KCC000527A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000527A_C01 KCC000527A_c01
ggctcagccaaacaACATTCTTGCAAGCTTGAATTCTTCCATATACATCAATAAAGGCCC
AGAGACTGAAACGTGCCGCCACAACCTAGGCCTGCCTAAATGTGGGTTTGACGTTGCTGC
GTCCGCCTTACTCGCTCCAACGTGCTTCTGAGTGCTAATACATCCGTAGAATGACTGCGT
GACGCTGAAACGACAGGGATGTGGGGCCTTGTCAGCTCCGAGTTGCAAACCTCCGAGGCA
GAGACGCCCGGCTTAAAGCTGCCGGCACTGAGGGCAGGATGGCAAGCCTTGAAAGAGAAG
CTGGGAGTCGCGCGTGCAAGTGACACCCTAGTGGTCCAGCGCCGGAGACAGGGGGACAGC
GACGACGGGGACAGCGACGACGGCGACGATGACTTTAGCGAATTCAAGTTTTTTAACAGC
AATGATAAGCGGAGTGCTCCTGTGGTGCCCTCGGGTGCGGGGAAAAGCTCCACAAGTGCT
ATTGCATCCGTCTTACTACGGTCAGGCGACTATGGTGACAGCGGCCAGGCACCTAAGCGC
GAGCGCTTTGCTGCCGTGTCGTCCAATGCGCTGCAGGCGCGAATAACAGAC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000527A_C01 KCC000527A_c01
         (591 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_495921.1| TAR DNA binding protein like (45.4 kD) (2J289) ...    40  0.032
ref|NP_741694.1| predicted CDS, putative mitochondrial protein (...    37  0.16
dbj|BAB01586.1| unnamed protein product [Macaca fascicularis]          37  0.20
gb|AAD03429.1| similar to nascent polypeptide associated complex...    36  0.35
sp|P14328|SP96_DICDI Spore coat protein SP96 gi|84145|pir||S0763...    36  0.35

>ref|NP_495921.1| TAR DNA binding protein like (45.4 kD) (2J289) [Caenorhabditis
           elegans] gi|7503422|pir||T22207 hypothetical protein
           F44G4.4 - Caenorhabditis elegans
           gi|3877075|emb|CAA90120.1| Hypothetical protein F44G4.4
           [Caenorhabditis elegans]
          Length = 411

 Score = 39.7 bits (91), Expect = 0.032
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 9/89 (10%)
 Frame = +1

Query: 235 EAETPGLKLPALRAGWQ---------ALKEKLGVARASDTLVVQRRRQGDSDDGDSDDGD 387
           + +  GLKL A   GW+            E++    ++D    +RR+ G SDD DSDDG 
Sbjct: 97  QVDPSGLKLIAPADGWENKTFFVIVAPQSERVRALSSADATSAKRRKVGSSDDSDSDDGR 156

Query: 388 DDFSEFKFFNSNDKRSAPVVPSGAGKSST 474
           D  S  K     D +   ++  G    +T
Sbjct: 157 DGRSGRKRAVERDSQPVDLIVLGVDFKTT 185

>ref|NP_741694.1| predicted CDS, putative mitochondrial protein (5T649)
           [Caenorhabditis elegans] gi|11289764|pir||T45055
           hypothetical protein Y39B6B.cc [imported] -
           Caenorhabditis elegans gi|15209349|emb|CAC51073.1|
           Hypothetical protein Y39B6A.4 [Caenorhabditis elegans]
          Length = 161

 Score = 37.4 bits (85), Expect = 0.16
 Identities = 20/64 (31%), Positives = 34/64 (52%)
 Frame = +1

Query: 337 QRRRQGDSDDGDSDDGDDDFSEFKFFNSNDKRSAPVVPSGAGKSSTSAIASVLLRSGDYG 516
           +RRR GD +D ++DD D+D+SE       D+  AP  P  A    T    S++ ++ ++ 
Sbjct: 39  RRRRHGDYEDSENDDDDEDYSE-------DEGEAPPPPPPAPPQMTDEEKSIMWQNPEHP 91

Query: 517 DSGQ 528
           +  Q
Sbjct: 92  ERRQ 95

>dbj|BAB01586.1| unnamed protein product [Macaca fascicularis]
          Length = 125

 Score = 37.0 bits (84), Expect = 0.20
 Identities = 22/85 (25%), Positives = 42/85 (48%)
 Frame = -2

Query: 344 RRWTTRVSLARATPSFSFKACHPALSAGSFKPGVSASEVCNSELTRPHIPVVSASRSHST 165
           R W      A  + S   KA     S G  K  +  ++ C+++ TRPH+P  +A+ +H+T
Sbjct: 23  RNWVPTNRSAAQSLSEEVKAWRDETSVG-LKASLKPADSCSAKPTRPHVPPWAATSAHTT 81

Query: 164 DVLALRSTLERVRRTQQRQTHI*AG 90
            + +   ++ R  R+++ +    AG
Sbjct: 82  SLSSRLLSIPRTERSRRCRERSSAG 106

>gb|AAD03429.1| similar to nascent polypeptide associated complex alpha chain
           [Arabidopsis thaliana]
          Length = 233

 Score = 36.2 bits (82), Expect = 0.35
 Identities = 17/45 (37%), Positives = 29/45 (63%)
 Frame = +1

Query: 286 ALKEKLGVARASDTLVVQRRRQGDSDDGDSDDGDDDFSEFKFFNS 420
           A+KE++ + + +D +VV+  + GD DD D DD DD+ ++  F  S
Sbjct: 17  AIKEQMKLQKEND-VVVEDVKDGDEDDDDVDDDDDEIADGMFLES 60

>sp|P14328|SP96_DICDI Spore coat protein SP96 gi|84145|pir||S07638 spore coat protein
           SP96 precursor - slime mold  (Dictyostelium discoideum)
           gi|295736|emb|CAA34508.1| spore coat protein sp96
           [Dictyostelium discoideum]
          Length = 600

 Score = 36.2 bits (82), Expect = 0.35
 Identities = 28/99 (28%), Positives = 44/99 (44%)
 Frame = -2

Query: 461 PAPEGTTGALRLSLLLKNLNSLKSSSPSSLSPSSLSPCLRRWTTRVSLARATPSFSFKAC 282
           P P  TTG+   S  L + +   +S  S++S S+        +   S A ++PS S  + 
Sbjct: 417 PRPTTTTGSTSDSSALGSTSESSASGSSAVSSSASGSSAASSSPSSSAASSSPSSSAASS 476

Query: 281 HPALSAGSFKPGVSASEVCNSELTRPHIPVVSASRSHST 165
            P+ SA S  P  SAS   +   +       S+S S S+
Sbjct: 477 SPSSSAASSSPSSSASSSSSPSSSASSSSAPSSSASSSS 515



EST assemble image


clone accession position
1 LCL004b10_r AV626202 1 459
2 HCL053b09_r AV642517 15 426
3 CL38a02_r AV395283 33 503
4 LCL093c06_r AV631400 36 535
5 MXL036h01_r BP095159 40 448
6 HCL062b07_r AV643010 60 591




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research