KCC000521A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000521A_C01 KCC000521A_c01
gcctgctttgaaattcagggcgtaaagtttaggaatCCGTGCCGGCAAACCAAAACAATA
CCATCGGCAATCCAGATTCGGCCCTTCAAAACTGTGTCCGAGCGGGGCACAGGCAATGGT
CAACCCCCTCAGCGCAACACTTCCAAAATCCAACCTCACGCGGCGGGCTCAGCGCGATGG
GGTCCCATGGGTCCCATGCATTGTCCTAGCTGTAATCATTATTCCCCATCCTTTCAGATC
CTGGTTCACAGCAGCGAGCTCGTGAGATGTGGGTTTTGCGCACCACGTGCTCGTGTCAAC
GTTCCTGCTCACAGCTGTGCTATTGCACGAGCCCAGCACCCGCCCCCGCCGCTTGCATTC
CTTTTCGCATCCCATCCCAATCAAAGGTTAGGTTAAGGGCACACACGCCTACACACACAC
CAACCACCGCATGCTCGCCCAACATGTCACATTTATTCTAGAAAGCGCCGCATGAGCCGG
CACACGCCACGCACACGCAAACGCAAGCATGAACTCGCAGCTCTCGCCGC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000521A_C01 KCC000521A_c01
         (530 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_069281.3| similar to fibroin-3 [Homo sapiens]                   39  0.032
ref|NP_495966.1| prion-like Q/N-rich domain protein, Prion-like ...    37  0.12
dbj|BAC03976.1| unnamed protein product [Homo sapiens]                 37  0.12
emb|CAD66637.1| phytocyanin protein, PUP2 [Arabidopsis thaliana]       36  0.27
ref|NP_200198.1| hypothetical protein [Arabidopsis thaliana] gi|...    36  0.27

>ref|XP_069281.3| similar to fibroin-3 [Homo sapiens]
          Length = 842

 Score = 39.3 bits (90), Expect = 0.032
 Identities = 22/62 (35%), Positives = 27/62 (43%)
 Frame = +3

Query: 255 RAREMWVLRTTCSCQRSCSQLCYCTSPAPAPAACIPFRIPSQSKVRLRAHTPTHTPTTAC 434
           R R +   R+T SC   C   C C   AP P   +P R+P   +V L    P H P   C
Sbjct: 580 RHRHLSGFRSTGSCTCPCPPTCPCPPGAPDPHVPLPPRVPLPPRVPLPPRVPLH-PMCPC 638

Query: 435 SP 440
            P
Sbjct: 639 PP 640

>ref|NP_495966.1| prion-like Q/N-rich domain protein, Prion-like Q/N-rich domain
           protein PQN-95 (32.8 kD) (pqn-95) [Caenorhabditis
           elegans] gi|7510909|pir||T27686 hypothetical protein
           ZK1067.7 - Caenorhabditis elegans
           gi|3881527|emb|CAA93886.1| C. elegans PQN-95 protein
           (corresponding sequence ZK1067.7) [Caenorhabditis
           elegans]
          Length = 314

 Score = 37.4 bits (85), Expect = 0.12
 Identities = 19/50 (38%), Positives = 25/50 (50%)
 Frame = +3

Query: 291 SCQRSCSQLCYCTSPAPAPAACIPFRIPSQSKVRLRAHTPTHTPTTACSP 440
           SCQ++ SQ     +  PA  A  P R+ S S +    H PT  PT+A  P
Sbjct: 216 SCQQAASQPASHNACHPARLAAHPTRLQSSSSLNKETHAPTRAPTSASLP 265

>dbj|BAC03976.1| unnamed protein product [Homo sapiens]
          Length = 133

 Score = 37.4 bits (85), Expect = 0.12
 Identities = 30/102 (29%), Positives = 45/102 (43%), Gaps = 8/102 (7%)
 Frame = +1

Query: 100 ERGTGNGQPPQRNTSKIQPHAAGSARWGPMGPMHCPSCNHYSP-SFQILVHSSELVRCGF 276
           +RGTG+  PP +      P  AG +   P  P    S +   P S+ + +  S+L+R GF
Sbjct: 13  DRGTGSLPPPSQRPLGPSPEGAGPSPPPPGIPRGGGSSSSEGPHSYFLSLVDSQLLRRGF 72

Query: 277 -CAPRARVNVPAHSCAIARAQHP------PPPLAFLFASHPN 381
              P  + ++P  + A+A   H       PPP  F     PN
Sbjct: 73  PLTPLIQRHLPPRTSALAERTHRYRFSRLPPPTPFRTPGRPN 114

>emb|CAD66637.1| phytocyanin protein, PUP2 [Arabidopsis thaliana]
          Length = 370

 Score = 36.2 bits (82), Expect = 0.27
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +3

Query: 336 APAPAACIPFRIPSQSKVRLRAHTPTHTPTTACSPNMSHLF*KAP-HEPAHA 488
           +P+P +  P   P+ +     AHTP+H+P  A S + +H    AP H PAHA
Sbjct: 213 SPSPVSHSPSHSPAHTPSHSPAHTPSHSPAHAPSHSPAH----APSHSPAHA 260

 Score = 31.2 bits (69), Expect = 8.7
 Identities = 18/54 (33%), Positives = 25/54 (45%), Gaps = 1/54 (1%)
 Frame = +3

Query: 330 SPAPAPAACIPFRIPSQSKVRLRAHTPTHTPTTACSPNMSHLF*KAP-HEPAHA 488
           SP     +  P   PS S     +H+P H P+ + +   SH    AP H PAH+
Sbjct: 215 SPVSHSPSHSPAHTPSHSPAHTPSHSPAHAPSHSPAHAPSHSPAHAPSHSPAHS 268

>ref|NP_200198.1| hypothetical protein [Arabidopsis thaliana]
           gi|10177249|dbj|BAB10717.1| contains similarity to
           phytocyanin/early nodulin-like protein~gene_id:K19P17.3
           [Arabidopsis thaliana]
          Length = 370

 Score = 36.2 bits (82), Expect = 0.27
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +3

Query: 336 APAPAACIPFRIPSQSKVRLRAHTPTHTPTTACSPNMSHLF*KAP-HEPAHA 488
           +P+P +  P   P+ +     AHTP+H+P  A S + +H    AP H PAHA
Sbjct: 213 SPSPVSHSPSHSPAHTPSHSPAHTPSHSPAHAPSHSPAH----APSHSPAHA 260

 Score = 32.7 bits (73), Expect = 3.0
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
 Frame = +3

Query: 330 SPAPAPA---ACIPFRIPSQSKVRLRAHTPTHTPTTACSPNMSHLF*KAPHEPAHAT 491
           SPA AP+   A  P   P+ +     AH+P+H+P T  SP+ S    ++P  P+  T
Sbjct: 240 SPAHAPSHSPAHAPSHSPAHAPSHSPAHSPSHSPATPKSPSPSSSPAQSPATPSPMT 296

 Score = 31.2 bits (69), Expect = 8.7
 Identities = 18/54 (33%), Positives = 25/54 (45%), Gaps = 1/54 (1%)
 Frame = +3

Query: 330 SPAPAPAACIPFRIPSQSKVRLRAHTPTHTPTTACSPNMSHLF*KAP-HEPAHA 488
           SP     +  P   PS S     +H+P H P+ + +   SH    AP H PAH+
Sbjct: 215 SPVSHSPSHSPAHTPSHSPAHTPSHSPAHAPSHSPAHAPSHSPAHAPSHSPAHS 268



EST assemble image


clone accession position
1 CL37b11_r AV395230 1 456
2 HCL086g07_r AV644344 116 574




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research