KCC000523A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000523A_C01 KCC000523A_c01
catTGCTCATATCACTGTTTTAGCTCATGAGCTCGCTGCGCCGTTTTTAGCAGCTAAACT
TTATACCCGCACAAAGGTCGCCAGACATGTCGCCAAGAACTCTGTCGGCGTCCTCTCAAG
CTATTCATACTACTGCACTAGCGACAAGGCCGCTGCTGCGACGCTCGCGGACTTCGGTGT
TAGTTTGTGCCCGGCGAGGGTTCTCTGGACAGCAGAGCCTTGAGCAAGCCATTGGTGCAA
TAAATCGTATCATTACCGACAGCGAGAACAGGAAACGGAAGAAAGCTGAGCAGAATGGGT
CTCGCGCAGAGCCGGAGGTGCAGCCGCTTGGCAAACCCATAACATTTAAGGCATCTGCAA
GGTCAGAGAAACTTGTGAAGGAGCCGGCCGGCTCCCCGCGCGACCTGTCCGCCTACCTGT
CCCTGCCGCTGGACCAGTACAGCCTGTCGGATCCAGGCTGGATCTCGCGGCCCGACCCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000523A_C01 KCC000523A_c01
         (479 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_793606.1| malonyl CoA-acyl carrier protein transacylase [...    41  0.008
ref|ZP_00128005.1| COG0331: (acyl-carrier-protein) S-malonyltran...    40  0.019
ref|XP_235483.2| similar to Sad1/unc-84-like protein 2 [Rattus n...    36  0.21
ref|XP_326851.1| hypothetical protein ( (AL353822) hypothetical ...    36  0.21
pir||T48807 hypothetical protein 15E6.150 [imported] - Neurospor...    36  0.21

>ref|NP_793606.1| malonyl CoA-acyl carrier protein transacylase [Pseudomonas syringae
           pv. tomato str. DC3000] gi|28854236|gb|AAO57301.1|
           malonyl CoA-acyl carrier protein transacylase
           [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 312

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 29/78 (37%), Positives = 39/78 (49%), Gaps = 1/78 (1%)
 Frame = -3

Query: 342 LWVCQAAAPPAL-RETHSAQLSSVSCSRCR**YDLLHQWLAQGSAVQRTLAGHKLTPKSA 166
           LW    + P  L  +T   Q + ++ S       L H WLA+G AV   +AGH L   SA
Sbjct: 45  LWALTQSGPAELLNQTDKTQPAILTASIA-----LWHVWLAEGGAVPAFVAGHSLGEYSA 99

Query: 165 SVAAAALSLVQ*YE*LER 112
            VAA +LSL    + +ER
Sbjct: 100 LVAAQSLSLADAVKLVER 117

>ref|ZP_00128005.1| COG0331: (acyl-carrier-protein) S-malonyltransferase [Pseudomonas
           syringae pv. syringae B728a]
          Length = 312

 Score = 39.7 bits (91), Expect = 0.019
 Identities = 29/78 (37%), Positives = 38/78 (48%), Gaps = 1/78 (1%)
 Frame = -3

Query: 342 LWVCQAAAPPAL-RETHSAQLSSVSCSRCR**YDLLHQWLAQGSAVQRTLAGHKLTPKSA 166
           LW      P  L  +T   Q + ++ S       L H WLA+G AV   +AGH L   SA
Sbjct: 45  LWALTQNGPAELLNQTDKTQPAILTASVA-----LWHVWLAEGGAVPAFVAGHSLGEYSA 99

Query: 165 SVAAAALSLVQ*YE*LER 112
            VAA +LSL    + +ER
Sbjct: 100 LVAAQSLSLADAVKLVER 117

>ref|XP_235483.2| similar to Sad1/unc-84-like protein 2 [Rattus norvegicus]
          Length = 410

 Score = 36.2 bits (82), Expect = 0.21
 Identities = 28/87 (32%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +3

Query: 204 SGQQSLEQAIGAINRIITDSENRKRKKAEQNGSRAEPEVQPLGKPITFKASARSEKLVKE 383
           S         G  + +  DS  R  K+   N  R  P  Q L  P     S  SE +V+E
Sbjct: 19  SSSSGASSVAGGQSTVFKDSPLRTLKRKSSNMKRLSPAPQ-LPPPSDSHTSYYSESVVRE 77

Query: 384 P-AGSPRDLSAYLSLPLDQYSLSDPGW 461
              GSPR +S   S  LD +  S+P W
Sbjct: 78  SYIGSPRAVSLARSALLDDHLHSEPYW 104

>ref|XP_326851.1| hypothetical protein ( (AL353822) hypothetical protein [Neurospora
           crassa] ) gi|16415993|emb|CAB88646.3| hypothetical
           protein [Neurospora crassa] gi|28922228|gb|EAA31474.1|
           hypothetical protein ( (AL353822) hypothetical protein
           [Neurospora crassa] )
          Length = 560

 Score = 36.2 bits (82), Expect = 0.21
 Identities = 39/142 (27%), Positives = 65/142 (45%), Gaps = 2/142 (1%)
 Frame = +3

Query: 51  QLNFIPAQRSPDMSPRTLSASSQAIHTTALATRPLLRRSRTSVLVCARRGFSGQQSLEQA 230
           QLN IP +    +  R++S ++ +  TT   T  +LR++  S         +G    E++
Sbjct: 222 QLNLIPQREFKFV--RSISTNALSRSTTMEFTEDMLRQADDSQATLVTNDDNGD---EES 276

Query: 231 IGAINRIITDSENRKRKKAEQNGSRAEPEVQPLGKPITFKASARSEKLVKEPAGSPRDL- 407
           I   ++I +D  N      + N S   P       PI F  S+ SE  + +P+ + RD  
Sbjct: 277 IFEGSKIHSDRRN------QANYSLRSP-------PIVFPLSSLSEN-IPQPSKALRDAY 322

Query: 408 -SAYLSLPLDQYSLSDPGWISR 470
             +YL  PL +    +PG +SR
Sbjct: 323 RDSYLQRPLPELPREEPGVVSR 344

>pir||T48807 hypothetical protein 15E6.150 [imported] - Neurospora crassa
          Length = 375

 Score = 36.2 bits (82), Expect = 0.21
 Identities = 39/142 (27%), Positives = 65/142 (45%), Gaps = 2/142 (1%)
 Frame = +3

Query: 51  QLNFIPAQRSPDMSPRTLSASSQAIHTTALATRPLLRRSRTSVLVCARRGFSGQQSLEQA 230
           QLN IP +    +  R++S ++ +  TT   T  +LR++  S         +G    E++
Sbjct: 37  QLNLIPQREFKFV--RSISTNALSRSTTMEFTEDMLRQADDSQATLVTNDDNGD---EES 91

Query: 231 IGAINRIITDSENRKRKKAEQNGSRAEPEVQPLGKPITFKASARSEKLVKEPAGSPRDL- 407
           I   ++I +D  N      + N S   P       PI F  S+ SE  + +P+ + RD  
Sbjct: 92  IFEGSKIHSDRRN------QANYSLRSP-------PIVFPLSSLSEN-IPQPSKALRDAY 137

Query: 408 -SAYLSLPLDQYSLSDPGWISR 470
             +YL  PL +    +PG +SR
Sbjct: 138 RDSYLQRPLPELPREEPGVVSR 159



EST assemble image


clone accession position
1 MXL045a10_r BP095639 1 372
2 CL37d11_r AV395235 4 479
3 LCL078d10_r AV630408 111 357




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research