KCC000524A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000524A_C01 KCC000524A_c01
ccgacgagctgtgcgagttccCCGTGGTTTACGCCTCGGGTGTGAATGGCATTGCCGGCA
TGACCCCGGAGACGCTGGCTGAGGACCTGGAGCCCCTGTTTGCGACCATTGTCAAGGAGA
TCCGCCCGCCCTCCGTGCAGCCGGCGGCGCCCCTGCAGCTGCTGTGCGCCAACATCGACT
ACGATGAGCACAAGGGCCGCATCGCCATCGGCCGCGTCAGCAGCGGCACCATCAAGCGTG
GCCAGACCATCTCGATCTGCTCCTCGCTGGAGCCCGGCAAGGTGCGCCAGGCCAAGATCG
CTGAGCTGTTCGTGTACGACAACTTCAGCCGCGTGCCGGTCGATGAGGTGGCGGCTGGTG
ACATCTGTGCGCTGTCGGGCATTGCCGATATCAAGATCGGCGAGACCATCACCCAGCGCG
AGAACCCCGGTGCCCCTGGCCCACCATCCAGGTGGAGGACCCAACCGTGAACATGACCTT
CAAGGTCAACACCTCGCCCTTCGCCGGCAAGGAGGGCAAGTTCGTGACCTCGCGCAACCT
GAAGGACCGCCTGGATCGCGAGCTGGAGCGTAACCTGGCGCTGCGCGTGGAGCCCGGTGA
GACCTCGGACTCGTTCGTGGTGTCTGGCCGCGGTACTCTGCACCTGGGTATCCTCATTGA
GAACATGCGTCGTGAGGGCTACGAGTTCGAGATTGGCCCCCCGAAGGTCATCACCCGCGA
GGTGAACTGGCAAGACGTGCGAGCCCTACGAGGAGGCCATTGTGGACGTGCCGGAGCAGT
ACGTGGGCGCCGTCGTGGAGCTGTTCGCCCAGCGGAAGGGCGAGATGGTGGACCTGATCC
CCTCGATCCAGGGCGCCTCGCGCATCAAGTTCCGTATCGCCACCCGCGGCCTACTGGGCC
TGAAGAACTCGCTGCTGACCGCCACCCGCGGCCTGGGCTGTCATGAACACCCTGTTCCTC
GAGTACGCCCCTGTTGCGGGCGAGATTCTGATGCGCGAGAACGGCTCTCTGGTGGCGCAC
GAGACCGGCCAGGCCACGACGTACGCTCTGGAGAGCGCGCAGGACCGCGGCCAGATGTTC
TGCCGCCCCGGCGACCAGGTGTACGAGGGCCAGGTGATTGGCATGCACGCCAAGGCGGGA
GACCTGAAGGTCAACATCTGCAAGACCAAGCAGCTGACCAACATGCGCGCCGCCGGCAAG
GACACCAAGGTGGGCCTGGACGAGCCCCGCAGCATGGGGCCTGGACGACTCGCTCGAGTA
CATCAACGACGACGAGCAGGTGGAGGTGACGCCCAAGAGCATCCGCATCCGCAAGGACCC
CATGGCTGCCAACAAGGGCAAGAAGGGCCGCTAAAGCATACAGTGATGACGACCCGTAAG
AAAGATCGTGTGTGGTGTTGACTAATGACACGCACCGTCGCAGCAGTGCAGTGGTTTGGC
CTGGCTGTGTGCCCGATTCGGTTCTTGCTCGGCAATGTCATTTTGTGTGATGCGTGCCAT
TCACTTGTTGTTACGTAGCCATGTAGTGGGATTCCTGATGTTGTTTGCAGCACTTCGTTT
GCTTCCAGAGCGCGTCTGGTTTGTTTCTGGTGGTTTCGTTTGTGGTCCATGTGGTGGTTC
ATCCGCATGCAGCTAGTCGTGAGCTGTGAGAAGATGGTGACGTAAAGAGCGCACAGCGCG
ACTGTGAGGGTTATAAGAGTGTGGACGATGTGAGCAGGAGAGGAGAGGGGAGCCCGGTAC
ACCGTTGCTACGCAGAATCTGGTGAGCATTTAGGCAGTGCCGATGCACCGAACATCTGAG
GAGCGGGGACTGGGGTGGGTCGCATGGGTACATTGCATGCATACGGCATGAAAGCCGGCC
GCCCGAGTATGTTGGCGCTGGGGTGGGCTGCTGAATGGCGTTGCATGACCCCGCAGATCA
AGCTCCTGTGTAACGCAACCTCTTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000524A_C01 KCC000524A_c01
         (1945 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_568289.3| GTP-binding protein typA (tyrosine phosphorylat...   162  e-110
ref|NP_851035.1| GTP-binding protein typA (tyrosine phosphorylat...   162  e-110
dbj|BAB08691.1| GTP-binding protein typA (tyrosine phosphorylate...   162  e-110
ref|NP_622534.1| predicted membrane GTPase involved in stress re...   130  e-103
ref|ZP_00019001.1| hypothetical protein [Chloroflexus aurantiacus]    130  e-100

>ref|NP_568289.3| GTP-binding protein typA (tyrosine phosphorylated protein A)
           [Arabidopsis thaliana]
          Length = 676

 Score =  162 bits (410), Expect(4) = e-110
 Identities = 81/136 (59%), Positives = 104/136 (75%), Gaps = 7/136 (5%)
 Frame = +2

Query: 434 PWPTIQVEDPTVNMTFKVNTSPFAGKEGKFVTSRNLKDRLDRELERNLALRVEPGETSDS 613
           P PTI+VE+PTV M+F VNTSPF+G+EGK+VTSRNL+DRL+RELERNLA++VE GET+D+
Sbjct: 374 PLPTIKVEEPTVKMSFSVNTSPFSGREGKYVTSRNLRDRLNRELERNLAMKVEDGETADT 433

Query: 614 FVVSGRGTLHLGILIENMRREGYEFEIGPPKVITREVNWQDVR-------ALRGGHCGRA 772
           F+VSGRGTLH+ ILIENMRREGYEF +GPPKVI + VN + +         +   H G  
Sbjct: 434 FIVSGRGTLHITILIENMRREGYEFMVGPPKVINKRVNDKLLEPYEIATVEVPEAHMGPV 493

Query: 773 GAVRGRRRGAVRPAEG 820
             + G+RRG +   +G
Sbjct: 494 VELLGKRRGQMFDMQG 509

 Score =  152 bits (384), Expect(4) = e-110
 Identities = 73/147 (49%), Positives = 105/147 (70%)
 Frame = +3

Query: 3   DELCEFPVVYASGVNGIAGMTPETLAEDLEPLFATIVKEIRPPSVQPAAPLQLLCANIDY 182
           DE C+F  +YASG+ G AG++P+ LAEDL PLF  I++ +  P+++    LQ+L  NI+Y
Sbjct: 233 DEQCDFQAIYASGIKGKAGLSPDDLAEDLGPLFEAIIRCVPGPNIEKDGALQMLATNIEY 292

Query: 183 DEHKGRIAIGRVSSGTIKRGQTISICSSLEPGKVRQAKIAELFVYDNFSRVPVDEVAAGD 362
           DEHKGRIAIGR+ +G +++G  + +C+S +    R A+++ELFVY+ F RVP D V AGD
Sbjct: 293 DEHKGRIAIGRLHAGVLRKGMDVRVCTSED--SCRFARVSELFVYEKFYRVPTDSVEAGD 350

Query: 363 ICALSGIADIKIGETITQRENPGAPGP 443
           ICA+ GI +I+IGETI  + + G P P
Sbjct: 351 ICAVCGIDNIQIGETIADKVH-GKPLP 376

 Score =  104 bits (260), Expect(4) = e-110
 Identities = 53/97 (54%), Positives = 69/97 (70%)
 Frame = +1

Query: 937  AVMNTLFLEYAPVAGEILMRENGSLVAHETGQATTYALESAQDRGQMFCRPGDQVYEGQV 1116
            A++NT+F  Y P AG+I  R+ GSLVA E G +T+YAL SAQ+RGQMF   G  VY+GQ+
Sbjct: 542  AILNTVFDSYGPWAGDISTRDLGSLVAFEDGTSTSYALASAQERGQMFVGSGVDVYKGQI 601

Query: 1117 IGMHAKAGDLKVNICKTKQLTNMRAAGKDTKVGLDEP 1227
            +G+H + GDL +NICK K  TN+R + KD  V LD P
Sbjct: 602  VGIHQRPGDLGLNICKKKAATNIR-SNKDVTVILDTP 637

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 36/81 (44%), Positives = 55/81 (67%), Gaps = 1/81 (1%)
 Frame = +3

Query: 693 LAPRRSSPAR*TGKTCEPYEEAIVDVPEQYVGAVVELFAQRKGEMVDLI-PSIQGASRIK 869
           + P +    R   K  EPYE A V+VPE ++G VVEL  +R+G+M D+     +G + ++
Sbjct: 460 VGPPKVINKRVNDKLLEPYEIATVEVPEAHMGPVVELLGKRRGQMFDMQGVGSEGTTFLR 519

Query: 870 FRIATRGLLGLKNSLLTATRG 932
           ++I TRGLLGL+N++LTA+RG
Sbjct: 520 YKIPTRGLLGLRNAILTASRG 540

 Score = 47.0 bits (110), Expect(4) = e-110
 Identities = 21/41 (51%), Positives = 29/41 (70%)
 Frame = +2

Query: 1223 SPAAWGLDDSLEYINDDEQVEVTPKSIRIRKDPMAANKGKK 1345
            +P  + LDD +EYI +DE VEVTP SIR+ K+   A KG++
Sbjct: 636  TPLTYSLDDCIEYIEEDELVEVTPSSIRMCKNQKMAKKGRQ 676

>ref|NP_851035.1| GTP-binding protein typA (tyrosine phosphorylated protein A)
           [Arabidopsis thaliana]
          Length = 675

 Score =  162 bits (410), Expect(4) = e-110
 Identities = 81/136 (59%), Positives = 104/136 (75%), Gaps = 7/136 (5%)
 Frame = +2

Query: 434 PWPTIQVEDPTVNMTFKVNTSPFAGKEGKFVTSRNLKDRLDRELERNLALRVEPGETSDS 613
           P PTI+VE+PTV M+F VNTSPF+G+EGK+VTSRNL+DRL+RELERNLA++VE GET+D+
Sbjct: 373 PLPTIKVEEPTVKMSFSVNTSPFSGREGKYVTSRNLRDRLNRELERNLAMKVEDGETADT 432

Query: 614 FVVSGRGTLHLGILIENMRREGYEFEIGPPKVITREVNWQDVR-------ALRGGHCGRA 772
           F+VSGRGTLH+ ILIENMRREGYEF +GPPKVI + VN + +         +   H G  
Sbjct: 433 FIVSGRGTLHITILIENMRREGYEFMVGPPKVINKRVNDKLLEPYEIATVEVPEAHMGPV 492

Query: 773 GAVRGRRRGAVRPAEG 820
             + G+RRG +   +G
Sbjct: 493 VELLGKRRGQMFDMQG 508

 Score =  152 bits (384), Expect(4) = e-110
 Identities = 73/147 (49%), Positives = 105/147 (70%)
 Frame = +3

Query: 3   DELCEFPVVYASGVNGIAGMTPETLAEDLEPLFATIVKEIRPPSVQPAAPLQLLCANIDY 182
           DE C+F  +YASG+ G AG++P+ LAEDL PLF  I++ +  P+++    LQ+L  NI+Y
Sbjct: 232 DEQCDFQAIYASGIKGKAGLSPDDLAEDLGPLFEAIIRCVPGPNIEKDGALQMLATNIEY 291

Query: 183 DEHKGRIAIGRVSSGTIKRGQTISICSSLEPGKVRQAKIAELFVYDNFSRVPVDEVAAGD 362
           DEHKGRIAIGR+ +G +++G  + +C+S +    R A+++ELFVY+ F RVP D V AGD
Sbjct: 292 DEHKGRIAIGRLHAGVLRKGMDVRVCTSED--SCRFARVSELFVYEKFYRVPTDSVEAGD 349

Query: 363 ICALSGIADIKIGETITQRENPGAPGP 443
           ICA+ GI +I+IGETI  + + G P P
Sbjct: 350 ICAVCGIDNIQIGETIADKVH-GKPLP 375

 Score =  104 bits (260), Expect(4) = e-110
 Identities = 53/97 (54%), Positives = 69/97 (70%)
 Frame = +1

Query: 937  AVMNTLFLEYAPVAGEILMRENGSLVAHETGQATTYALESAQDRGQMFCRPGDQVYEGQV 1116
            A++NT+F  Y P AG+I  R+ GSLVA E G +T+YAL SAQ+RGQMF   G  VY+GQ+
Sbjct: 541  AILNTVFDSYGPWAGDISTRDLGSLVAFEDGTSTSYALASAQERGQMFVGSGVDVYKGQI 600

Query: 1117 IGMHAKAGDLKVNICKTKQLTNMRAAGKDTKVGLDEP 1227
            +G+H + GDL +NICK K  TN+R + KD  V LD P
Sbjct: 601  VGIHQRPGDLGLNICKKKAATNIR-SNKDVTVILDTP 636

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 36/81 (44%), Positives = 55/81 (67%), Gaps = 1/81 (1%)
 Frame = +3

Query: 693 LAPRRSSPAR*TGKTCEPYEEAIVDVPEQYVGAVVELFAQRKGEMVDLI-PSIQGASRIK 869
           + P +    R   K  EPYE A V+VPE ++G VVEL  +R+G+M D+     +G + ++
Sbjct: 459 VGPPKVINKRVNDKLLEPYEIATVEVPEAHMGPVVELLGKRRGQMFDMQGVGSEGTTFLR 518

Query: 870 FRIATRGLLGLKNSLLTATRG 932
           ++I TRGLLGL+N++LTA+RG
Sbjct: 519 YKIPTRGLLGLRNAILTASRG 539

 Score = 47.0 bits (110), Expect(4) = e-110
 Identities = 21/41 (51%), Positives = 29/41 (70%)
 Frame = +2

Query: 1223 SPAAWGLDDSLEYINDDEQVEVTPKSIRIRKDPMAANKGKK 1345
            +P  + LDD +EYI +DE VEVTP SIR+ K+   A KG++
Sbjct: 635  TPLTYSLDDCIEYIEEDELVEVTPSSIRMCKNQKMAKKGRQ 675

>dbj|BAB08691.1| GTP-binding protein typA (tyrosine phosphorylated protein A)
           [Arabidopsis thaliana]
          Length = 609

 Score =  162 bits (410), Expect(4) = e-110
 Identities = 81/136 (59%), Positives = 104/136 (75%), Gaps = 7/136 (5%)
 Frame = +2

Query: 434 PWPTIQVEDPTVNMTFKVNTSPFAGKEGKFVTSRNLKDRLDRELERNLALRVEPGETSDS 613
           P PTI+VE+PTV M+F VNTSPF+G+EGK+VTSRNL+DRL+RELERNLA++VE GET+D+
Sbjct: 307 PLPTIKVEEPTVKMSFSVNTSPFSGREGKYVTSRNLRDRLNRELERNLAMKVEDGETADT 366

Query: 614 FVVSGRGTLHLGILIENMRREGYEFEIGPPKVITREVNWQDVR-------ALRGGHCGRA 772
           F+VSGRGTLH+ ILIENMRREGYEF +GPPKVI + VN + +         +   H G  
Sbjct: 367 FIVSGRGTLHITILIENMRREGYEFMVGPPKVINKRVNDKLLEPYEIATVEVPEAHMGPV 426

Query: 773 GAVRGRRRGAVRPAEG 820
             + G+RRG +   +G
Sbjct: 427 VELLGKRRGQMFDMQG 442

 Score =  152 bits (384), Expect(4) = e-110
 Identities = 73/147 (49%), Positives = 105/147 (70%)
 Frame = +3

Query: 3   DELCEFPVVYASGVNGIAGMTPETLAEDLEPLFATIVKEIRPPSVQPAAPLQLLCANIDY 182
           DE C+F  +YASG+ G AG++P+ LAEDL PLF  I++ +  P+++    LQ+L  NI+Y
Sbjct: 166 DEQCDFQAIYASGIKGKAGLSPDDLAEDLGPLFEAIIRCVPGPNIEKDGALQMLATNIEY 225

Query: 183 DEHKGRIAIGRVSSGTIKRGQTISICSSLEPGKVRQAKIAELFVYDNFSRVPVDEVAAGD 362
           DEHKGRIAIGR+ +G +++G  + +C+S +    R A+++ELFVY+ F RVP D V AGD
Sbjct: 226 DEHKGRIAIGRLHAGVLRKGMDVRVCTSED--SCRFARVSELFVYEKFYRVPTDSVEAGD 283

Query: 363 ICALSGIADIKIGETITQRENPGAPGP 443
           ICA+ GI +I+IGETI  + + G P P
Sbjct: 284 ICAVCGIDNIQIGETIADKVH-GKPLP 309

 Score =  104 bits (260), Expect(4) = e-110
 Identities = 53/97 (54%), Positives = 69/97 (70%)
 Frame = +1

Query: 937  AVMNTLFLEYAPVAGEILMRENGSLVAHETGQATTYALESAQDRGQMFCRPGDQVYEGQV 1116
            A++NT+F  Y P AG+I  R+ GSLVA E G +T+YAL SAQ+RGQMF   G  VY+GQ+
Sbjct: 475  AILNTVFDSYGPWAGDISTRDLGSLVAFEDGTSTSYALASAQERGQMFVGSGVDVYKGQI 534

Query: 1117 IGMHAKAGDLKVNICKTKQLTNMRAAGKDTKVGLDEP 1227
            +G+H + GDL +NICK K  TN+R + KD  V LD P
Sbjct: 535  VGIHQRPGDLGLNICKKKAATNIR-SNKDVTVILDTP 570

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 36/81 (44%), Positives = 55/81 (67%), Gaps = 1/81 (1%)
 Frame = +3

Query: 693 LAPRRSSPAR*TGKTCEPYEEAIVDVPEQYVGAVVELFAQRKGEMVDLI-PSIQGASRIK 869
           + P +    R   K  EPYE A V+VPE ++G VVEL  +R+G+M D+     +G + ++
Sbjct: 393 VGPPKVINKRVNDKLLEPYEIATVEVPEAHMGPVVELLGKRRGQMFDMQGVGSEGTTFLR 452

Query: 870 FRIATRGLLGLKNSLLTATRG 932
           ++I TRGLLGL+N++LTA+RG
Sbjct: 453 YKIPTRGLLGLRNAILTASRG 473

 Score = 47.0 bits (110), Expect(4) = e-110
 Identities = 21/41 (51%), Positives = 29/41 (70%)
 Frame = +2

Query: 1223 SPAAWGLDDSLEYINDDEQVEVTPKSIRIRKDPMAANKGKK 1345
            +P  + LDD +EYI +DE VEVTP SIR+ K+   A KG++
Sbjct: 569  TPLTYSLDDCIEYIEEDELVEVTPSSIRMCKNQKMAKKGRQ 609

>ref|NP_622534.1| predicted membrane GTPase involved in stress response
           [Thermoanaerobacter tengcongensis]
           gi|20515881|gb|AAM24138.1| predicted membrane GTPase
           involved in stress response [Thermoanaerobacter
           tengcongensis]
          Length = 606

 Score =  130 bits (327), Expect(5) = e-103
 Identities = 63/98 (64%), Positives = 79/98 (80%)
 Frame = +2

Query: 434 PWPTIQVEDPTVNMTFKVNTSPFAGKEGKFVTSRNLKDRLDRELERNLALRVEPGETSDS 613
           P   +++E+PTV+MTF VNTSPFAG EGK+VTSR+L++RL +ELE N+ALRVE  ++ DS
Sbjct: 299 PVDFVEIEEPTVSMTFSVNTSPFAGTEGKYVTSRHLRERLFKELETNVALRVEETDSPDS 358

Query: 614 FVVSGRGTLHLGILIENMRREGYEFEIGPPKVITREVN 727
           F VSGRG LHL ILIE MRREGYE ++  P VI +EVN
Sbjct: 359 FKVSGRGELHLSILIETMRREGYELQVSKPTVIFKEVN 396

 Score =  127 bits (319), Expect(5) = e-103
 Identities = 64/142 (45%), Positives = 91/142 (64%)
 Frame = +3

Query: 3   DELCEFPVVYASGVNGIAGMTPETLAEDLEPLFATIVKEIRPPSVQPAAPLQLLCANIDY 182
           D+  +FPVVY SG  GIA +  +  + DL PLF TI+K I  PS     P QL+   +DY
Sbjct: 158 DDQIDFPVVYTSGKGGIAKLDLKEESRDLRPLFETIIKYIPAPSGDIEGPFQLIVTTLDY 217

Query: 183 DEHKGRIAIGRVSSGTIKRGQTISICSSLEPGKVRQAKIAELFVYDNFSRVPVDEVAAGD 362
           D++ GRIAIG+V  G IK G+ ++IC   + G +++  I  ++ ++   RVPV+E   GD
Sbjct: 218 DDYIGRIAIGKVVRGRIKAGEEVAICK--KGGSIQKFNINNIYQFEGLRRVPVEEAKLGD 275

Query: 363 ICALSGIADIKIGETITQRENP 428
           I A+SGI DI+IGETI  ++NP
Sbjct: 276 IVAVSGIRDIEIGETIADKDNP 297

 Score =  102 bits (253), Expect(5) = e-103
 Identities = 47/99 (47%), Positives = 68/99 (68%)
 Frame = +1

Query: 940  VMNTLFLEYAPVAGEILMRENGSLVAHETGQATTYALESAQDRGQMFCRPGDQVYEGQVI 1119
            +M ++F  Y P  GEI  R  G+LVA ETG ATTY L  AQ+RG +F  PG +VYEG V+
Sbjct: 467  IMTSVFYGYEPYKGEIPSRSRGALVAFETGIATTYGLYHAQERGTLFIEPGTKVYEGMVV 526

Query: 1120 GMHAKAGDLKVNICKTKQLTNMRAAGKDTKVGLDEPRSM 1236
            GM++++GD++VN+CK K +TN+R+A  +  + L   + M
Sbjct: 527  GMNSRSGDIEVNVCKKKHVTNLRSATAEEALRLSPVKKM 565

 Score = 65.1 bits (157), Expect(5) = e-103
 Identities = 31/70 (44%), Positives = 44/70 (62%)
 Frame = +3

Query: 729 GKTCEPYEEAIVDVPEQYVGAVVELFAQRKGEMVDLIPSIQGASRIKFRIATRGLLGLKN 908
           G   EP E   VD+PE+Y+G V+E    RK E++D+     G  R+KF+I TRGL+G ++
Sbjct: 397 GVKMEPIELLTVDIPEEYMGVVMEKLGPRKAELMDMHTLKPGTIRLKFKIPTRGLIGYRS 456

Query: 909 SLLTATRGLG 938
             LT T+G G
Sbjct: 457 EFLTDTKGNG 466

 Score = 38.9 bits (89), Expect(5) = e-103
 Identities = 17/25 (68%), Positives = 24/25 (96%)
 Frame = +2

Query: 1241 LDDSLEYINDDEQVEVTPKSIRIRK 1315
            L+++LE+I++DE VEVTP+SIRIRK
Sbjct: 567  LEEALEFIDNDELVEVTPQSIRIRK 591

>ref|ZP_00019001.1| hypothetical protein [Chloroflexus aurantiacus]
          Length = 613

 Score =  130 bits (327), Expect(5) = e-100
 Identities = 62/94 (65%), Positives = 79/94 (83%)
 Frame = +2

Query: 440 PTIQVEDPTVNMTFKVNTSPFAGKEGKFVTSRNLKDRLDRELERNLALRVEPGETSDSFV 619
           P I+VE+PTV MTF VNTSPFAG+EG +VTSR L++RL +E+ER++ALRVE  ++ D F+
Sbjct: 300 PPIKVEEPTVRMTFGVNTSPFAGREGTYVTSRKLRERLFQEMERDVALRVEETDSPDVFI 359

Query: 620 VSGRGTLHLGILIENMRREGYEFEIGPPKVITRE 721
           V+GRG LHLGILIE MRREGYEF++  P+VI RE
Sbjct: 360 VAGRGELHLGILIETMRREGYEFQVSKPEVIFRE 393

 Score =  111 bits (277), Expect(5) = e-100
 Identities = 58/147 (39%), Positives = 84/147 (56%)
 Frame = +3

Query: 3   DELCEFPVVYASGVNGIAGMTPETLAEDLEPLFATIVKEIRPPSVQPAAPLQLLCANIDY 182
           DE  EF  +Y + + G AG +P  L + LEPLF  I+  I PP+V    P+Q L     Y
Sbjct: 157 DEQAEFATIYTNALLGHAGRSPLKLHDSLEPLFECILDRIPPPTVDVEGPVQFLVTTSSY 216

Query: 183 DEHKGRIAIGRVSSGTIKRGQTISICSSLEPGKVRQAKIAELFVYDNFSRVPVDEVAAGD 362
           DE+KG+I  GR+  GTI++GQ   +      G +   K++++FVY+   R  V++  AGD
Sbjct: 217 DEYKGKILTGRLVRGTIRKGQ--PLVRIARDGTISPVKVSQIFVYNGLERQEVEQAQAGD 274

Query: 363 ICALSGIADIKIGETITQRENPGAPGP 443
           I A++GI+D  IG+TI     P A  P
Sbjct: 275 IIAIAGISDAAIGDTIADALAPEALPP 301

 Score =  110 bits (275), Expect(5) = e-100
 Identities = 52/99 (52%), Positives = 67/99 (67%)
 Frame = +1

Query: 940  VMNTLFLEYAPVAGEILMRENGSLVAHETGQATTYALESAQDRGQMFCRPGDQVYEGQVI 1119
            +M+++F  Y P AGEI MR NGSL+A E+G ATTYA+ + QDRG  F  PG +VYEG V+
Sbjct: 467  IMHSIFFGYEPYAGEIEMRANGSLIAAESGVATTYAIHALQDRGVFFITPGQEVYEGMVV 526

Query: 1120 GMHAKAGDLKVNICKTKQLTNMRAAGKDTKVGLDEPRSM 1236
            G H +  DL+VN+CK K LTNMR       + LD PR +
Sbjct: 527  GQHIRDNDLEVNVCKEKHLTNMRNNRGAETIRLDAPRQL 565

 Score = 58.5 bits (140), Expect(5) = e-100
 Identities = 30/70 (42%), Positives = 41/70 (57%)
 Frame = +3

Query: 729 GKTCEPYEEAIVDVPEQYVGAVVELFAQRKGEMVDLIPSIQGASRIKFRIATRGLLGLKN 908
           G   EP E   ++V  +Y G VVEL  +R+G+M D+  S  G+    + + TRGLLG + 
Sbjct: 397 GTRLEPMELVEIEVASEYQGVVVELLGKRQGQMRDMRISEDGSVHYVYLVPTRGLLGFRQ 456

Query: 909 SLLTATRGLG 938
             LTATRG G
Sbjct: 457 LFLTATRGTG 466

 Score = 43.9 bits (102), Expect(5) = e-100
 Identities = 20/41 (48%), Positives = 30/41 (72%)
 Frame = +2

Query: 1223 SPAAWGLDDSLEYINDDEQVEVTPKSIRIRKDPMAANKGKK 1345
            +P    LDD++EYI+DDE VEVTPK  RIRK  ++++  ++
Sbjct: 561  APRQLSLDDAIEYISDDELVEVTPKGWRIRKRLLSSDDRRR 601



EST assemble image


clone accession position
1 HCL042f01_r AV641929 1 330
2 HCL024e03_r AV640907 22 484
3 HC021g07_r AV633523 54 457
4 MX017b06_r BP086804 55 434
5 HC057h08_r AV636316 116 570
6 MX223c05_r BP090388 196 526
7 HC010f06_r AV632634 233 694
8 CM098d04_r AV392912 263 773
9 CL37e01_r AV395253 276 653
10 HC069e10_r AV637159 284 769
11 LCL006d03_r AV626303 386 805
12 HC052a01_r AV635864 394 961
13 MX226d08_r BP090609 420 723
14 MX215g09_r BP089908 429 796
15 HC001e01_r AV631900 434 926
16 HC075e03_r AV637622 485 924
17 CM007c01_r AV386787 490 937
18 MX038f01_r BP087600 525 761
19 HC056f02_r AV636215 535 1058
20 HC097b01_r AV639260 552 789
21 MX034g09_r BP087449 587 967
22 MX253h05_r BP092417 678 1062
23 HC014e10_r AV632934 683 1044
24 HC048f06_r AV635620 703 1185
25 CM061b02_r AV390634 724 1316
26 HC030f05_r AV634216 731 1234
27 HC031e06_r AV634291 731 1217
28 MXL074b07_r BP097341 773 1179
29 MXL074b08_r BP097342 788 1146
30 LC042h12_r AV621945 858 1363
31 HC065a08_r AV636847 861 1352
32 LC049c06_r AV622407 913 1443
33 HC033d12_r AV634443 916 1472
34 MXL067a07_r BP096914 916 1300
35 HC006g05_r AV632323 927 1442
36 HCL013d11_r AV640269 1010 1541
37 MX017b01_r BP086802 1038 1516
38 HC021g02_r AV633518 1079 1556
39 MX235d03_r BP091206 1084 1434
40 HC039d07_r AV634897 1147 1627
41 CM056c04_r AV390297 1377 1993
42 MX223c07_r BP090389 1392 1686
43 HCL072d07_r AV643593 1461 1964
44 CM007b01_r AV386785 1471 1964
45 CM082a11_r AV392125 1480 1964
46 HC019h07_r AV633360 1492 2069
47 HCL087f05_r AV644386 1519 1964
48 HC003d07_r AV632061 1530 1964
49 HCL053e04_r AV642533 1553 1962
50 MX238g12_r BP091443 1691 1964




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research