KCC000519A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000519A_C01 KCC000519A_c01
TGTGAACGCGGGCACGGACGCGGAGACCTACACCAGCCAGCTCTTCACCACACTGCTGGG
CGACTTCCAGAGCTCCATCATCACGGACGAGCGGGACGTGTGGCGCTTCCCCGACATGTC
GGTGCTGCTGCTGTCGCTGTACGCCATTCTGATGATGATCGTGTTCATGAACCTGCTCAT
TGCCACCATGAACGACACCTACGACCGCGTCAAGGAGTTCCGCGAGGTGGAGGTGATGCG
GCTGCGCGCGCACATGATGGTGTACGTCAAGGACTTCATGAAGCTGCAGCCGCCGCATGC
AGGCCCTGGACTGGTGACGTGCTGCACCTGCTGCTGCGGCCCGAGGAGGTCAAGTCGGGC
CGCTGGCTCAGCCAGGCGGCCGGAGAGCCGCAGGAGTTCGGCGCATGGTGCGGGTCTGCA
TCAGCTACATGCTGCTCCAGCATTGTGCGGGAGGTGGAGACGGTGGTGCGCGCCACGTCA
GAGCGGAATGGCTGAGGCCATCGCCGAGCTGCAAGCCAAGCTGGACAAGCTCGCTGCGGC
ACTGGACAAGCCAAAGAGCTAGCAGCGGCCGCCTGTTCGCGCTGCATACCGGAGCTAGCT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000519A_C01 KCC000519A_c01
         (600 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|ZP_00137579.1| COG1012: NAD-dependent aldehyde dehydrogenase...    42  0.009
ref|ZP_00137577.1| COG1012: NAD-dependent aldehyde dehydrogenase...    42  0.009
ref|ZP_00137575.1| COG1012: NAD-dependent aldehyde dehydrogenase...    42  0.009
dbj|BAC82537.1| trp3 [Cavia porcellus]                                 41  0.011
ref|NP_572353.1| CG4536-PA [Drosophila melanogaster] gi|7290757|...    41  0.011

>ref|ZP_00137579.1| COG1012: NAD-dependent aldehyde dehydrogenases [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 620

 Score = 41.6 bits (96), Expect = 0.009
 Identities = 34/112 (30%), Positives = 43/112 (38%), Gaps = 18/112 (16%)
 Frame = +1

Query: 34  QPALHHTAGRLPELHHHGRAGRVALPRHVGAAAVA---------VRHSDDDRV----HEP 174
           +P  HH  G +      G     A P H+G    A         +RHS  DR+    H+P
Sbjct: 22  EPRRHHPGGAVDRRRGRGSRAEPADPAHLGQRRAAPGRQHRGHDLRHSLPDRILLQLHDP 81

Query: 175 AHCHHERHLRPRQGVPRG-----GGDAAARAHDGVRQGLHEAAAAACRPWTG 315
           A   H+RH  P + V RG     GG    R   G  Q   +      RP TG
Sbjct: 82  AAGRHDRHRHPGRPVRRGPRRRSGGGGGRRRSPG--QPNRQRGRILPRPRTG 131

>ref|ZP_00137577.1| COG1012: NAD-dependent aldehyde dehydrogenases [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 648

 Score = 41.6 bits (96), Expect = 0.009
 Identities = 34/112 (30%), Positives = 43/112 (38%), Gaps = 18/112 (16%)
 Frame = +1

Query: 34  QPALHHTAGRLPELHHHGRAGRVALPRHVGAAAVA---------VRHSDDDRV----HEP 174
           +P  HH  G +      G     A P H+G    A         +RHS  DR+    H+P
Sbjct: 50  EPRRHHPGGAVDRRRGRGSRAEPADPAHLGQRRAAPGRQHRGHDLRHSLPDRILLQLHDP 109

Query: 175 AHCHHERHLRPRQGVPRG-----GGDAAARAHDGVRQGLHEAAAAACRPWTG 315
           A   H+RH  P + V RG     GG    R   G  Q   +      RP TG
Sbjct: 110 AAGRHDRHRHPGRPVRRGPRRRSGGGGGRRRSPG--QPNRQRGRILPRPRTG 159

>ref|ZP_00137575.1| COG1012: NAD-dependent aldehyde dehydrogenases [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 708

 Score = 41.6 bits (96), Expect = 0.009
 Identities = 34/112 (30%), Positives = 43/112 (38%), Gaps = 18/112 (16%)
 Frame = +1

Query: 34  QPALHHTAGRLPELHHHGRAGRVALPRHVGAAAVA---------VRHSDDDRV----HEP 174
           +P  HH  G +      G     A P H+G    A         +RHS  DR+    H+P
Sbjct: 110 EPRRHHPGGAVDRRRGRGSRAEPADPAHLGQRRAAPGRQHRGHDLRHSLPDRILLQLHDP 169

Query: 175 AHCHHERHLRPRQGVPRG-----GGDAAARAHDGVRQGLHEAAAAACRPWTG 315
           A   H+RH  P + V RG     GG    R   G  Q   +      RP TG
Sbjct: 170 AAGRHDRHRHPGRPVRRGPRRRSGGGGGRRRSPG--QPNRQRGRILPRPRTG 219

>dbj|BAC82537.1| trp3 [Cavia porcellus]
          Length = 836

 Score = 41.2 bits (95), Expect = 0.011
 Identities = 25/98 (25%), Positives = 50/98 (50%), Gaps = 1/98 (1%)
 Frame = +2

Query: 5   NAGTDAETYTSQLFTTLLGDFQSSIITDERDVWRFPDMSVLLLSLYAILMMIVFMNLLIA 184
           +A T  E     LF ++ G  + + +  + D     ++  +L  +Y + M++V +N+LIA
Sbjct: 597 SAFTTVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVVVLLNMLIA 656

Query: 185 TMNDTYDRVKEFREVEVMRLRAHM-MVYVKDFMKLQPP 295
            +N +Y  +++  +VE    R+ + + Y  D   L PP
Sbjct: 657 MINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPP 694

>ref|NP_572353.1| CG4536-PA [Drosophila melanogaster] gi|7290757|gb|AAF46203.1|
           CG4536-PA [Drosophila melanogaster]
          Length = 1123

 Score = 41.2 bits (95), Expect = 0.011
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 3/82 (3%)
 Frame = +2

Query: 26  TYTSQ---LFTTLLGDFQSSIITDERDVWRFPDMSVLLLSLYAILMMIVFMNLLIATMND 196
           TYTS    LF T LGD+    +        +P++S  +  ++ I + I+ +N+LIA M +
Sbjct: 600 TYTSTWMALFQTTLGDYNYPDLNQTT----YPNLSKTVFVIFMIFVPILLLNMLIAMMGN 655

Query: 197 TYDRVKEFREVEVMRLRAHMMV 262
           TY  V E  E E M+  A ++V
Sbjct: 656 TYVTVIEQSEKEWMKQWAKIVV 677



EST assemble image


clone accession position
1 CL37a10_r AV395229 1 589
2 MXL040h07_r BP095378 349 691




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research