KCC000526A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000526A_C01 KCC000526A_c01
GTTCGATATAGGCATTAGAGGACGGTGGCAACGTCTGCATTGCGCGCTGCGCCTATTTTC
CTGAACAGCGCAACCATGCAAGTGCAGCAGAAGCTAGGCGCCTCCCGGGCCATGAAGGCC
AGCCGCAACGTCCAGCGTGTATTTGCGGCGCACTCGGACATTCGCAAGGAGGCTGCGCTG
CGTGTGCCCCTGGACAAGGCGCATACCTTCAACGCCAAGTTCGTTCCCTTCGCGGATGTT
CAAAGCAACAAGATGTCCCCAGAGACTTACTCCCTGGACGACATCGTCTACCGATCGCGG
GACGGCGGCCTGCTGGACGTGCACCATGACATGAAGGCCCTGGCACAGTATGGCCCAGAC
TACTGGCGTGCGCTGTTTGATGCTCGCGTGGGCACGACCGCTTGGCCCTTTGGCTCGGGC
GTGTGGAGCAAGAAGGAGTGGGTTCTGCCGGGCCTGTCGGACGACGACATTGTGTCCATG
TTTGAGGGCAACAGCAACCTGTTCTGGGCGGAGCGCTTCGGCCGGGAGGCACTGGGCATG
A


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000526A_C01 KCC000526A_c01
         (541 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|Q9MT28|THRC_SOLTU Threonine synthase, chloroplast precursor (...   167  1e-40
ref|NP_194713.1| threonine synthase, chloroplast [Arabidopsis th...   166  1e-40
gb|AAB04607.1| threonine synthase                                     166  1e-40
pdb|1E5X|A Chain A, Structure Of Threonine Synthase From Arabido...   159  2e-38
dbj|BAC10696.1| putative threonine synthase [Oryza sativa (japon...   155  2e-37

>sp|Q9MT28|THRC_SOLTU Threonine synthase, chloroplast precursor (TS)
           gi|8439547|gb|AAF74984.1|AF082894_1 threonine synthase
           [Solanum tuberosum]
          Length = 519

 Score =  167 bits (422), Expect = 1e-40
 Identities = 81/131 (61%), Positives = 97/131 (73%)
 Frame = +1

Query: 148 AHSDIRKEAALRVPLDKAHTFNAKFVPFADVQSNKMSPETYSLDDIVYRSRDGGLLDVHH 327
           A  +IR+EA        +H F+A++VPF    +   S E YSLD+IVYRSR GGLLDV H
Sbjct: 55  ADENIREEARRHC---SSHNFSARYVPF---NAGPNSDEWYSLDEIVYRSRSGGLLDVQH 108

Query: 328 DMKALAQYGPDYWRALFDARVGTTAWPFGSGVWSKKEWVLPGLSDDDIVSMFEGNSNLFW 507
           DM AL ++   YWR+LFD+RVG T WP+GSGVWSKKEWVLP +  DDIVS FEGNSNLFW
Sbjct: 109 DMDALKKFDGQYWRSLFDSRVGKTTWPYGSGVWSKKEWVLPEIDSDDIVSAFEGNSNLFW 168

Query: 508 AERFGREALGM 540
           AERFG++ LGM
Sbjct: 169 AERFGKQFLGM 179

>ref|NP_194713.1| threonine synthase, chloroplast [Arabidopsis thaliana]
           gi|20140904|sp|Q9S7B5|THRC_ARATH Threonine synthase,
           chloroplast precursor (TS) gi|7488373|pir||T08545
           threonine synthase (EC 4.2.3.1) precursor - Arabidopsis
           thaliana gi|4850369|dbj|BAA77707.1| threonine synthase
           [Arabidopsis thaliana] gi|4914408|emb|CAB43659.1|
           threonine synthase [Arabidopsis thaliana]
           gi|7269883|emb|CAB79742.1| threonine synthase
           [Arabidopsis thaliana]
          Length = 526

 Score =  166 bits (421), Expect = 1e-40
 Identities = 89/171 (52%), Positives = 111/171 (64%)
 Frame = +1

Query: 28  ATSALRAAPIFLNSATMQVQQKLGASRAMKASRNVQRVFAAHSDIRKEAALRVPLDKAHT 207
           +TS LR  P+ ++        K     A+K     +       +IR EA  R   +  + 
Sbjct: 26  STSLLRHRPVVISCTADGNNIKAPIETAVKPPHRTE------DNIRDEAR-RNRSNAVNP 78

Query: 208 FNAKFVPFADVQSNKMSPETYSLDDIVYRSRDGGLLDVHHDMKALAQYGPDYWRALFDAR 387
           F+AK+VPF        S E+YSLD+IVYRSR GGLLDV HDM+AL ++   YWR LFD+R
Sbjct: 79  FSAKYVPFNAAPG---STESYSLDEIVYRSRSGGLLDVEHDMEALKRFDGAYWRDLFDSR 135

Query: 388 VGTTAWPFGSGVWSKKEWVLPGLSDDDIVSMFEGNSNLFWAERFGREALGM 540
           VG + WP+GSGVWSKKEWVLP + DDDIVS FEGNSNLFWAERFG++ LGM
Sbjct: 136 VGKSTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFWAERFGKQFLGM 186

>gb|AAB04607.1| threonine synthase
          Length = 525

 Score =  166 bits (421), Expect = 1e-40
 Identities = 89/171 (52%), Positives = 111/171 (64%)
 Frame = +1

Query: 28  ATSALRAAPIFLNSATMQVQQKLGASRAMKASRNVQRVFAAHSDIRKEAALRVPLDKAHT 207
           +TS LR  P+ ++        K     A+K     +       +IR EA  R   +  + 
Sbjct: 25  STSLLRHRPVVISCTADGNNIKAPIETAVKPPHRTE------DNIRDEAR-RNRSNAVNP 77

Query: 208 FNAKFVPFADVQSNKMSPETYSLDDIVYRSRDGGLLDVHHDMKALAQYGPDYWRALFDAR 387
           F+AK+VPF        S E+YSLD+IVYRSR GGLLDV HDM+AL ++   YWR LFD+R
Sbjct: 78  FSAKYVPFNAAPG---STESYSLDEIVYRSRSGGLLDVEHDMEALKRFDGAYWRDLFDSR 134

Query: 388 VGTTAWPFGSGVWSKKEWVLPGLSDDDIVSMFEGNSNLFWAERFGREALGM 540
           VG + WP+GSGVWSKKEWVLP + DDDIVS FEGNSNLFWAERFG++ LGM
Sbjct: 135 VGKSTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFWAERFGKQFLGM 185

>pdb|1E5X|A Chain A, Structure Of Threonine Synthase From Arabidopsis Thaliana
           gi|15825883|pdb|1E5X|B Chain B, Structure Of Threonine
           Synthase From Arabidopsis Thaliana
          Length = 486

 Score =  159 bits (402), Expect = 2e-38
 Identities = 76/124 (61%), Positives = 93/124 (74%)
 Frame = +1

Query: 166 KEAALRVPLDKAHTFNAKFVPFADVQSNKMSPETYSLDDIVYRSRDGGLLDVHHDMKALA 345
           ++ A R   +  + F+AK+VPF        S E+YSLD+IVYRSR GGLLDV HD +AL 
Sbjct: 25  RDEARRNRSNAVNPFSAKYVPFNAAPG---STESYSLDEIVYRSRSGGLLDVEHDXEALK 81

Query: 346 QYGPDYWRALFDARVGTTAWPFGSGVWSKKEWVLPGLSDDDIVSMFEGNSNLFWAERFGR 525
           ++   YWR LFD+RVG + WP+GSGVWSKKEWVLP + DDDIVS FEGNSNLFWAERFG+
Sbjct: 82  RFDGAYWRDLFDSRVGKSTWPYGSGVWSKKEWVLPEIDDDDIVSAFEGNSNLFWAERFGK 141

Query: 526 EALG 537
           + LG
Sbjct: 142 QFLG 145

>dbj|BAC10696.1| putative threonine synthase [Oryza sativa (japonica
           cultivar-group)]
          Length = 525

 Score =  155 bits (393), Expect = 2e-37
 Identities = 81/131 (61%), Positives = 97/131 (73%), Gaps = 1/131 (0%)
 Frame = +1

Query: 148 AHSDIRKEAA-LRVPLDKAHTFNAKFVPFADVQSNKMSPETYSLDDIVYRSRDGGLLDVH 324
           A  +IR+EAA LR P    + F+A +VPF     +    E YSLD++VYRS  GGLLDV 
Sbjct: 58  AEENIREEAARLRGP---GNDFSAWYVPFPPTPEDDPD-ERYSLDEVVYRSSSGGLLDVC 113

Query: 325 HDMKALAQYGPDYWRALFDARVGTTAWPFGSGVWSKKEWVLPGLSDDDIVSMFEGNSNLF 504
           HDM+ALA++   YWR LFD+RVG TAWP+GSGVWSKKE+VLP +  D IVS+FEGNSNLF
Sbjct: 114 HDMEALARFPGSYWRDLFDSRVGRTAWPYGSGVWSKKEFVLPEIDSDHIVSLFEGNSNLF 173

Query: 505 WAERFGREALG 537
           WAER GRE LG
Sbjct: 174 WAERLGREHLG 184



EST assemble image


clone accession position
1 HCL073b04_r AV643634 1 568
2 HCL076e07_r AV643812 41 547
3 HCL026d01_r AV641019 98 566
4 MXL062g12_r BP096672 98 479
5 HCL068f05_r AV643382 105 594
6 LCL022g06_r AV627211 105 619
7 HCL034f11_r AV641493 105 536
8 HCL097h05_r AV645074 105 611
9 HCL066e10_r AV643266 105 601
10 HCL097h04_r AV645073 105 534
11 LCL054f10_r AV629221 106 645
12 CL37h07_r AV395225 106 585
13 HCL098g07_r AV645145 107 535
14 HCL038f11_r AV641688 117 610
15 LCL018h02_r AV626959 132 620
16 CL78h11_r AV397228 132 544




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research