KCC000525A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000525A_C01 KCC000525A_c01
TGTGAGCGCTCCGAACCCGGCACTCGCTCGTGTGCCTACTCGTTCTTGTAAGCCCTCGCT
TCGCTCCTCGTCTCGCTCGTCGTCGTCGACATGGCCTCCAACGGCGCTGCCCCGGACCGC
TGGTCGAACGTGAAGCGTGTGTACACACGCCAGGATGTGGAGAAGCTGCGTGGCTCCATC
AAGATCGAGTATACCCTCGCGCGACTGGGCGCCGAGAGGTTTTGGAATCTGCTGCACACG
GAGGACTACGTCCCCGCCCTTGGCGCCATGACCGGCGGCCAGGCTGTGGAGATGGTCGCC
GCCGGCCTCAAGGCCATCTACCTATCGGGCTGGCAGGTCGCCGCCGACGCCAACTCGGCT
TCGCAGACCTACCCCGACCAGTCCCTGTACCCAGTGGACTCCGTGCCCCGGGTGGTTTCC
CGCATCAACAACGCCTTCCAGCGCATGGACCAGATGCAGCACTCTGAGGGCCGCGGCGAC
ACGTACTGGTTTGCGCCCATTGTGGCGGACGCCGAGGCCGGCTTCGGCGGCAACCTGAAC
GCATACGAGCTGATGAAGGCGCTGATCGAGGCCGGCGCCTCCTGCGTGCACTTCGAGGAC
CAGCTGGCCAGCGCCAAGAAGTGCGGCCACCTGGGCGGCAAGGTGCTGGTGCCCACCAAG
GAGTTCGTGCAGAAGCTGACGGCGGCGCGGCTGGCGGCGGACGTGATGGACGTGCCCACC
CTCATCATTGCGCGCACGGACGCGCTGGGCGCCTACCTGCTCACCAGCGACGCCGACGAG
TACGACAAGCCCTTCATGACCGGCGAGCGCACTGCCGAGGGCTTTTACTGCGTGCGCGGC
GGCATTGACGCCGCCATTGCCCGCGGCCTGGCCTATGCGCCCTACGCCGATCTGGTGTGG
TTTGAGACCAGCGAGCCGTCCATGGAGGAGGCCAAGAAGTTCGCCGCCGCCATCCACGCG
CAGTACCCCGGCAAGCTGCTTGCCTACAACTGCTCGCCCTCTTTCAACTGGAAGAAGAAG
CTGAGCGACGACGAGATTGCCAAGTTCCAGAAGACGCTGGGCTCGCTGGGCTACAAGTTC
CAATTCATCACGCTGGCCGGCTTCCACTCGCTCAACTACGGCATGTTCAGCCTGGCCCGC
GACTACGCCTCGCGCGGCATGAGCGCGTATGCGCAGCTGCAGGAGGCGGAGTTTGCCAGC
GAGAAGCAGGGCTACCGCGCCACCACACACCAGAAGTTTGTGGGCACGGGCTACTTCGAC
CTGGTCAGCACCGTCATCACCCAGGGCACCTCGTCCACCAACGCGCTCAAGGGCAGCACG
GAGGAGGAGCAGTTCCACCACTGAGCGAGCGGCGGCGGCGCGGGCCGGGCGCTCCGGTAG
CTGAGGCTGGTGATGTGGGATGTTTTGTGTAGTGGCGAGGCCGCGGCAGTGGCAGTAATG
AGGCGGTAGGGGTTTGTGTTACGGGTAGCTAGGGGTAGCTCTGTTGCAGGCAGAGGTGAT
AGTAGGACAGCAGGTCAGGGGCAGAGGCCGGAGGGGCCGAGTTTGGAGGGCCGCATGTCG
CGTGTTGTCGTCGTGTGTTGTTGTAGCGGTGCAGTTGTGTGCAGAACTCATGCGGCGGCA
GGCCTGGCCGCACCCGGAATAAGTGTAGGCGAGGTTGCGCATTATTGTCTTGTGCTTCTG
CTTCTGGGCTGAACAGGACCGTGTTTTGTTACGACTAACGATTGTTTTGGGAGGACTGTT
GCCGGCAGTTGTTTGCCATTCCAGATATGATGGCAACGACACGCATATGTCTGGCGGCGT
TCTCCCGTGTGTGCTGGCGCAATTGCGCTTTGCAAGGCACGCAATATCATTTGGTGATGC
AGCAGGATGGGTGCGCGTTGTCGTTACAAAGGTGTATGGATGGGCAATACACAGCCCTGG
CCACGATTGTAACCGCAACGTAACG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000525A_C01 KCC000525A_c01
         (1945 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||T08046 probable isocitrate lyase (EC 4.1.3.1) - Chlamydomon...   823  0.0
emb|CAC86131.1| isocitrate lyase [Polytomella sp. Pringsheim 198...   677  0.0
ref|ZP_00019480.1| hypothetical protein [Chloroflexus aurantiacus]    587  e-166
ref|NP_843617.1| isocitrate lyase [Bacillus anthracis str. Ames]...   584  e-165
ref|NP_830914.1| Isocitrate lyase [Bacillus cereus ATCC 14579] g...   582  e-165

>pir||T08046 probable isocitrate lyase (EC 4.1.3.1) - Chlamydomonas reinhardtii
            gi|619932|gb|AAB61446.1| isocitrate lyase
          Length = 416

 Score =  823 bits (2126), Expect = 0.0
 Identities = 412/417 (98%), Positives = 413/417 (98%)
 Frame = +1

Query: 91   MASNGAAPDRWSNVKRVYTRQDVEKLRGSIKIEYTLARLGAERFWNLLHTEDYVPALGAM 270
            MASNGAAPDRWSNVKRVYTRQDVEKLRGSIKIEYTLARLGAERFWNLLHTEDYVPALGAM
Sbjct: 1    MASNGAAPDRWSNVKRVYTRQDVEKLRGSIKIEYTLARLGAERFWNLLHTEDYVPALGAM 60

Query: 271  TGGQAVEMVAAGLKAIYLSGWQVAADANSASQTYPDQSLYPVDSVPRVVSRINNAFQRMD 450
            TGGQAVEMVAAGLK IYLSGWQVAADANSASQTYPDQSLYPVDSVPRVVSRINNAFQRMD
Sbjct: 61   TGGQAVEMVAAGLKDIYLSGWQVAADANSASQTYPDQSLYPVDSVPRVVSRINNAFQRMD 120

Query: 451  QMQHSEGRGDTYWFAPIVADAEAGFGGNLNAYELMKALIEAGASCVHFEDQLASAKKCGH 630
            QMQHSEGRGDTYWFAPIVADAEAGFGGNLNAYELMKALIEAGASCVHFEDQLASAKKCGH
Sbjct: 121  QMQHSEGRGDTYWFAPIVADAEAGFGGNLNAYELMKALIEAGASCVHFEDQLASAKKCGH 180

Query: 631  LGGKVLVPTKEFVQKLTAARLAADVMDVPTLIIARTDALGAYLLTSDADEYDKPFMTGER 810
            LGGKVLVPTKEFVQKLTAARLAADVMDVPTLII RTDALGAYLLTSDADEYDKPFMTGER
Sbjct: 181  LGGKVLVPTKEFVQKLTAARLAADVMDVPTLIIVRTDALGAYLLTSDADEYDKPFMTGER 240

Query: 811  TAEGFYCVRGGIDAAIARGLAYAPYADLVWFETSEPSMEEAKKFAAAIHAQYPGKLLAYN 990
            TAEGFYCVRGGIDAAIARGLAYAPYADLVWFETSEPSMEEAKKFAAAIHAQYPGKLLAYN
Sbjct: 241  TAEGFYCVRGGIDAAIARGLAYAPYADLVWFETSEPSMEEAKKFAAAIHAQYPGKLLAYN 300

Query: 991  CSPSFNWKKKLSDDEIAKFQKTLGSLGYKFQFITLAGFHSLNYGMFSLARDYASRGMSAY 1170
            CSPSFNW KKLS DEI+KFQKTLGSLGYKFQFITLAGFHSLNYGMFSLARDYASRGMSAY
Sbjct: 301  CSPSFNW-KKLSADEISKFQKTLGSLGYKFQFITLAGFHSLNYGMFSLARDYASRGMSAY 359

Query: 1171 AQLQEAEFASEKQGYRATTHQKFVGTGYFDLVSTVITQGTSSTNALKGSTEEEQFHH 1341
            AQLQEAEFASEKQGYRATTHQKFVGTGYFDLVSTVITQGTSSTNALKGSTEEEQFHH
Sbjct: 360  AQLQEAEFASEKQGYRATTHQKFVGTGYFDLVSTVITQGTSSTNALKGSTEEEQFHH 416

>emb|CAC86131.1| isocitrate lyase [Polytomella sp. Pringsheim 198.80]
          Length = 416

 Score =  677 bits (1747), Expect = 0.0
 Identities = 328/416 (78%), Positives = 371/416 (88%)
 Frame = +1

Query: 91   MASNGAAPDRWSNVKRVYTRQDVEKLRGSIKIEYTLARLGAERFWNLLHTEDYVPALGAM 270
            M +  A  DRW+ + RV++ +DVE+LRGS+ IE+TLAR+GAE+FW LLHTEDYVPALGA+
Sbjct: 1    MPAPSAHADRWTGISRVFSEKDVERLRGSVTIEHTLARIGAEKFWKLLHTEDYVPALGAL 60

Query: 271  TGGQAVEMVAAGLKAIYLSGWQVAADANSASQTYPDQSLYPVDSVPRVVSRINNAFQRMD 450
            TG QAVEM++AGLKAIYLSGWQVA D NSA QTYPDQSLYP DSVP+VV RINNAFQR D
Sbjct: 61   TGHQAVEMISAGLKAIYLSGWQVAGDNNSAYQTYPDQSLYPADSVPKVVKRINNAFQRAD 120

Query: 451  QMQHSEGRGDTYWFAPIVADAEAGFGGNLNAYELMKALIEAGASCVHFEDQLASAKKCGH 630
            Q+QHS+G  +  +FAPIVADAEAGFGG LNAYELM  +IEAGA+CVHFEDQLASAKKCGH
Sbjct: 121  QIQHSQGSTEVDFFAPIVADAEAGFGGVLNAYELMLGMIEAGAACVHFEDQLASAKKCGH 180

Query: 631  LGGKVLVPTKEFVQKLTAARLAADVMDVPTLIIARTDALGAYLLTSDADEYDKPFMTGER 810
            +GGKVLVPT EF+QK+TAARLAADV +VPTLIIARTDALGAYLLTSD DE DK F TGER
Sbjct: 181  MGGKVLVPTNEFIQKITAARLAADVANVPTLIIARTDALGAYLLTSDIDERDKAFCTGER 240

Query: 811  TAEGFYCVRGGIDAAIARGLAYAPYADLVWFETSEPSMEEAKKFAAAIHAQYPGKLLAYN 990
            TAEGFY VRGGIDAAIARGL+YAPYADLVWFET EP+MEEAKKFAAAIHA++PGKLLAYN
Sbjct: 241  TAEGFYRVRGGIDAAIARGLSYAPYADLVWFETGEPNMEEAKKFAAAIHAKFPGKLLAYN 300

Query: 991  CSPSFNWKKKLSDDEIAKFQKTLGSLGYKFQFITLAGFHSLNYGMFSLARDYASRGMSAY 1170
            CSPSFNWKK LSD+EI  FQKTLG+LGYKFQF+TLAGFH+LNYGMFSLA++Y+  GM+AY
Sbjct: 301  CSPSFNWKKLLSDEEIGAFQKTLGALGYKFQFVTLAGFHALNYGMFSLAKEYSKTGMTAY 360

Query: 1171 AQLQEAEFASEKQGYRATTHQKFVGTGYFDLVSTVITQGTSSTNALKGSTEEEQFH 1338
            ++LQ  EFASEK GY+ATTHQ+FVGTGYFD +S VIT+GTSS  AL GSTEEEQFH
Sbjct: 361  SELQANEFASEKDGYKATTHQRFVGTGYFDALSQVITEGTSSVTALSGSTEEEQFH 416

>ref|ZP_00019480.1| hypothetical protein [Chloroflexus aurantiacus]
          Length = 398

 Score =  587 bits (1512), Expect = e-166
 Identities = 284/392 (72%), Positives = 330/392 (83%)
 Frame = +1

Query: 163  KLRGSIKIEYTLARLGAERFWNLLHTEDYVPALGAMTGGQAVEMVAAGLKAIYLSGWQVA 342
            +LR S++IEYTLAR+GAER WNLLHTE Y+ ALGA+TG QA++ V AGLKAIYLSGWQVA
Sbjct: 7    RLRVSVQIEYTLARMGAERLWNLLHTEPYINALGALTGNQAMQQVKAGLKAIYLSGWQVA 66

Query: 343  ADANSASQTYPDQSLYPVDSVPRVVSRINNAFQRMDQMQHSEGRGDTYWFAPIVADAEAG 522
            ADAN A Q YPDQSLYP +S P++V  INNA +R DQ+ HSEGR D YWFAPIVADAEAG
Sbjct: 67   ADANLAGQMYPDQSLYPANSGPQLVRNINNALRRADQIYHSEGRNDIYWFAPIVADAEAG 126

Query: 523  FGGNLNAYELMKALIEAGASCVHFEDQLASAKKCGHLGGKVLVPTKEFVQKLTAARLAAD 702
            FGG LN +E+MKA IEAGA+ VHFEDQLAS KKCGH+GGKVL+PT+  ++ L AARLAAD
Sbjct: 127  FGGPLNVFEIMKAYIEAGAAGVHFEDQLASEKKCGHMGGKVLIPTQAAIRNLVAARLAAD 186

Query: 703  VMDVPTLIIARTDALGAYLLTSDADEYDKPFMTGERTAEGFYCVRGGIDAAIARGLAYAP 882
            VM VPT+I+ARTDA  A LLTSD DE D+PF TGERT+EGFY VR G+D AIARGLAYAP
Sbjct: 187  VMGVPTIIVARTDANAATLLTSDIDERDRPFCTGERTSEGFYRVRAGLDQAIARGLAYAP 246

Query: 883  YADLVWFETSEPSMEEAKKFAAAIHAQYPGKLLAYNCSPSFNWKKKLSDDEIAKFQKTLG 1062
            YAD++W ETSEP++EEA++FA AIHAQ+PGKLLAYNCSPSFNWKKKL D  IA FQ+ LG
Sbjct: 247  YADMIWCETSEPNLEEARRFAEAIHAQFPGKLLAYNCSPSFNWKKKLDDATIAAFQRELG 306

Query: 1063 SLGYKFQFITLAGFHSLNYGMFSLARDYASRGMSAYAQLQEAEFASEKQGYRATTHQKFV 1242
            ++GYKFQF+TLAGFH+LNY MF LAR+Y  RGM+AY++LQ+AEFA+E  GY AT HQ+ V
Sbjct: 307  AMGYKFQFVTLAGFHALNYSMFELARNYRDRGMAAYSELQQAEFAAEAYGYTATRHQREV 366

Query: 1243 GTGYFDLVSTVITQGTSSTNALKGSTEEEQFH 1338
            GTGYFD V+ VI  G  ST AL GSTEEEQFH
Sbjct: 367  GTGYFDEVAQVIAGGEISTTALTGSTEEEQFH 398

>ref|NP_843617.1| isocitrate lyase [Bacillus anthracis str. Ames]
            gi|30254854|gb|AAP25103.1| isocitrate lyase [Bacillus
            anthracis str. Ames]
          Length = 425

 Score =  584 bits (1506), Expect = e-165
 Identities = 287/406 (70%), Positives = 331/406 (80%)
 Frame = +1

Query: 118  RWSNVKRVYTRQDVEKLRGSIKIEYTLARLGAERFWNLLHTEDYVPALGAMTGGQAVEMV 297
            RW  + R Y+ +DV +LRGSI IE+TLAR GAE+ W  LHTEDY+ ALGA+TG QA++ V
Sbjct: 18   RWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWASLHTEDYINALGALTGNQAMQQV 77

Query: 298  AAGLKAIYLSGWQVAADANSASQTYPDQSLYPVDSVPRVVSRINNAFQRMDQMQHSEGRG 477
             AGLKAIYLSGWQVAADAN +   YPDQSLYP +SVP VV RIN   QR DQ+QH EG G
Sbjct: 78   KAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRINQTLQRADQIQHMEGSG 137

Query: 478  DTYWFAPIVADAEAGFGGNLNAYELMKALIEAGASCVHFEDQLASAKKCGHLGGKVLVPT 657
            DT +F PIVADAEAGFGG LN +ELMK +IEAGAS VHFEDQL+S KKCGHLGGKVL+PT
Sbjct: 138  DTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQLSSEKKCGHLGGKVLLPT 197

Query: 658  KEFVQKLTAARLAADVMDVPTLIIARTDALGAYLLTSDADEYDKPFMTGERTAEGFYCVR 837
            +  V+ L +ARLAADVM VPT+I+ARTDA  A L+TSD D  DK F+TGERT EGFY  +
Sbjct: 198  QTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVDKAFITGERTPEGFYRTK 257

Query: 838  GGIDAAIARGLAYAPYADLVWFETSEPSMEEAKKFAAAIHAQYPGKLLAYNCSPSFNWKK 1017
             G+D AIARGLAYAPYADLVW ETSEP++E+AK+FA AIH ++PGKLLAYNCSPSFNWK+
Sbjct: 258  AGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEHPGKLLAYNCSPSFNWKQ 317

Query: 1018 KLSDDEIAKFQKTLGSLGYKFQFITLAGFHSLNYGMFSLARDYASRGMSAYAQLQEAEFA 1197
            KL +  IA FQK + S GYKFQF+TLAGFHSLNYGMF LAR Y  RGM+AY++LQ+AEFA
Sbjct: 318  KLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGYKERGMAAYSELQQAEFA 377

Query: 1198 SEKQGYRATTHQKFVGTGYFDLVSTVITQGTSSTNALKGSTEEEQF 1335
            +EK GY AT HQ+ VGTGYFD V+ VIT GTSST ALKGSTEE QF
Sbjct: 378  AEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEEAQF 423

>ref|NP_830914.1| Isocitrate lyase [Bacillus cereus ATCC 14579]
            gi|29894826|gb|AAP08115.1| Isocitrate lyase [Bacillus
            cereus ATCC 14579]
          Length = 425

 Score =  582 bits (1501), Expect = e-165
 Identities = 286/407 (70%), Positives = 330/407 (80%)
 Frame = +1

Query: 115  DRWSNVKRVYTRQDVEKLRGSIKIEYTLARLGAERFWNLLHTEDYVPALGAMTGGQAVEM 294
            +RW  + R Y+ +DV +LRGSI IE+TLAR GAE+ W  LHTEDY+ ALGA+TG QA++ 
Sbjct: 17   ERWEGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWTSLHTEDYINALGALTGNQAMQQ 76

Query: 295  VAAGLKAIYLSGWQVAADANSASQTYPDQSLYPVDSVPRVVSRINNAFQRMDQMQHSEGR 474
            V AGLKAIYLSGWQVAADAN +   YPDQSLYP +SVP VV RIN   QR DQ+QH EG 
Sbjct: 77   VKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRINQTLQRADQIQHMEGS 136

Query: 475  GDTYWFAPIVADAEAGFGGNLNAYELMKALIEAGASCVHFEDQLASAKKCGHLGGKVLVP 654
             DT +F PIVADAEAGFGG LN +ELMK +IEAGAS VHFEDQL+S KKCGHLGGKVL+P
Sbjct: 137  DDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQLSSEKKCGHLGGKVLLP 196

Query: 655  TKEFVQKLTAARLAADVMDVPTLIIARTDALGAYLLTSDADEYDKPFMTGERTAEGFYCV 834
            T+  V+ L +ARLAADVM VPT+I+ARTDA  A L+TSD D  DK F+TGERT EGFY  
Sbjct: 197  TQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVDKAFITGERTPEGFYRT 256

Query: 835  RGGIDAAIARGLAYAPYADLVWFETSEPSMEEAKKFAAAIHAQYPGKLLAYNCSPSFNWK 1014
              G+D AIARGLAYAPYADLVW ETSEP++E+AK+FA AIH ++PGKLLAYNCSPSFNWK
Sbjct: 257  NAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEHPGKLLAYNCSPSFNWK 316

Query: 1015 KKLSDDEIAKFQKTLGSLGYKFQFITLAGFHSLNYGMFSLARDYASRGMSAYAQLQEAEF 1194
            +KL +  IA FQK + S GYKFQF+TLAGFHSLNYGMF LAR Y  RGM+AY++LQ+AEF
Sbjct: 317  QKLDEKAIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGYKERGMAAYSELQQAEF 376

Query: 1195 ASEKQGYRATTHQKFVGTGYFDLVSTVITQGTSSTNALKGSTEEEQF 1335
            A+EK GY AT HQ+ VGTGYFD V+ VIT GTSST ALKGSTEE QF
Sbjct: 377  AAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEEAQF 423



EST assemble image


clone accession position
1 LCL054e03_r AV629212 1 475
2 LC057e09_r AV622994 1 520
3 LC087d05_r AV625065 2 521
4 LC058f12_r AV623083 3 515
5 CM002f03_r AV397834 4 551
6 MXL037b02_r BP095171 6 304
7 HC087f07_r AV638540 6 324
8 MXL010g09_r BP093604 6 301
9 HC085e03_r AV638367 6 442
10 HC022g12_r AV633602 6 347
11 LC059e06_r AV623144 6 563
12 HC041a10_r AV635033 6 564
13 HC037g01_r AV634775 6 520
14 HC076b10_r AV637682 6 451
15 LCL070e03_r AV629986 6 374
16 HC036f08_r AV634698 6 486
17 LCL088d12_r AV631078 6 472
18 HC064a12_r AV636783 6 515
19 HC025c10_r AV633793 6 520
20 LC001e07_r AV618932 7 543
21 HCL089e09_r AV644497 7 557
22 LCL088g06_r AV631100 7 472
23 LC003e12_r AV619087 7 486
24 LCL089c06_r AV631128 7 389
25 MXL077a06_r BP097507 9 464
26 MXL043d11_r BP095536 9 495
27 HC017a02_r AV633117 9 460
28 HC025a12_r AV633774 9 512
29 HCL033b05_r AV641411 9 392
30 MXL005h07_r BP093268 9 474
31 CM076a09_r AV391680 10 619
32 MX251c07_r BP092223 10 483
33 MXL042f04_r BP095487 10 494
34 MXL072d02_r BP097242 11 495
35 LCL038d03_r AV628203 11 343
36 HCL073d02_r AV643648 11 523
37 CL78a12_r AV397209 11 456
38 HCL075b04_r AV643738 11 470
39 MX049g09_r BP088030 12 370
40 HCL027f05_r AV641090 12 475
41 HCL020f03_r AV640687 12 174
42 HC008e04_r AV632458 12 520
43 CM100c03_r AV392814 16 522
44 HC045f03_r AV635378 17 499
45 CM004e05_r AV386648 17 546
46 MXL097c06_r BP098676 17 379
47 MXL047a07_r BP095763 17 404
48 MXL043e07_r BP095540 17 453
49 HCL038g03_r AV641690 17 553
50 HC094f02_r AV639069 18 310
51 MX238c01_r BP091403 18 269
52 HCL076g04_r AV643826 18 401
53 LCL029f09_r AV627626 18 556
54 MXL009b02_r BP093489 19 472
55 HC074c05_r AV637530 19 510
56 HC046b06_r AV635420 19 500
57 MXL020e02_r BP094278 19 545
58 MX231c12_r BP090937 20 420
59 HC049a04_r AV635644 21 520
60 HCL072c10_r AV643588 21 524
61 HC060a04_r AV636474 21 465
62 HCL075g01_r AV643771 21 497
63 MX241h01_r BP091623 22 501
64 HCL019b12_r AV640612 23 194
65 MXL013c12_r BP093763 23 539
66 MXL006f06_r BP093316 23 358
67 MX260c10_r BP092875 24 375
68 CM040a06_r AV389174 25 592
69 HC085c03_r AV638347 25 454
70 CM050c02_r AV389736 25 360
71 HC080f03_r AV638011 25 475
72 HC040e12_r AV634994 27 498
73 HC083f01_r AV638231 27 453
74 LC092d02_r AV625426 33 408
75 HC061g10_r AV636613 57 459
76 MX018d04_r BP086848 138 525
77 MXL071a04_r BP097156 144 518
78 LCL095a02_r AV631493 146 411
79 CM008h07_r AV386730 150 667
80 MXL067e05_r BP096948 173 581
81 HCL095b09_r AV644892 179 667
82 HC060d04_r AV636503 187 698
83 MX055e10_r BP088256 213 363
84 HC076h12_r AV637745 322 763
85 MXL003c09_r BP093095 351 722
86 MX253d07_r BP092379 367 750
87 HC089h10_r AV638723 402 787
88 MX060e09_r BP088438 410 887
89 MX049d06_r BP088012 434 867
90 MX239a11_r BP091457 435 703
91 LC068f09_r AV623792 437 954
92 CM050d03_r AV389758 457 719
93 HC003h06_r AV632096 464 962
94 HC003b09_r AV632041 464 896
95 HC071b06_r AV637286 465 927
96 HC043g01_r AV635238 514 1014
97 CM076c03_r AV391705 519 1147
98 HC023a09_r AV633619 520 926
99 HCL056e09_r AV642712 536 1070
100 HCL014e08_r AV640341 543 1008
101 HC030g05_r AV634226 582 1096
102 HC076f10_r AV637723 584 1040
103 MX259b05_r BP092785 585 934
104 HC072c07_r AV637370 589 1073
105 CM096g08_r AV392789 608 1067
106 MX055a03_r BP088235 625 989
107 HC027d06_r AV633957 644 1199
108 MX003a12_r BP086163 654 1078
109 HC016h10_r AV633114 658 1003
110 MXL064a11_r BP096739 673 1076
111 CM087f10_r AV392469 696 1292
112 MX028f08_r BP087236 696 1182
113 HC006f11_r AV632318 703 1219
114 MX101e04_r BP088823 749 1085
115 MX254f12_r BP092475 752 1130
116 HC034g03_r AV634540 755 1294
117 MX216c01_r BP089938 756 1234
118 CM100e06_r AV392828 758 1260
119 CM089h01_r AV392230 759 1358
120 MXL038f09_r BP095241 761 1220
121 HC046c10_r AV635434 762 1356
122 MX033d11_r BP087381 773 1317
123 HC075f05_r AV637634 795 1300
124 HC087f05_r AV638538 798 1228
125 HC044f06_r AV635304 809 1304
126 MX101a06_r BP088784 810 1349
127 MX101e06_r BP088825 816 1287
128 CM013g02_r AV387040 818 1141
129 HC028e09_r AV634046 820 1355
130 HC073h04_r AV637498 821 1234
131 CM053d09_r AV389896 824 1221
132 HC035a05_r AV634565 826 1312
133 MX102d04_r BP088895 827 1329
134 MX103f02_r BP088997 827 1233
135 MX101e09_r BP088827 827 1259
136 MX101c12_r BP088809 827 1235
137 MX101a12_r BP088788 827 1256
138 MX101d11_r BP088819 827 1235
139 MX103g03_r BP089008 827 1316
140 MX101d07_r BP088815 827 1236
141 MX102b03_r BP088876 827 1225
142 MX101c11_r BP088808 827 1216
143 MX101c01_r BP088800 827 1223
144 MX102d03_r BP088894 827 1319
145 MX103b06_r BP088959 827 1350
146 MX103f04_r BP088999 827 1320
147 MX102e04_r BP088904 827 1113
148 MX101e05_r BP088824 827 1304
149 MX103e01_r BP088985 827 1240
150 MX101d01_r BP088810 827 1230
151 MX103c04_r BP088967 827 1321
152 MX103h03_r BP089019 827 1301
153 MX101b12_r BP088799 827 1228
154 MX104a01_r BP089027 827 1250
155 MX102a05_r BP088866 827 1323
156 MX102e08_r BP088908 827 1284
157 MX102c06_r BP088889 827 1186
158 MX103g02_r BP089007 827 1231
159 MX102h07_r BP088938 827 1243
160 CM034b04_r AV388609 827 1281
161 MX102a10_r BP088871 827 1226
162 MX102d06_r BP088897 827 1263
163 MX102b01_r BP088874 827 1251
164 MX101a02_r BP088781 827 1260
165 MX101e02_r BP088821 827 1311
166 MX102a02_r BP088863 827 1258
167 MX101h05_r BP088855 827 1146
168 MX102f02_r BP088913 827 1124
169 MX103a06_r BP088948 827 1348
170 MX101f06_r BP088835 827 1350
171 MX102e02_r BP088902 827 1255
172 MX102b04_r BP088877 827 1133
173 MX101a01_r BP088780 827 1138
174 MX102d12_r BP088900 835 1217
175 HC089e01_r AV638688 845 1142
176 MX102b10_r BP088883 867 1103
177 HC011g12_r AV632724 877 1375
178 LC091a02_r AV625328 877 1278
179 HC023d08_r AV633644 886 1405
180 LC039c10_r AV621664 887 1419
181 HC077b07_r AV637760 891 1422
182 CM061e04_r AV390605 931 1536
183 HC046f03_r AV635461 932 1441
184 MX058g05_r BP088368 948 1395
185 HC050f06_r AV635766 955 1482
186 CM070g09_r AV391298 981 1564
187 CL41b01_r AV395398 994 1505
188 HC008e08_r AV632462 1045 1401
189 MX228h08_r BP090771 1076 1372
190 HC032e08_r AV634370 1220 1689
191 CM039g06_r AV388946 1397 1955
192 CM017f09_r AV388207 1400 1896
193 CM055h04_r AV390261 1403 2000
194 CL37f03_r AV395266 1448 1948
195 HC040h08_r AV635022 1462 1985
196 HCL043h01_r AV642009 1502 2014
197 HC027g09_r AV633988 1518 2018
198 HCL002a11_r AV639626 1546 1989
199 HC028e02_r AV634040 1556 2043
200 HC069e03_r AV637153 1579 1989
201 HC092h04_r AV638941 1579 1989
202 LCL060c06_r AV629526 1595 2037
203 LC038b02_r AV621585 1604 2031
204 CM053f11_r AV389890 1662 1989
205 HCL095h02_r AV644948 1670 1989
206 HCL098f06_r AV645132 1845 2083




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research