +   R     +T++++
Sbjct: 2564 TTRTTPTRPTPTDTTMSSASTPEPST--TPGTTRTTPTRPTSTDTTMSSS 2611

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 59/213 (27%), Positives = 84/213 (38%), Gaps = 18/213 (8%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+ +  R  PTTT  T  T S  + + ++PST            T R TPT
Sbjct: 1008 PEPSTKPGTTRTTPTR--PTTTESTDTTMS--SASTTEPST---------TPGTTRTTPT 1054

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGP----CANT 350
             P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P       T
Sbjct: 1055 RPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTTPGT 1112

Query: 351  CRSAQRRPT--------------PPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSS 488
             R+   RPT              P P+T   T  T               TP  P  T S
Sbjct: 1113 TRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT---------------TPTRPTSTES 1157

Query: 489  TTSATRASSTGSPLTCSATASRLPSLS*SPSST 587
            T +   ++ST  P T   T    P+   S  ST
Sbjct: 1158 TDTTMSSASTPEPSTTPGTTRTTPTRPTSTEST 1190

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 55/189 (29%), Positives = 80/189 (42%), Gaps = 2/189 (1%)
 Frame = +3

Query: 3   PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
           P  +T  GTT     R+ PT   PT +T S  + +  +PST            T R TPT
Sbjct: 41  PEPSTTPGTT-----RTTPTRPTPTDSTMS--SASTPEPST---------TPGTTRTTPT 84

Query: 183 AP-PS*TAMSTV-TLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCR 356
            P P+ T MS+  T    ++   +R +   +TPT     ++ TP+     S+ P   T R
Sbjct: 85  RPTPTDTTMSSAYTPDPSSTPGTTRTTPTRQTPTDTTMSSASTPQP----STTP--GTTR 138

Query: 357 SAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTC 536
           +   RPTP   T++    +      +T  G    TP  P  T +T S   + ST  P T 
Sbjct: 139 TTPTRPTPTDTTMS----SASTPEPSTTPGTTRTTPTRPTPTDTTMS---SESTPEPSTT 191

Query: 537 SATASRLPS 563
             T    P+
Sbjct: 192 PGTTRTTPT 200

 Score = 48.5 bits (114), Expect = 8e-05
 Identities = 59/210 (28%), Positives = 80/210 (38%), Gaps = 15/210 (7%)
 Frame = +3

Query: 3   PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
           P  +T  GTT+ +  R  PT+T  T  T S  + +  +PST            T R TPT
Sbjct: 276 PEPSTTPGTTRTTPTR--PTSTESTDTTMS--SASTPEPST---------TPGTTRTTPT 322

Query: 183 APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSS-GPCANTCRS 359
            P S T  +  T+ + ++  PS   G + T TP R  ++ T  S A          T R+
Sbjct: 323 RPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTDTTMSSASTPEPSTTPGTTRT 380

Query: 360 AQRRPT--------------PPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTS 497
              RPT              P P+T   T  T               TP  P  T ST +
Sbjct: 381 TPTRPTSTESTDTTMSSASTPEPSTTPGTTRT---------------TPTRPTSTESTDT 425

Query: 498 ATRASSTGSPLTCSATASRLPSLS*SPSST 587
              ++ST  P T   T    P+   S  ST
Sbjct: 426 TMSSASTPEPSTTPGTTRTTPTRPTSTEST 455

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 57/189 (30%), Positives = 82/189 (43%), Gaps = 5/189 (2%)
 Frame = +3

Query: 3   PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
           P  +T  GTT+ +  R  PT+T  T  T S  + +  +PST            T R TPT
Sbjct: 9   PEPSTTPGTTRTTPTR--PTSTESTDTTMS--SASTPEPST---------TPGTTRTTPT 55

Query: 183 AP-PS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYC---SSGPCANT 350
            P P+ + MS+ +        PS   G + T TP R   + T  S AY    SS P   T
Sbjct: 56  RPTPTDSTMSSASTPE-----PSTTPGTTRT-TPTRPTPTDTTMSSAYTPDPSSTP--GT 107

Query: 351 CRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TP-RPPPLTSSTTSATRASSTGSP 527
            R+   R TP   T++    +      +T  G    TP RP P  ++ +SA+    + +P
Sbjct: 108 TRTTPTRQTPTDTTMS----SASTPQPSTTPGTTRTTPTRPTPTDTTMSSASTPEPSTTP 163

Query: 528 LTCSATASR 554
            T   T +R
Sbjct: 164 GTTRTTPTR 172

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 59/213 (27%), Positives = 81/213 (37%), Gaps = 18/213 (8%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+ +  R  PT+T  T  T S  + +  +PST            T R TPT
Sbjct: 944  PEPSTTPGTTRTTPTR--PTSTESTDTTMS--SASTPEPST---------TPGTTRTTPT 990

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQ----TPRSPAYCSSGPCANT 350
             P S T  +  T+ + ++  PS   G + T TP R  T++    T  S +         T
Sbjct: 991  RPTS-TESTDTTMSSASTPEPSTKPGTTRT-TPTRPTTTESTDTTMSSASTTEPSTTPGT 1048

Query: 351  CRSAQRRPT--------------PPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSS 488
             R+   RPT              P P+T   T  T               TP  P  T S
Sbjct: 1049 TRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT---------------TPTRPTSTES 1093

Query: 489  TTSATRASSTGSPLTCSATASRLPSLS*SPSST 587
            T +   ++ST  P T   T    P+   S  ST
Sbjct: 1094 TDTTMSSASTPEPSTTPGTTRTTPTRPTSTEST 1126

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 58/213 (27%), Positives = 83/213 (38%), Gaps = 18/213 (8%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+ +  R  PT+T  T  T S  + +  +PST            T R TPT
Sbjct: 1742 PEPSTTPGTTRTTPTR--PTSTESTDTTMS--SASTPEPST---------TPGTTRTTPT 1788

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGP----CANT 350
             P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P       T
Sbjct: 1789 RPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTTPGT 1846

Query: 351  CRSAQRRPT--------------PPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSS 488
             R+   RPT              P P+T   T  T               TP  P  T S
Sbjct: 1847 TRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT---------------TPTRPTSTES 1891

Query: 489  TTSATRASSTGSPLTCSATASRLPSLS*SPSST 587
            T +   ++ST  P T   T    P+   S  ST
Sbjct: 1892 TDTTMSSASTPEPSTTPGTTRTTPTRPTSTEST 1924

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 58/213 (27%), Positives = 83/213 (38%), Gaps = 18/213 (8%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+ +  R  PT+T  T  T S  + +  +PST            T R TPT
Sbjct: 1710 PEPSTTPGTTRTTPTR--PTSTESTDTTMS--SASTPEPST---------TPGTTRTTPT 1756

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGP----CANT 350
             P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P       T
Sbjct: 1757 RPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTTPGT 1814

Query: 351  CRSAQRRPT--------------PPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSS 488
             R+   RPT              P P+T   T  T               TP  P  T S
Sbjct: 1815 TRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT---------------TPTRPTSTES 1859

Query: 489  TTSATRASSTGSPLTCSATASRLPSLS*SPSST 587
            T +   ++ST  P T   T    P+   S  ST
Sbjct: 1860 TDTTMSSASTPEPSTTPGTTRTTPTRPTSTEST 1892

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 59/230 (25%), Positives = 90/230 (38%), Gaps = 34/230 (14%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSD-------PST*ASTLTLRACAR 161
            P  +T  GTT+ +  R  PT T  +SA++  P+            P++  ST T  + A 
Sbjct: 883  PEPSTTSGTTRTTPTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSAS 942

Query: 162  T---------RRCTPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRS 314
            T          R TPT P S T  +  T+ + ++  PS   G + T TP R  ++++  +
Sbjct: 943  TPEPSTTPGTTRTTPTRPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDT 1000

Query: 315  PAYCSSGPCANTCRSAQRRPTPPPATLAQTWWTCRAACR---ATATG*AS*TPRPP---- 473
                +S P  +T     R     P T   T  T  +A     +T  G    TP  P    
Sbjct: 1001 TMSSASTPEPSTKPGTTRTTPTRPTTTESTDTTMSSASTTEPSTTPGTTRTTPTRPTSTE 1060

Query: 474  -----------PLTSSTTSATRASSTGSPLTCSATASRLPSLS*SPSSTP 590
                       P  S+T   TR + T    T S   +   + +  PS+TP
Sbjct: 1061 STDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTP 1110

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 57/210 (27%), Positives = 84/210 (39%), Gaps = 14/210 (6%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P   T  GTT+ +  R  PT+T  T  T S  + +  +PST            T R TPT
Sbjct: 1421 PEPTTTPGTTRTTPTR--PTSTESTDTTMS--SASTPEPST---------TPGTTRTTPT 1467

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSET-PT-PPRRRTSQTPRSPAYCSS-GPCANTC 353
             P S T  +  T+ + ++  PS   G + T PT P    ++ T  S AY         T 
Sbjct: 1468 RPTS-TESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSAYTPDPSGIPGTT 1526

Query: 354  RSAQRRPTPPPATLAQ-----------TWWTCRAACRATATG*AS*TPRPPPLTSSTTSA 500
            R+   RPTP   T++            T  T      +T +   + +    P  S+T   
Sbjct: 1527 RTTPTRPTPTETTMSSASTPEPSMTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGT 1586

Query: 501  TRASSTGSPLTCSATASRLPSLS*SPSSTP 590
            TR + T    T S   +   + +  PS+TP
Sbjct: 1587 TRTTPTRPTSTESTDTTMSSASTPEPSTTP 1616

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 57/213 (26%), Positives = 83/213 (38%), Gaps = 18/213 (8%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+ +  R  PT+T  T  T S  + +  +PST   T          R TPT
Sbjct: 976  PEPSTTPGTTRTTPTR--PTSTESTDTTMS--SASTPEPSTKPGTT---------RTTPT 1022

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGP----CANT 350
             P + T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P       T
Sbjct: 1023 RPTT-TESTDTTMSSASTTEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTTPGT 1080

Query: 351  CRSAQRRPT--------------PPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSS 488
             R+   RPT              P P+T   T  T               TP  P  T S
Sbjct: 1081 TRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT---------------TPTRPTSTES 1125

Query: 489  TTSATRASSTGSPLTCSATASRLPSLS*SPSST 587
            T +   ++ST  P T   T    P+   S  ST
Sbjct: 1126 TDTTMSSASTPEPSTTPGTTRTTPTRPTSTEST 1158

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 54/196 (27%), Positives = 76/196 (38%), Gaps = 1/196 (0%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+ +  R  PT+T  T  T S  + +  +PST            T R TPT
Sbjct: 1610 PEPSTTPGTTRTTPTR--PTSTESTDTTMS--SASTPEPST---------TPGTTRTTPT 1656

Query: 183  AP-PS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRS 359
             P P+ T MS+             AS    + TP   RT+ T  +P   +     ++  +
Sbjct: 1657 RPTPTDTTMSS-------------ASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSEST 1703

Query: 360  AQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCS 539
             +   TP P+T   T  T               TP  P  T ST +   ++ST  P T  
Sbjct: 1704 PEPSTTPEPSTTPGTTRT---------------TPTRPTSTESTDTTMSSASTPEPSTTP 1748

Query: 540  ATASRLPSLS*SPSST 587
             T    P+   S  ST
Sbjct: 1749 GTTRTTPTRPTSTEST 1764

 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 56/211 (26%), Positives = 85/211 (39%), Gaps = 15/211 (7%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+ +  R  PT+T  T  T S  + +  +PST            T R TPT
Sbjct: 1104 PEPSTTPGTTRTTPTR--PTSTESTDTTMS--SASTPEPST---------TPGTTRTTPT 1150

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSA 362
             P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P  +T    
Sbjct: 1151 RPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTTPGT 1208

Query: 363  QRRPTPPPATLAQTWWTCRAACR---ATATG*AS*TPRPP------------PLTSSTTS 497
             R     P +   T  T  +A     +T  G    TP  P            P  S+T  
Sbjct: 1209 TRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTDTTMSSASTPEPSTTPG 1268

Query: 498  ATRASSTGSPLTCSATASRLPSLS*SPSSTP 590
             TR + T    T S   +   + +  PS+TP
Sbjct: 1269 TTRTTPTRPTSTESTDTTMSSASTPEPSTTP 1299

 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 57/216 (26%), Positives = 83/216 (38%), Gaps = 21/216 (9%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATS-SLPAGACSDPST*ASTLTLRACAR--TRRC 173
            P+      TT  S   + P+TT  T+ T+ + P    S  +T +S  T        T R 
Sbjct: 1024 PTTTESTDTTMSSASTTEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT 1083

Query: 174  TPTAPPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGP----C 341
            TPT P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P     
Sbjct: 1084 TPTRPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTT 1141

Query: 342  ANTCRSAQRRPT--------------PPPATLAQTWWTCRAACRATATG*AS*TPRPPPL 479
              T R+   RPT              P P+T   T  T               TP  P  
Sbjct: 1142 PGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT---------------TPTRPTS 1186

Query: 480  TSSTTSATRASSTGSPLTCSATASRLPSLS*SPSST 587
            T ST +   ++ST  P T   T    P+   S  ST
Sbjct: 1187 TESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTEST 1222

 Score = 45.8 bits (107), Expect = 5e-04
 Identities = 59/210 (28%), Positives = 79/210 (37%), Gaps = 15/210 (7%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+ +  R  PT+T  T  T S  + +  +PST            T R TPT
Sbjct: 1453 PEPSTTPGTTRTTPTR--PTSTESTDTTMS--SASTPEPST---------TPGTTRTTPT 1499

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCA-NTCRS 359
             P S T  +  T+ +  +  PS   G + T TP R   ++T  S A          T R+
Sbjct: 1500 RPTS-TESTDTTMSSAYTPDPSGIPGTTRT-TPTRPTPTETTMSSASTPEPSMTPGTTRT 1557

Query: 360  AQRRPT--------------PPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTS 497
               RPT              P P+T   T  T               TP  P  T ST +
Sbjct: 1558 TPTRPTSTESTDTTMSSASTPEPSTTPGTTRT---------------TPTRPTSTESTDT 1602

Query: 498  ATRASSTGSPLTCSATASRLPSLS*SPSST 587
               ++ST  P T   T    P+   S  ST
Sbjct: 1603 TMSSASTPEPSTTPGTTRTTPTRPTSTEST 1632

 Score = 45.8 bits (107), Expect = 5e-04
 Identities = 55/207 (26%), Positives = 77/207 (36%), Gaps = 12/207 (5%)
 Frame = +3

Query: 3   PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
           P+R T   TT  S     P+TT  T+ T+           +  ST        T R TPT
Sbjct: 141 PTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDTTMSSESTPEPSTTPGTTRTTPT 200

Query: 183 AP-PS*TAMSTV-TLQAHNSIWPSRASGLSETPTPPRRRTSQTPR----------SPAYC 326
            P P+ T MS+  T +   +   +R +    TPT     ++ TP           +P   
Sbjct: 201 RPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSASTPEPSTTPGTTRTTPTRP 260

Query: 327 SSGPCANTCRSAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATR 506
           +S    +T  S+    TP P+T   T  T               TP  P  T ST +   
Sbjct: 261 TSTESTDTTMSSAS--TPEPSTTPGTTRT---------------TPTRPTSTESTDTTMS 303

Query: 507 ASSTGSPLTCSATASRLPSLS*SPSST 587
           ++ST  P T   T    P+   S  ST
Sbjct: 304 SASTPEPSTTPGTTRTTPTRPTSTEST 330

 Score = 45.4 bits (106), Expect = 7e-04
 Identities = 52/195 (26%), Positives = 72/195 (36%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  GTT+ +  R  PT T  +SA++        +PST            T R TPT
Sbjct: 1642 PEPSTTPGTTRTTPTRPTPTDTTMSSASTP-------EPST---------TPGTTRTTPT 1685

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSA 362
             P    +  + ++ + ++  PS     S TP   R     TP  P    S     T  + 
Sbjct: 1686 RPTPTDSTMSSSMSSESTPEPSTTPEPSTTPGTTRT----TPTRPTSTES-----TDTTM 1736

Query: 363  QRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCSA 542
                TP P+T   T  T               TP  P  T ST +   ++ST  P T   
Sbjct: 1737 SSASTPEPSTTPGTTRT---------------TPTRPTSTESTDTTMSSASTPEPSTTPG 1781

Query: 543  TASRLPSLS*SPSST 587
            T    P+   S  ST
Sbjct: 1782 TTRTTPTRPTSTEST 1796

 Score = 45.1 bits (105), Expect = 9e-04
 Identities = 57/213 (26%), Positives = 81/213 (37%), Gaps = 18/213 (8%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPT 182
            P  +T  G T+ S  R  PT+T  T  T S  + +  +P+T            T R TPT
Sbjct: 1293 PEPSTTPGITRTSPTR--PTSTESTDTTMS--SASTPEPTT---------TPDTTRTTPT 1339

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGP----CANT 350
             P S T  +  T+ + ++  PS   G + T TP R  ++++  +    +S P       T
Sbjct: 1340 RPTS-TESTDTTMSSASTPEPSTTPGTTRT-TPTRPTSTESTDTTMSSASTPEPSTTPGT 1397

Query: 351  CRSAQRRPT--------------PPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSS 488
             R+   RPT              P P T   T  T               TP  P  T S
Sbjct: 1398 TRTTPTRPTSTESTDTTMSSASTPEPTTTPGTTRT---------------TPTRPTSTES 1442

Query: 489  TTSATRASSTGSPLTCSATASRLPSLS*SPSST 587
            T +   ++ST  P T   T    P+   S  ST
Sbjct: 1443 TDTTMSSASTPEPSTTPGTTRTTPTRPTSTEST 1475

 Score = 40.4 bits (93), Expect = 0.022
 Identities = 43/150 (28%), Positives = 61/150 (40%), Gaps = 7/150 (4%)
 Frame = +3

Query: 3    PSRATCCGTTKRSWRRSVPTTTAPTSAT--SSLPAGACSDPST*ASTLTLRACARTRRCT 176
            P  +T  GTT     R+ PT   PT +T  SS+ + +  +PST            T R T
Sbjct: 2213 PEPSTTPGTT-----RTTPTRPTPTDSTMSSSMSSASTPEPST---------TPGTTRTT 2258

Query: 177  PTAP-PS*TAMSTVTLQAHNSIWPSRASGLSET----PTPPRRRTSQTPRSPAYCSSGPC 341
            PT P P+ T MS+ ++ + ++  PS   G + T    PTP     S +  S +   S   
Sbjct: 2259 PTRPTPTDTTMSS-SMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSASTPESSTT 2317

Query: 342  ANTCRSAQRRPTPPPATLAQTWWTCRAACR 431
                +  Q  P P           CR  CR
Sbjct: 2318 PELLQQDQHLPIP----------QCRLVCR 2337

>pir||JW0067 chitinase (EC 3.2.1.14) A - Emericella nidulans
          Length = 660

 Score = 62.0 bits (149), Expect = 7e-09
 Identities = 61/198 (30%), Positives = 88/198 (43%), Gaps = 18/198 (9%)
 Frame = +3

Query: 51  SVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAMS---TVTL 221
           S  +TT+ TSATS+      S  ST ++T T    + T   TPT  PS +  S   T T+
Sbjct: 362 STTSTTSTTSATST--TSTTSTTSTTSTTPTTSTTSTTSTTTPTPSPSPSTASSSTTETV 419

Query: 222 QAHNSIWPSRASGLSETP------------TPPRRRTSQTPRSPAYCSSGPC---ANTCR 356
                  PS +S  SET             TP   +T  +  +P   SS P    ++T  
Sbjct: 420 TPSPKPSPSESSTTSETSSLPSTSTPVVSETPSETKTPTSSSAPPLSSSSPVGGSSSTAS 479

Query: 357 SAQRRPTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTC 536
           S+   P+  P+T      +   A   T+T           +++ST+S    S TGS  + 
Sbjct: 480 SSTSTPSETPST------SSTRAVSETSTH----------ISTSTSSGPETSLTGSSTSV 523

Query: 537 SATASRLPSLS*SPSSTP 590
            AT+S +PS + SPSSTP
Sbjct: 524 PATSSSVPSSAISPSSTP 541

 Score = 40.4 bits (93), Expect = 0.022
 Identities = 29/117 (24%), Positives = 53/117 (44%), Gaps = 2/117 (1%)
 Frame = +3

Query: 243 PSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSAQRRPTPPPATLAQTWWTCR- 419
           P   +  + TPTP    TS T  +    ++   + T  ++    TP  +T + T  T   
Sbjct: 344 PPPTTSPTPTPTPSTTTTSTTSTTSTTSATSTTSTTSTTSTTSTTPTTSTTSTTSTTTPT 403

Query: 420 -AACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCSATASRLPSLS*SPSST 587
            +   +TA+   + T  P P  S + S+T + ++  P T +   S  PS + +P+S+
Sbjct: 404 PSPSPSTASSSTTETVTPSPKPSPSESSTTSETSSLPSTSTPVVSETPSETKTPTSS 460

 Score = 32.7 bits (73), Expect = 4.6
 Identities = 22/75 (29%), Positives = 39/75 (51%), Gaps = 1/75 (1%)
 Frame = +3

Query: 372 PTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSST-TSATRASSTGSPLTCSATA 548
           PTP P+T   +  +  +   AT+T   + T      T +T T++T +++T +P    +TA
Sbjct: 352 PTPTPSTTTTSTTSTTSTTSATSTTSTTSTTSTTSTTPTTSTTSTTSTTTPTPSPSPSTA 411

Query: 549 SRLPSLS*SPSSTPS 593
           S   + + +PS  PS
Sbjct: 412 SSSTTETVTPSPKPS 426

>dbj|BAA36223.1| chitinase [Aspergillus nidulans]
          Length = 961

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 61/194 (31%), Positives = 92/194 (46%), Gaps = 14/194 (7%)
 Frame = +3

Query: 51  SVPTTTAPTSATSSLPAGACSDPST*ASTLTLRACARTRRCTPTAPPS*TAMSTVTLQAH 230
           S  +TT+ TSATS+      S  ST ++T T    + T   TPT  PS +  S+ T +  
Sbjct: 362 STTSTTSTTSATST--TSTTSTTSTTSTTPTTSTTSTTSTTTPTPSPSPSTASSSTTE-- 417

Query: 231 NSIWPSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSAQRRPT----PPPATLA 398
            ++ PS     SE+ T     TS+T   P+  +S P  +   S  + PT    PP ++ +
Sbjct: 418 -TVTPSPKPSPSESST-----TSETSSLPS--TSTPVVSETPSETKTPTSSSAPPLSSSS 469

Query: 399 QTWWTCRAACRATATG*AS*TPRPPP----------LTSSTTSATRASSTGSPLTCSATA 548
               +   A  +T+T   S TP              +++ST+S    S TGS  +  AT+
Sbjct: 470 PVGGSSSTASSSTST--PSETPSASSTRAVSETSTHISTSTSSGPETSLTGSSTSVPATS 527

Query: 549 SRLPSLS*SPSSTP 590
           S +PS + SPSSTP
Sbjct: 528 SSVPSSAISPSSTP 541

 Score = 40.4 bits (93), Expect = 0.022
 Identities = 29/117 (24%), Positives = 53/117 (44%), Gaps = 2/117 (1%)
 Frame = +3

Query: 243 PSRASGLSETPTPPRRRTSQTPRSPAYCSSGPCANTCRSAQRRPTPPPATLAQTWWTCR- 419
           P   +  + TPTP    TS T  +    ++   + T  ++    TP  +T + T  T   
Sbjct: 344 PPPTTSPTPTPTPSTTTTSTTSTTSTTSATSTTSTTSTTSTTSTTPTTSTTSTTSTTTPT 403

Query: 420 -AACRATATG*AS*TPRPPPLTSSTTSATRASSTGSPLTCSATASRLPSLS*SPSST 587
            +   +TA+   + T  P P  S + S+T + ++  P T +   S  PS + +P+S+
Sbjct: 404 PSPSPSTASSSTTETVTPSPKPSPSESSTTSETSSLPSTSTPVVSETPSETKTPTSS 460

 Score = 32.7 bits (73), Expect = 4.6
 Identities = 22/75 (29%), Positives = 39/75 (51%), Gaps = 1/75 (1%)
 Frame = +3

Query: 372 PTPPPATLAQTWWTCRAACRATATG*AS*TPRPPPLTSST-TSATRASSTGSPLTCSATA 548
           PTP P+T   +  +  +   AT+T   + T      T +T T++T +++T +P    +TA
Sbjct: 352 PTPTPSTTTTSTTSTTSTTSATSTTSTTSTTSTTSTTPTTSTTSTTSTTTPTPSPSPSTA 411

Query: 549 SRLPSLS*SPSSTPS 593
           S   + + +PS  PS
Sbjct: 412 SSSTTETVTPSPKPS 426

 Score = 32.7 bits (73), Expect = 4.6
 Identities = 28/92 (30%), Positives = 37/92 (39%), Gaps = 5/92 (5%)
 Frame = +3

Query: 18   CCGTTKRSWRRSVPTTTAPTSATSSLPAG---ACSDPST*ASTLTL-RACART-RRCTPT 182
            C GT   +     PTT  P S + S PA        P    +T+T+   CA T    T T
Sbjct: 752  CPGTASATATAIAPTTDVPGSGSGSSPAQPTITADIPEGWTTTVTVCTVCAATPTTVTLT 811

Query: 183  APPS*TAMSTVTLQAHNSIWPSRASGLSETPT 278
             PP+ T   + + Q    +  S  SG  E  T
Sbjct: 812  LPPATTTEESTSAQPTGEVPSSDGSGSGEVST 843



EST assemble image


clone accession position
1 MXL001b10_r BP092944 1 164
2 CL38a12_r AV395324 64 549
3 LCL056c10_r AV629308 189 638




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research