KCC000518A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000518A_C01 KCC000518A_c01
taccatgcatgagcatCCGATTGTTGTTTTGCAATTCTGTCTGACTGCACAAGGAACCCG
TCCTTGGGAATCAACATCTGTCAACATGGCGGCCATGCTCTCGACGACCACCATCGGCTT
CCCTCGCATCTGGCAACCAGAGGCAGCTGAAGTTCGCCATGGAGAGCTACTTCAAAGGCG
ACAGCGGCGAGGCGGAGCTGCTGGCCGTAGCGCATAAGGTTCAATCCGACGCATGGGCGC
TTCAGAAGGCTGCTGGTATCGCGGTGATCGGTCTCGACGGCACGCTGTATGACCAGGTGC
TTGACACCATTACCTGGCTCGGGGCCATCCCGCCGCGTTTCAAGCACCTCTCGGGTCTGC
AGCGCTACTACGCTATGGCTCGGGGTGGTGCCGCTCTGGACATGAGCAAGTTCTTCGACA
CCAACTATCACTACCTGGTGCCCGAGCTGGGGCCGGACGTGCTGGGCCCGGCTACCGCCG
CCGGCGCGCCGCTACAGCCAGACTTCAGCGGGCCGCTGGACAAGCTGGCGCGCGGCCAGG
CGGTTGTGGGGCGCGAGCGCGCGGTGCCGATCCTGATTGGCCCCGTGACGTTCGTGTCGC
TGTCACGTGGCTGTGAGCTGCCGCTGGACCAGGCCGTGGCCCGGCTGCTGCCCACCTACT
GCGCCCTGCTGCAGCAGCTGGCGGCTGCGGGTGCGCCCGAGGTGCAGCTGCACGAGCCCG
TGCTGGCCACCAGTGAGGGCGCCGGCATGCGCGCCGAGTTCGAGACCGCGTATGCCCAGA
TGGCGCAGGCCGCCGGCTCTGTGCCGCTGCATCTGGTGACCTACTACGACGACCTCGGCG
CCGCCTACCCCTGGGCCGTGCAGCTGCCGGTGGCGGCCGTCACGCTGGACTTCCTGGGGC
CGCCCGGCGCCGCGGTGCCCAGCCAGACGCTGGCGCTGCTGCAGCAGCACGGCTTCCCGG
CCGACAAGCGCCTGGGCGCCGGCGTGGTGGACGGACGCAGCGTGTGGAAGGACGA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000518A_C01 KCC000518A_c01
         (1015 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|Q39586|METE_CHLRE 5-methyltetrahydropteroyltriglutamate--homo...   571  e-163
ref|ZP_00073482.1| COG0620: Methionine synthase II (cobalamin-in...   243  7e-63
ref|NP_681881.1| 5-methyltetrahydropteroyltriglutamate--homocyst...   229  7e-59
ref|NP_215649.1| metE [Mycobacterium tuberculosis H37Rv] gi|1584...   176  7e-43
ref|ZP_00011939.1| COG0620: Methionine synthase II (cobalamin-in...   167  2e-40

>sp|Q39586|METE_CHLRE 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
            (Methionine synthase, vitamin-B12 independent isozyme)
            (Cobalamin-independent methionine synthase)
            gi|2129456|pir||S65083
            5-methyltetrahydropteroyltriglutamate-homocysteine
            S-methyltransferase (EC 2.1.1.14) - Chlamydomonas
            reinhardtii gi|1017759|gb|AAC49178.1|
            cobalamin-independent methionine synthase
            gi|1587968|prf||2207381A Met synthase
          Length = 814

 Score =  571 bits (1471), Expect(2) = e-163
 Identities = 287/294 (97%), Positives = 288/294 (97%)
 Frame = +3

Query: 132  GNQRQLKFAMESYFKGDSGEAELLAVAHKVQSDAWALQKAAGIAVIGLDGTLYDQVLDTI 311
            GNQRQLKFAMESYFKGDSGEAELLAVAHKVQSDAWALQKAAGIAVIGLDGTLYDQVLDTI
Sbjct: 13   GNQRQLKFAMESYFKGDSGEAELLAVAHKVQSDAWALQKAAGIAVIGLDGTLYDQVLDTI 72

Query: 312  TWLGAIPPRFKHLSGLQRYYAMARGGAALDMSKFFDTNYHYLVPELGPDVLGPATAAGAP 491
            TWLGAIPPRFKHLSGLQRYYAMARGGAALDMSKFFDTNYHYLVPELGPDVLGPATA G P
Sbjct: 73   TWLGAIPPRFKHLSGLQRYYAMARGGAALDMSKFFDTNYHYLVPELGPDVLGPATA-GPP 131

Query: 492  LQPDFSGPLDKLARGQAVVGRERAVPILIGPVTFVSLSRGCELPLDQAVARLLPTYCALL 671
            LQPDFSGPLDKLARGQAVVGR+ AVPILIGPVTFVSLSRGCELPLDQAVARLLPTYCALL
Sbjct: 132  LQPDFSGPLDKLARGQAVVGRDGAVPILIGPVTFVSLSRGCELPLDQAVARLLPTYCALL 191

Query: 672  QQLAAAGAPEVQLHEPVLATSEGAGMRAEFETAYAQMAQAAGSVPLHLVTYYDDLGAAYP 851
            QQLAAAGAPEVQLHEPVLATSEG GM  EFETAYAQMAQAAGSVPLHLVTYYDDLGAAYP
Sbjct: 192  QQLAAAGAPEVQLHEPVLATSEGTGMPTEFETAYAQMAQAAGSVPLHLVTYYDDLGAAYP 251

Query: 852  WAVQLPVAAVTLDFLGPPGAAVPSQTLALLQQHGFPADKRLGAGVVDGRSVWKD 1013
            WAVQLPVAAVTLDFLGPPGAAVPSQTLALLQQHGFPADKRLGAGVVDGRSVWKD
Sbjct: 252  WAVQLPVAAVTLDFLGPPGAAVPSQTLALLQQHGFPADKRLGAGVVDGRSVWKD 305

 Score = 27.7 bits (60), Expect(2) = e-163
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = +2

Query: 95  MLSTTTIGFPRI 130
           MLSTTTIGFPRI
Sbjct: 1   MLSTTTIGFPRI 12

>ref|ZP_00073482.1| COG0620: Methionine synthase II (cobalamin-independent)
            [Trichodesmium erythraeum IMS101]
          Length = 744

 Score =  243 bits (619), Expect(2) = 7e-63
 Identities = 129/297 (43%), Positives = 186/297 (62%), Gaps = 4/297 (1%)
 Frame = +3

Query: 132  GNQRQLKFAMESYFKGDSGEAELLAVAHKVQSDAWALQKAAGIAVIGL-DGTLYDQVLDT 308
            G  R++K A+ES+++      ELL +  +++  +W  Q  AGI  IG+ D TLYDQ+LD 
Sbjct: 14   GKNREVKKALESFWQQKISADELLKIVREIEEASWQTQTKAGIERIGIGDATLYDQILDW 73

Query: 309  ITWLGAIPPRFKHLSGLQRYYAMARGG---AALDMSKFFDTNYHYLVPELGPDVLGPATA 479
                G IP RF+    L+ Y+AMARG     AL+M+K+FDTNYHYLVPE+ PD+   A  
Sbjct: 74   SFRFGIIPKRFQQFQNLECYFAMARGKDGILALEMTKWFDTNYHYLVPEITPDITPKA-- 131

Query: 480  AGAPLQPDFSGPLDKLARGQAVVGRERAVPILIGPVTFVSLSRGCELPLDQAVARLLPTY 659
                   DFS  L+ + R + ++G+  AVPI+I P+TF+ LSR   +  D  +A+LLP Y
Sbjct: 132  -------DFSDFLETVKRAKKIIGKS-AVPIIISPITFIRLSRLESVEFDNILAQLLPLY 183

Query: 660  CALLQQLAAAGAPEVQLHEPVLATSEGAGMRAEFETAYAQMAQAAGSVPLHLVTYYDDLG 839
              LL +L   G  E+QLHEP L   + + ++ +FE AYA++A+    + +HLVTY+DDLG
Sbjct: 184  SDLLTKLKKLGISEIQLHEPALVFGDSSNLKKQFEMAYAELAKV--GLNIHLVTYFDDLG 241

Query: 840  AAYPWAVQLPVAAVTLDFLGPPGAAVPSQTLALLQQHGFPADKRLGAGVVDGRSVWK 1010
              YPW ++LPV +++LD           Q L L++ +GFPADK LGAGVVD R++W+
Sbjct: 242  ETYPWVMKLPVTSISLDL-------TRGQNLELIKSYGFPADKTLGAGVVDARNIWR 291

 Score = 21.6 bits (44), Expect(2) = 7e-63
 Identities = 7/11 (63%), Positives = 11/11 (99%)
 Frame = +2

Query: 98  LSTTTIGFPRI 130
           +ST+T+G+PRI
Sbjct: 3   ISTSTLGYPRI 13

>ref|NP_681881.1| 5-methyltetrahydropteroyltriglutamate--homocyste ine
            S-methyltransferase [Thermosynechococcus elongatus BP-1]
            gi|30173040|sp|Q8DJY0|METE_SYNEL
            5-methyltetrahydropteroyltriglutamate--homocysteine
            methyltransferase (Methionine synthase, vitamin-B12
            independent isozyme) (Cobalamin-independent methionine
            synthase) gi|22294814|dbj|BAC08643.1|
            5-methyltetrahydropteroyltriglutamate--homocyste ine
            S-methyltransferase [Thermosynechococcus elongatus BP-1]
          Length = 758

 Score =  229 bits (583), Expect = 7e-59
 Identities = 129/298 (43%), Positives = 185/298 (61%), Gaps = 5/298 (1%)
 Frame = +3

Query: 132  GNQRQLKFAMESYFKGDSGEAELLAVAHKVQSDAWALQKAAGIAVIGL-DGTLYDQVLDT 308
            G  R+LK A+E+++        LL  A  ++   W  Q   GI  IG+ D +LYD VLD 
Sbjct: 14   GKNRELKKALEAFWSNQLDAEALLKTAQDIELQNWQKQLEVGIDRIGIGDLSLYDSVLDW 73

Query: 309  ITWLGAIPPRFKHLSGLQRYYAMARGG---AALDMSKFFDTNYHYLVPELGPDVLGPATA 479
                G IP R++  +GL++Y+AMARG     AL+M+K+FDTNYHYLVPE+          
Sbjct: 74   SIRFGIIPERYRSFTGLEQYFAMARGKDGIPALEMTKWFDTNYHYLVPEISE-------- 125

Query: 480  AGAPLQP-DFSGPLDKLARGQAVVGRERAVPILIGPVTFVSLSRGCELPLDQAVARLLPT 656
                 QP DFS  L+ + R Q ++G +RAVPI++GP+T + LSR  E  L+QAV+ L   
Sbjct: 126  ---AFQPTDFSDFLETVRRAQTLLG-DRAVPIVLGPLTLLRLSR-LETNLEQAVSYLRDR 180

Query: 657  YCALLQQLAAAGAPEVQLHEPVLATSEGAGMRAEFETAYAQMAQAAGSVPLHLVTYYDDL 836
            Y  LL++L   G  EVQ+HEP L   E    ++ +++ +  + QA  ++PLHLVTY+DDL
Sbjct: 181  YLILLRELKNLGVVEVQIHEPALVLEEADSFKSFYQSTFDTLRQA--NLPLHLVTYFDDL 238

Query: 837  GAAYPWAVQLPVAAVTLDFLGPPGAAVPSQTLALLQQHGFPADKRLGAGVVDGRSVWK 1010
            GAA+PW ++LPV  ++LDF            LALL+++GFPADK+LG G++DGR++WK
Sbjct: 239  GAAWPWVMELPVTCISLDF-------TRGHNLALLKEYGFPADKQLGVGIIDGRNIWK 289

>ref|NP_215649.1| metE [Mycobacterium tuberculosis H37Rv] gi|15840571|ref|NP_335608.1|
            5-methyltetrahydropteroyltriglutamate-homocysteine
            methyltransferase [Mycobacterium tuberculosis CDC1551]
            gi|31792327|ref|NP_854820.1| PROBABLE
            5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE--HOMOCYSTEINE
            METHYLTRANSFERASE METE (methionine synthase, vitamin-B12
            independent isozyme) [Mycobacterium bovis subsp. bovis
            AF2122/97] gi|3334257|sp|O06584|METE_MYCTU
            5-methyltetrahydropteroyltriglutamate--homocysteine
            methyltransferase (Methionine synthase, vitamin-B12
            independent isozyme) (Cobalamin-independent methionine
            synthase) gi|7433424|pir||F70539 probable
            5-methyltetrahydropteroyltriglutamate-homocysteine
            methyltransferase - Mycobacterium tuberculosis (strain
            H37RV) gi|2117227|emb|CAB09044.1| metE [Mycobacterium
            tuberculosis H37Rv] gi|13880750|gb|AAK45422.1|
            5-methyltetrahydropteroyltriglutamate-homocysteine
            methyltransferase [Mycobacterium tuberculosis CDC1551]
            gi|31617915|emb|CAD94025.1| PROBABLE
            5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE--HOMOCYSTEINE
            METHYLTRANSFERASE METE (methionine synthase, vitamin-B12
            independent isozyme) [Mycobacterium bovis subsp. bovis
            AF2122/97]
          Length = 759

 Score =  176 bits (445), Expect = 7e-43
 Identities = 121/321 (37%), Positives = 171/321 (52%), Gaps = 14/321 (4%)
 Frame = +3

Query: 90   RPCSRRPPSASLAS----GNQRQLKFAMESYFKGDSGEAELLAVAHKVQSDAWALQKAAG 257
            +P  R+P +A++      G +R+LK A E Y+ G +  +EL AVA  ++ D W+   AAG
Sbjct: 3    QPVRRQPFTATITGSPRIGPRRELKRATEGYWAGRTSRSELEAVAATLRRDTWSALAAAG 62

Query: 258  IAVIGLDG-TLYDQVLDTITWLGAIPPRFKHLS-GLQRYYAMARGG---AALDMSKFFDT 422
            +  + ++  + YDQ+LDT   LGA+PPR   +S GL RY+A ARG    A L+M+K+FDT
Sbjct: 63   LDSVPVNTFSYYDQMLDTAVLLGALPPRVSPVSDGLDRYFAAARGTDQIAPLEMTKWFDT 122

Query: 423  NYHYLVPELGPDVLGPATAAGAPLQPDFSGPLDKLARGQAVVGRERAVPILIGPVTFVSL 602
            NYHYLVPE+GP            L P       K A GQ +  R    P++IGP+TF+ L
Sbjct: 123  NYHYLVPEIGPSTT-------FTLHPGKVLAELKEALGQGIPAR----PVIIGPITFLLL 171

Query: 603  SR---GCELPLDQAVARLLPTYCALLQQLAAAGAPEVQLHEPVLATSEGAGMRAEFETAY 773
            S+   G   P+++ +  L+P Y  LL  LA  GA  VQ  EP L T       A  E  Y
Sbjct: 172  SKAVDGAGAPIER-LEELVPVYSELLSLLADGGAQWVQFDEPALVTDLSPDAPALAEAVY 230

Query: 774  AQMAQAAGSVPLHLVTYYDDLGAAYPWAVQLPVAAVTLDFLGPPGAAVPSQTLALLQQHG 953
              +   +    +++ TY+ D GAA P   + PV A+ +D +     +V           G
Sbjct: 231  TALCSVSNRPAIYVATYFGDPGAALPALARTPVEAIGVDLVAGADTSVA----------G 280

Query: 954  FP--ADKRLGAGVVDGRSVWK 1010
             P  A K L AGVVDGR+VW+
Sbjct: 281  VPELAGKTLVAGVVDGRNVWR 301

>ref|ZP_00011939.1| COG0620: Methionine synthase II (cobalamin-independent)
            [Rhodopseudomonas palustris]
          Length = 788

 Score =  167 bits (424), Expect = 2e-40
 Identities = 118/322 (36%), Positives = 168/322 (51%), Gaps = 29/322 (9%)
 Frame = +3

Query: 132  GNQRQLKFAMESYFKGDSGEAELLAVAHKVQSDAWALQKAAGIAVI-GLDGTLYDQVLDT 308
            G +R+LK A+ES++ G S EA+LL VA  +++  WA Q A G++VI   D +LYDQVLDT
Sbjct: 21   GPRRELKSALESFWAGKSTEADLLKVAAALRAANWARQSARGVSVIPSNDFSLYDQVLDT 80

Query: 309  ITWLGAIPPRFKHLSG---LQRYYAMARGGAA-----------------------LDMSK 410
               +GAIP  +    G   L  Y+AMARG  A                        +M+K
Sbjct: 81   SVMVGAIPEIYGWRGGPVSLATYFAMARGTQAEIAGHGCANGHHHGDSTPQGVPAQEMTK 140

Query: 411  FFDTNYHYLVPELGPDVLGPATAAGAPLQPDFSGPLDKLARGQAVVGRERAVPILIGPVT 590
            +FDTNYHY+VPE          +AG   Q     PL++    +A+    R  P+L+GPVT
Sbjct: 141  WFDTNYHYMVPEF---------SAGQSFQLASVKPLEEYREAKALGYDTR--PVLLGPVT 189

Query: 591  FVSLSRGCELPLD--QAVARLLPTYCALLQQLAAAGAPEVQLHEPVLATSEGAGMRAEFE 764
            ++ L +  +  LD    + +L+P Y  +L +LAAAGA  VQL EP L        R  F 
Sbjct: 190  YLKLGKSADAGLDVLSLLPKLVPVYIEILGRLAAAGAKWVQLDEPALVLDLDDRERLAFR 249

Query: 765  TAYAQMAQAAGSVPLHLVTYYDDLGAAYPWAVQLPVAAVTLDFLGPPGAAVPSQTLALLQ 944
             AY Q+A+    + + L TY+  LG     A+ LP+A + LD +       P Q  A++ 
Sbjct: 250  DAYGQIARELPHLDIMLTTYFGGLGDNLDTALALPIAGLHLDLV-----RAPKQINAVIA 304

Query: 945  QHGFPADKRLGAGVVDGRSVWK 1010
            +   P D  L  GVVDGR++W+
Sbjct: 305  KG--PKDLVLSLGVVDGRNIWR 324



EST assemble image


clone accession position
1 MXL058f01_r BP096428 1 470
2 LCL039b02_r AV628248 5 449
3 CL67c09_r AV396702 21 502
4 CL60a05_r AV396375 30 335
5 MXL039g02_r BP095309 44 448
6 MXL043b03_r BP095521 96 478
7 MXL032d09_r BP094918 107 391
8 MXL035d09_r BP095078 312 795
9 CL37a09_r AV395269 544 1019
10 MXL020a07_r BP094243 545 996




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research