KCC000529A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000529A_C01 KCC000529A_c01
AGCACTCATACACGCCGTAAGGCATTAAACGTACAGAAGTCCCTTGCATCCTCCTCCCTC
GTCCTCCGTCGGAGACTCTCCGGCACCTCGCCCCGACGTCGCCTCACGATGTCGGAGTGG
AGCCAGAGGCTCACCGTGCCAGCTGCGGCGCATCGCAAGACGCGCAGCGACACCTTCGGG
TTAATGGCCATGGGCGCCCTGAACTCCTGGCAGGAGATGCCCGGGCTGCACACCGATGCG
GCGCCGACCAGCTCGCCCTCCGGCGGCGAGCAGGGCCCCGACAGCAGCAGCATGGATACC
GAAATGGCCTTCGTGGCTGTTGAGGCCGACGACGCCGAAATGGCCGGCGCAACCCGCGAG
CGCCGCA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000529A_C01 KCC000529A_c01
         (367 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAF18101.1|AF204400_1 FrgA [Myxococcus xanthus]                     45  2e-04
pir||S31719 proline-rich protein - African clawed frog gi|64956|...    44  4e-04
dbj|BAC87604.1| unnamed protein product [Homo sapiens]                 43  0.001
dbj|BAC86079.1| unnamed protein product [Homo sapiens]                 42  0.003
ref|ZP_00009817.1| COG2885: Outer membrane protein and related p...    41  0.004

>gb|AAF18101.1|AF204400_1 FrgA [Myxococcus xanthus]
          Length = 883

 Score = 45.4 bits (106), Expect = 2e-04
 Identities = 42/118 (35%), Positives = 51/118 (42%), Gaps = 7/118 (5%)
 Frame = +2

Query: 35  RSPLHPPPSSSVGDSPAPRPDVASRCRSGARGSPCQLRRIARRAATPSG*WPWAP*TPGR 214
           R P  PP + + G  P P P   +  R+  R +  Q    AR A  P+      P  P  
Sbjct: 158 RPPPPPPEALTPGPEPLPPPGPPAFVRAPLRLNMPQAEAPARPAQRPTPQAAQIPVLPFT 217

Query: 215 RCPGCTPMRRR---PARPPAAS---RAP-TAAAWIPKWPSWLLRPTTPKWPAQPASAA 367
             PG  P       PA PPAA+   RAP TA A  P  PS    PT  + PAQ  +AA
Sbjct: 218 PAPGTAPSSANTSTPASPPAATLPPRAPATAPAPKPAAPSSPPAPTGARAPAQSGTAA 275

>pir||S31719 proline-rich protein - African clawed frog gi|64956|emb|CAA48321.1|
           Proline rich protein [Xenopus laevis]
          Length = 379

 Score = 44.3 bits (103), Expect = 4e-04
 Identities = 34/105 (32%), Positives = 47/105 (44%), Gaps = 3/105 (2%)
 Frame = +2

Query: 50  PPPSSSVG---DSPAPRPDVASRCRSGARGSPCQLRRIARRAATPSG*WPWAP*TPGRRC 220
           PP S+S G    S AP P    R ++GA  +P Q  +   R           P TPG R 
Sbjct: 168 PPSSTSSGMKHSSSAPPPPPPGRRQAGAPPAPSQNAKPYNREKP-------LPPTPGHRA 220

Query: 221 PGCTPMRRRPARPPAASRAPTAAAWIPKWPSWLLRPTTPKWPAQP 355
           P   P++  P+  P  SR+P+A +  P  P +   PT+   P  P
Sbjct: 221 PAAPPVKPPPS--PINSRSPSAHSQPPPPPPYRQPPTSLNGPPSP 263

>dbj|BAC87604.1| unnamed protein product [Homo sapiens]
          Length = 215

 Score = 42.7 bits (99), Expect = 0.001
 Identities = 33/95 (34%), Positives = 40/95 (41%), Gaps = 2/95 (2%)
 Frame = +2

Query: 38  SPLHPPPSSSVGDSPAPRPDVASRCRSGARGSPCQLRRIARRAATPSG*WPWAP*TP--G 211
           SP HPPPS      PA +P       SG RG P Q+    +   TP   WP  P  P   
Sbjct: 116 SPAHPPPSL-----PASKPR-----NSGFRG-PSQVSTWQQCLQTPG--WPICPPAPLSD 162

Query: 212 RRCPGCTPMRRRPARPPAASRAPTAAAWIPKWPSW 316
              PGC  +   P+ P      PT+  W+P  P W
Sbjct: 163 LSLPGCPCLH--PSSPSHCRCLPTSHPWVPSQPLW 195

>dbj|BAC86079.1| unnamed protein product [Homo sapiens]
          Length = 215

 Score = 41.6 bits (96), Expect = 0.003
 Identities = 34/97 (35%), Positives = 41/97 (42%), Gaps = 4/97 (4%)
 Frame = +2

Query: 38  SPLHPPPSSSVGDSPAPRPDVASRCRSGARGSPCQLRRIARRAATPSG*WPWAP*TPGR- 214
           SP HPPPS      PA +P       SG RG P Q+    +   TP   WP  P  P R 
Sbjct: 116 SPAHPPPSL-----PASKPR-----NSGFRG-PSQVSTWQQCLQTPG--WPICP--PARL 160

Query: 215 ---RCPGCTPMRRRPARPPAASRAPTAAAWIPKWPSW 316
                PGC  +   P+ P      PT+  W+P  P W
Sbjct: 161 SDLSLPGCPCLH--PSSPSHCRCLPTSHPWVPSQPLW 195

>ref|ZP_00009817.1| COG2885: Outer membrane protein and related
           peptidoglycan-associated (lipo)proteins
           [Rhodopseudomonas palustris]
          Length = 689

 Score = 41.2 bits (95), Expect = 0.004
 Identities = 40/112 (35%), Positives = 48/112 (42%), Gaps = 8/112 (7%)
 Frame = +2

Query: 53  PPSSSVGDSPAPRPDVASRCRSGARGSPCQLRRIARRAATPSG*WPWAP*TP-GRRCPGC 229
           PP+++  D  A +PD A +     RG P                 P AP TP     PG 
Sbjct: 194 PPNAAAPD--AAKPDAAKQPPGERRGPP-----------------PGAPGTPPNATAPGM 234

Query: 230 TPM-----RRRPARPPAASRAPTAAAWIPKWPSWL--LRPTTPKWPAQPASA 364
           TP      RR P  PPAA+  P AAA  P  PS      PT+P  P+ PA A
Sbjct: 235 TPPPGEAPRRGPPPPPAAANPPPAAAPTPA-PSAAPQAAPTSPANPSGPAVA 285



EST assemble image


clone accession position
1 CL80c09_r AV397307 1 323
2 HCL071e01_r AV643547 78 355
3 CL42g03_r AV395478 82 264
4 CL38a08_r AV395305 88 292
5 HCL036a03_r AV641548 98 449
6 CL51f10_r AV395926 115 214
7 HCL099a05_r AV645161 126 450




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research