KCC000522A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000522A_C01 KCC000522A_c01
CTAGAATTTCGGGCGCTTGGCGTTGTCCTTACCAAGTCACGTAATGGCGCTCTGTGCTCG
CGTTTTCGGGGCCCCGGCCAAGCTGGCGAAGCAGCAGGTGATTACCCCCCGGCGCACTTC
GGCCCCTCGCGCTGTGGCGCGCCATGCCACTGTGGACAAGATCACTGGCATTGTTGTTCA
GCCTGCCGTTCAGTTCTCGGAGGTGCAGAGCGAGCTGGCGACCGTGGATAAGACCAACCA
GAACATCCAGTCGCTGGCGCGCGTTGACTTCCACCCAGCCTGCGAGGCCGCCATCAACGA
GCAGGTCAACATCGAGTACAACGTGTCTTACCTGTACCACGCGCTGTGGGCCTACTTCGA
CCGCGACAACGTGGCGCTGCCCGGCCTGGCCGCCTTCTTCAAGGCCGGCAGCGAGGAGGA
GCGCGAGCACGCAGAGCTGCTCATGGAGTACCAGAACCGGCGCGGCGGCCGCGTGGTGCT
GGGCGCCATCTCCATGCCGGACCTGGACCTCAGCGCCAGCGAGAAGGGCGACGCGCTGTA
CGCCATGGAGCTGGCCCTGAGCCTGGAGAAGCTCAACTTCCAGAAGCTGCGCCAGCTGCA
CTCGGTGGCGGACGAGCACGGCGATGCCTCCATGGCCGACTTCGTGGAGGGCGAGCTGCT
GAACGAGCAGGTCGAGGCTGTGAAGAAGGTGTCCGAGTACGTGTCGCAGCTGCGGCGGGT
GGGCCAGGGCCTGGGCGTGTACCAGTTTGACAAGCAGCTGGCCGCCGAGGTGGCCGCCGG
TGCCGCCGCGTAAAGGGAGTGGTCGCGTAGCGAGCAGACAGCTCGGTTGGTTGAGATGGG
GGTGAAGAACATGTGAGGGCACAGCTCAGCATGTGAT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000522A_C01 KCC000522A_c01
         (877 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAM27205.1|AF503338_1 pre-apoferritin [Chlamydomonas reinhard...   483  e-135
sp|Q948P6|FRI3_SOYBN Ferritin 3, chloroplast precursor (SFerH-3)...   243  4e-63
ref|NP_191168.1| expressed protein [Arabidopsis thaliana] gi|298...   242  7e-63
emb|CAA58146.1| ferritin [Zea mays]                                   239  3e-62
sp|Q41709|FRI2_VIGUN Ferritin 2, chloroplast precursor gi|744180...   238  1e-61

>gb|AAM27205.1|AF503338_1 pre-apoferritin [Chlamydomonas reinhardtii]
          Length = 249

 Score =  483 bits (1243), Expect = e-135
 Identities = 249/249 (100%), Positives = 249/249 (100%)
 Frame = +2

Query: 44  MALCARVFGAPAKLAKQQVITPRRTSAPRAVARHATVDKITGIVVQPAVQFSEVQSELAT 223
           MALCARVFGAPAKLAKQQVITPRRTSAPRAVARHATVDKITGIVVQPAVQFSEVQSELAT
Sbjct: 1   MALCARVFGAPAKLAKQQVITPRRTSAPRAVARHATVDKITGIVVQPAVQFSEVQSELAT 60

Query: 224 VDKTNQNIQSLARVDFHPACEAAINEQVNIEYNVSYLYHALWAYFDRDNVALPGLAAFFK 403
           VDKTNQNIQSLARVDFHPACEAAINEQVNIEYNVSYLYHALWAYFDRDNVALPGLAAFFK
Sbjct: 61  VDKTNQNIQSLARVDFHPACEAAINEQVNIEYNVSYLYHALWAYFDRDNVALPGLAAFFK 120

Query: 404 AGSEEEREHAELLMEYQNRRGGRVVLGAISMPDLDLSASEKGDALYAMELALSLEKLNFQ 583
           AGSEEEREHAELLMEYQNRRGGRVVLGAISMPDLDLSASEKGDALYAMELALSLEKLNFQ
Sbjct: 121 AGSEEEREHAELLMEYQNRRGGRVVLGAISMPDLDLSASEKGDALYAMELALSLEKLNFQ 180

Query: 584 KLRQLHSVADEHGDASMADFVEGELLNEQVEAVKKVSEYVSQLRRVGQGLGVYQFDKQLA 763
           KLRQLHSVADEHGDASMADFVEGELLNEQVEAVKKVSEYVSQLRRVGQGLGVYQFDKQLA
Sbjct: 181 KLRQLHSVADEHGDASMADFVEGELLNEQVEAVKKVSEYVSQLRRVGQGLGVYQFDKQLA 240

Query: 764 AEVAAGAAA 790
           AEVAAGAAA
Sbjct: 241 AEVAAGAAA 249

>sp|Q948P6|FRI3_SOYBN Ferritin 3, chloroplast precursor (SFerH-3)
           gi|15487307|dbj|BAB64536.1| ferritin [Glycine max]
          Length = 256

 Score =  243 bits (619), Expect = 4e-63
 Identities = 128/208 (61%), Positives = 153/208 (73%)
 Frame = +2

Query: 161 ITGIVVQPAVQFSEVQSELATVDKTNQNIQSLARVDFHPACEAAINEQVNIEYNVSYLYH 340
           +TG+V +P   F EV+ EL  V    Q   SLAR  +   CEA INEQ+N+EYNVSY+YH
Sbjct: 54  LTGVVFEP---FEEVKKELDLVPTVPQ--ASLARQKYTDDCEATINEQINVEYNVSYVYH 108

Query: 341 ALWAYFDRDNVALPGLAAFFKAGSEEEREHAELLMEYQNRRGGRVVLGAISMPDLDLSAS 520
           A++AYFDRDNVAL GLA FFK  SEEEREHAE LMEYQN+RGG+V L +I MP  +    
Sbjct: 109 AMFAYFDRDNVALKGLAKFFKESSEEEREHAEKLMEYQNKRGGKVKLQSIVMPLSEFDHE 168

Query: 521 EKGDALYAMELALSLEKLNFQKLRQLHSVADEHGDASMADFVEGELLNEQVEAVKKVSEY 700
           EKGDALYAMELALSLEKL  +KL  LHSVA ++ D  +ADF+E E L EQVEA+KK+SEY
Sbjct: 169 EKGDALYAMELALSLEKLTNEKLLNLHSVASKNNDVQLADFIESEFLGEQVEAIKKISEY 228

Query: 701 VSQLRRVGQGLGVYQFDKQLAAEVAAGA 784
           V+QLRRVG+G GV+ FD+ L  E    A
Sbjct: 229 VAQLRRVGKGHGVWHFDQMLLHEEGVAA 256

>ref|NP_191168.1| expressed protein [Arabidopsis thaliana]
           gi|29839408|sp|Q9LYN2|FRI4_ARATH Probable ferritin 4,
           chloroplast precursor gi|11277086|pir||T47726
           hypothetical protein F18O21.50 - Arabidopsis thaliana
           gi|7572907|emb|CAB87408.1| putative protein [Arabidopsis
           thaliana] gi|18072928|emb|CAC85399.1| ferritin subunit 3
           [Arabidopsis thaliana] gi|18176428|gb|AAL60042.1|
           unknown protein [Arabidopsis thaliana]
           gi|21689725|gb|AAM67484.1| unknown protein [Arabidopsis
           thaliana]
          Length = 259

 Score =  242 bits (617), Expect = 7e-63
 Identities = 126/209 (60%), Positives = 154/209 (73%)
 Frame = +2

Query: 149 TVDKITGIVVQPAVQFSEVQSELATVDKTNQNIQSLARVDFHPACEAAINEQVNIEYNVS 328
           T   ++G+V +P   F EV+ E+  V    Q   SLAR  + P CEAA+NEQ+N+EYNVS
Sbjct: 56  TTSTLSGVVFEP---FEEVKKEMDLVPSGQQ--LSLARHLYSPECEAAVNEQINVEYNVS 110

Query: 329 YLYHALWAYFDRDNVALPGLAAFFKAGSEEEREHAELLMEYQNRRGGRVVLGAISMPDLD 508
           Y+YHAL+AYFDRDNVAL GLA FFK  S EEREHAELLMEYQN+RGGRV L  + +P  +
Sbjct: 111 YVYHALYAYFDRDNVALKGLAKFFKESSVEEREHAELLMEYQNKRGGRVKLQPMVLPQSE 170

Query: 509 LSASEKGDALYAMELALSLEKLNFQKLRQLHSVADEHGDASMADFVEGELLNEQVEAVKK 688
               EKGDALYAMELALSLEKL  +KL  LHSVA ++ D  +ADF+E   LNEQVEA+KK
Sbjct: 171 FDHPEKGDALYAMELALSLEKLVNEKLLNLHSVASKNDDVQLADFIESVFLNEQVEAIKK 230

Query: 689 VSEYVSQLRRVGQGLGVYQFDKQLAAEVA 775
           +SEYVSQLRR+G+G G + FD++L    A
Sbjct: 231 ISEYVSQLRRLGKGHGTWHFDQELLGAAA 259

>emb|CAA58146.1| ferritin [Zea mays]
          Length = 253

 Score =  239 bits (611), Expect = 3e-62
 Identities = 133/252 (52%), Positives = 168/252 (65%), Gaps = 4/252 (1%)
 Frame = +2

Query: 32  PSHVMALCARVFGAPAKLAKQQVITPRRTSAPRAVARHATVDK----ITGIVVQPAVQFS 199
           PS   A+  ++ GAPA  A    + PR  ++P A A      K    ++G+V QP   F 
Sbjct: 7   PSPAAAVPTQLSGAPATPAPVVRVAPRGVASPSAGAACRAAGKGKEVLSGVVFQP---FE 63

Query: 200 EVQSELATVDKTNQNIQSLARVDFHPACEAAINEQVNIEYNVSYLYHALWAYFDRDNVAL 379
           E++ ELA V ++    +SLAR  F   CEAA+NEQ+N+EYN SY YH+L+AYFDRDNVAL
Sbjct: 64  EIKGELALVPQSPD--KSLARHKFVDDCEAALNEQINVEYNASYAYHSLFAYFDRDNVAL 121

Query: 380 PGLAAFFKAGSEEEREHAELLMEYQNRRGGRVVLGAISMPDLDLSASEKGDALYAMELAL 559
            G A FFK  S+EEREHAE LMEYQN+RGGRV L +I  P  +    EKGDALYAMELAL
Sbjct: 122 KGFAKFFKESSDEEREHAEKLMEYQNKRGGRVRLQSIVTPLTEFDHPEKGDALYAMELAL 181

Query: 560 SLEKLNFQKLRQLHSVADEHGDASMADFVEGELLNEQVEAVKKVSEYVSQLRRVGQGLGV 739
           +LEKL  +KL  LH VA    D  + DF+E + L EQVEA+ K+S+YV+QLRRVG+G GV
Sbjct: 182 ALEKLVNEKLHNLHGVATRCNDPQLTDFIESDFLEEQVEAINKISKYVAQLRRVGKGHGV 241

Query: 740 YQFDKQLAAEVA 775
           + FD+ L  E A
Sbjct: 242 WHFDQMLLEEEA 253

>sp|Q41709|FRI2_VIGUN Ferritin 2, chloroplast precursor gi|7441800|pir||T08124 ferritin 2
           precursor - cowpea gi|2970654|gb|AAC06027.1| ferritin
           subunit cowpea2 precursor [Vigna unguiculata]
          Length = 250

 Score =  238 bits (606), Expect = 1e-61
 Identities = 125/203 (61%), Positives = 154/203 (75%)
 Frame = +2

Query: 161 ITGIVVQPAVQFSEVQSELATVDKTNQNIQSLARVDFHPACEAAINEQVNIEYNVSYLYH 340
           +TG++ +P   F EV+ EL  V    Q   SLAR  +    EAA+NEQ+N+EYNVSY+YH
Sbjct: 48  LTGVIFEP---FEEVKKELDLVPTVPQ--ASLARQKYVDESEAAVNEQINVEYNVSYVYH 102

Query: 341 ALWAYFDRDNVALPGLAAFFKAGSEEEREHAELLMEYQNRRGGRVVLGAISMPDLDLSAS 520
           AL+AYFDRDNVAL GLA FFK  SEEEREHAE LMEYQNRRGG+V L +I MP  +   +
Sbjct: 103 ALFAYFDRDNVALRGLAKFFKESSEEEREHAEKLMEYQNRRGGKVKLQSIVMPLSEFDHA 162

Query: 521 EKGDALYAMELALSLEKLNFQKLRQLHSVADEHGDASMADFVEGELLNEQVEAVKKVSEY 700
           +KGDAL+AMELALSLEKL  +KL  LHSVA ++GD  +ADFVE E L EQVE++K++SEY
Sbjct: 163 DKGDALHAMELALSLEKLTNEKLLHLHSVATKNGDVQLADFVESEFLGEQVESIKRISEY 222

Query: 701 VSQLRRVGQGLGVYQFDKQLAAE 769
           V+QLRRVG+G GV+ FD+ L  E
Sbjct: 223 VAQLRRVGKGHGVWHFDQMLLHE 245



EST assemble image


clone accession position
1 MX041c09_r BP087682 1 495
2 MX231c08_r BP090935 100 394
3 LC007f05_r AV619384 101 610
4 MX249f06_r BP092090 102 559
5 HC010h09_r AV632653 119 611
6 LC059c07_r AV623127 452 949
7 CL37d10_r AV395232 510 989




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research