KCC000520A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000520A_C01 KCC000520A_c01
GACACATGTTGTGTTAAAGCTGGCGCAGCAGCGCCTCCTGCAAGCATACTCCTTATCTTG
GAGCCCCGAAGCTCACTACCCTCGCAGCGCACATGCTGTCGAGTGTCGCGTCGGTTGACC
CCATAAACAACACACCAGTAAGATGCTCCGAGTGTAAAGGACCTTGCGTGCGACGGCTGC
CAGCTCCGGTTGAGCGCCATAGTTGCCACTAATGACTTCCGCAAACGCCCGCAATGTCCT
CATACACGAACAGTGCAATGGGATCGCGTATAGCACACCGTATGCGACCACCCAGATCGA
TGTAAACGGACGCACTCCGCAAGTTGGCCCCACAGATGACCAGTTTCCTGTATGGCCCAA
TGCTATCCATGCTGCCATCACTCAGTACTTGGCAAGGCGTTACGAAGGATTTCCGCAACC
AGCCACTTCCCTAGTCTCGACATGCATCACCGGTACACACACACACGCACACTACATTCC
TAAGCACTGACCCACTACTATGTCACGATGTCTGTGAAAGTCCCCntccg


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000520A_C01 KCC000520A_c01
         (530 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_135098.1| RIKEN cDNA 4930506F14 [Mus musculus] gi|1285415...    36  0.27
dbj|BAC87289.1| unnamed protein product [Homo sapiens]                 34  1.0
emb|CAD90172.1| C. elegans NTL-3 protein (corresponding sequence...    34  1.3
ref|NP_499535.1| NOT-like, component of CCR4/NOT complex, CCR4-a...    34  1.3
ref|NP_077939.1| spermidine/putrescine transport system permease...    33  3.0

>ref|XP_135098.1| RIKEN cDNA 4930506F14 [Mus musculus] gi|12854159|dbj|BAB29945.1|
           unnamed protein product [Mus musculus]
          Length = 129

 Score = 36.2 bits (82), Expect = 0.27
 Identities = 19/43 (44%), Positives = 23/43 (53%)
 Frame = -2

Query: 475 VVCVCVCTGDACRD*GSGWLRKSFVTPCQVLSDGSMDSIGPYR 347
           V    V +   C+  GSGWLR+   TPCQVL DG    +G  R
Sbjct: 59  VTASLVFSSQVCK--GSGWLRQPSDTPCQVLGDGPALPLGKER 99

>dbj|BAC87289.1| unnamed protein product [Homo sapiens]
          Length = 377

 Score = 34.3 bits (77), Expect = 1.0
 Identities = 22/87 (25%), Positives = 32/87 (36%)
 Frame = +1

Query: 235 CPHTRTVQWDRV*HTVCDHPDRCKRTHSASWPHR*PVSCMAQCYPCCHHSVLGKALRRIS 414
           CPHT ++           H   C  THS + PH    +     + C H  V        +
Sbjct: 72  CPHTLSLSHTPT-QCTSSHSHTCSHTHSLTCPHTLAPTRHTHSHACTHPHVQTHTASAYT 130

Query: 415 ATSHFPSLDMHHRYTHTRTLHS*ALTH 495
            T+H  +    H  +H    HS A +H
Sbjct: 131 FTTHSHTPGHTHSCSHLIHTHSHAHSH 157

>emb|CAD90172.1| C. elegans NTL-3 protein (corresponding sequence Y56A3A.1)
           [Caenorhabditis elegans] gi|30425633|emb|CAB60507.2| C.
           elegans NTL-3 protein (corresponding sequence Y56A3A.1)
           [Caenorhabditis elegans]
          Length = 701

 Score = 33.9 bits (76), Expect = 1.3
 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 3/69 (4%)
 Frame = +2

Query: 260 GIAYSTPYATTQIDVNGRTP---QVGPTDDQFPVWPNAIHAAITQYLARRYEGFPQPATS 430
           G + +TP  +T I  N   P   Q  P     PV+P A  AA    LA+     PQ   S
Sbjct: 356 GRSTTTPVPSTPISANSPAPSLAQAAPIAAASPVFPPAAAAASKPVLAQSVSEMPQKKES 415

Query: 431 LVSTCITGT 457
           + ST   G+
Sbjct: 416 ITSTTSRGS 424

>ref|NP_499535.1| NOT-like, component of CCR4/NOT complex, CCR4-associated Factor
           family (ntl-3) [Caenorhabditis elegans]
          Length = 513

 Score = 33.9 bits (76), Expect = 1.3
 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 3/69 (4%)
 Frame = +2

Query: 260 GIAYSTPYATTQIDVNGRTP---QVGPTDDQFPVWPNAIHAAITQYLARRYEGFPQPATS 430
           G + +TP  +T I  N   P   Q  P     PV+P A  AA    LA+     PQ   S
Sbjct: 356 GRSTTTPVPSTPISANSPAPSLAQAAPIAAASPVFPPAAAAASKPVLAQSVSEMPQKKES 415

Query: 431 LVSTCITGT 457
           + ST   G+
Sbjct: 416 ITSTTSRGS 424

>ref|NP_077939.1| spermidine/putrescine transport system permease [Ureaplasma
           urealyticum] gi|11278982|pir||F82932
           spermidine/putrescine transport system permease UU108
           [imported] - Ureaplasma urealyticum
           gi|6899064|gb|AAF30514.1|AE002111_3
           spermidine/putrescine transport system permease
           [Ureaplasma urealyticum]
          Length = 335

 Score = 32.7 bits (73), Expect = 3.0
 Identities = 10/28 (35%), Positives = 18/28 (63%)
 Frame = -3

Query: 345 NWSSVGPTCGVRPFTSIWVVAYGVLYAI 262
           NWS + PT G++ F S+W+ A   ++ +
Sbjct: 97  NWSVITPTIGMKIFNSLWIAAVATIFCL 124



EST assemble image


clone accession position
1 CL37b06_r AV395258 1 558
2 MXL020a11_r BP094246 95 415
3 LCL016e12_r AV626845 97 377
4 MXL045f08_r BP095675 106 451
5 CM026h02_r AV387562 109 660




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research