KCC000517A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000517A_C01 KCC000517A_c01
ctcatacatcgtttgtgCTGAGGTGTTAGCAGACTCGACTGGCGTGTCTGGCTCGCTGAA
AAGGGATAATTCCACCAAGCGCCACAAGCCCGACCGCGCACCAAATTGTGCTCCCAAGAC
GAGCGTCGCAAGATTTGCGGCCATGGCTAGCCGCCTGGTGCATGTTGGGCCTCCTCGTGC
CGTGGCGAGCTTGGCCGCCAGCCATGTTTCGGGAAGCACAGTTGGGCTGCCTCTCTTGGG
TGCCAAAGGTGCTTGTCTGTGTGCGGCTGGGCCATCGACCAGCAGCATCGATCTGGGCAG
GGCTTACTCCCTCGTCGCTGGAACGGCGCTTGCACGGGCCGCATGCGAAGTTAGCTTCCG
CCTCCGCAACGTCGCTACATCCGCTTCCCTGAGCGGCTCCGGCAGCGACGGCGTTGCAAC
CTCCAGCAGCACCGGCCCAGGAAGCAGCAGCGCATGCTTTGGTGTGGGCGTGTCGGGACG
CC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000517A_C01 KCC000517A_c01
         (482 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAB46679.1| proteophosphoglycan [Leishmania major]                 40  0.015
ref|XP_048104.2| similar to profilaggrin - human (fragments) [Ho...    39  0.025
ref|NP_785666.1| extracellular protein, gamma-D-glutamate-meso-d...    39  0.032
ref|NP_062235.1| Ste-20 related kinase [Rattus norvegicus] gi|12...    38  0.055
gb|AAC23501.1| pancreatic serine threonine kinase [Rattus norveg...    38  0.055

>emb|CAB46679.1| proteophosphoglycan [Leishmania major]
          Length = 873

 Score = 40.0 bits (92), Expect = 0.015
 Identities = 35/146 (23%), Positives = 64/146 (42%), Gaps = 1/146 (0%)
 Frame = +2

Query: 20   EVLADSTGVSGSLKRDNSTKRHKPDRAPNCAPKTSVARFAAMASRLVHVGPPRAVASLAA 199
            E  + S+  S S    +S+    P  + + AP +S +  +A +S         A ++ ++
Sbjct: 616  ETESSSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSS 675

Query: 200  SHVSGSTVGLPLLGAKGA-CLCAAGPSTSSIDLGRAYSLVAGTALARAACEVSFRLRNVA 376
            S  S S+   P   +  A    ++ PS SS     + S     + + A    S    + +
Sbjct: 676  SAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSAS 735

Query: 377  TSASLSGSGSDGVATSSSTGPGSSSA 454
            +S++ S S S   + SSS+ P SSS+
Sbjct: 736  SSSAPSSSSSSAPSASSSSAPSSSSS 761

 Score = 37.4 bits (85), Expect = 0.094
 Identities = 40/144 (27%), Positives = 62/144 (42%), Gaps = 2/144 (1%)
 Frame = +2

Query: 29   ADSTGVSGSLKRDNSTKRHKPDRAPNCAPKTSVARFAAMASRLVHVGP--PRAVASLAAS 202
            + S   + S    +S+    P  + + AP +S +  +A +S         P A +S A S
Sbjct: 728  SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS 787

Query: 203  HVSGSTVGLPLLGAKGACLCAAGPSTSSIDLGRAYSLVAGTALARAACEVSFRLRNVATS 382
              S S        A  +   +A PS SS     + S  A +A + +A   S      A+S
Sbjct: 788  SSSSSAPSASSSSAPSSSSSSA-PSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASS 846

Query: 383  ASLSGSGSDGVATSSSTGPGSSSA 454
            +S S S S   + SSS+ P SSS+
Sbjct: 847  SSASSSSSSAPSASSSSAPSSSSS 870

 Score = 33.5 bits (75), Expect = 1.4
 Identities = 35/142 (24%), Positives = 62/142 (43%)
 Frame = +2

Query: 29   ADSTGVSGSLKRDNSTKRHKPDRAPNCAPKTSVARFAAMASRLVHVGPPRAVASLAASHV 208
            + S+  S S     S+    P  + + AP +S +  +A +S         A ++ ++S  
Sbjct: 681  SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAP 740

Query: 209  SGSTVGLPLLGAKGACLCAAGPSTSSIDLGRAYSLVAGTALARAACEVSFRLRNVATSAS 388
            S S+   P   +  A      PS+SS          A +A + +A   S    + ++S++
Sbjct: 741  SSSSSSAPSASSSSA------PSSSSS---------APSASSSSAPSSSSSAPSASSSSA 785

Query: 389  LSGSGSDGVATSSSTGPGSSSA 454
             S S S   + SSS+ P SSS+
Sbjct: 786  PSSSSSSAPSASSSSAPSSSSS 807

>ref|XP_048104.2| similar to profilaggrin - human (fragments) [Homo sapiens]
          Length = 5689

 Score = 39.3 bits (90), Expect = 0.025
 Identities = 36/137 (26%), Positives = 51/137 (36%), Gaps = 15/137 (10%)
 Frame = -2

Query: 472  HAHTKACAAASWAGAAGGCNAVAAGAAQGSGCSDVAEAEANFACGPCKRRSSDEGVSPAQ 293
            H+HT     +  +    G  + +          D +    +    P  R  S       Q
Sbjct: 3147 HSHTTPQGRSDASHGQSGPRSASRQTRNEEQSGDGSRHSGSRHHEPSTRAGSSRHSQVGQ 3206

Query: 292  IDAAGRWPSRTQTSTFGTQ----------ERQPNCASRNMAGG---QARHGTRRPNMHQ- 155
             ++AG   SR Q S+              ER+   ASRN  G    Q+RHG+R P  HQ 
Sbjct: 3207 GESAGSKTSRRQGSSVSQDRDSEGHSEDSERRSESASRNHYGSAREQSRHGSRNPRSHQE 3266

Query: 154  -AASHGRKSCDARLGST 107
              ASHG  +  +R   T
Sbjct: 3267 DRASHGHSAESSRQSGT 3283

 Score = 35.4 bits (80), Expect = 0.36
 Identities = 38/129 (29%), Positives = 51/129 (39%), Gaps = 5/129 (3%)
 Frame = -2

Query: 478  SRHAHTKACAAASWAGAAGGCNAVAAGAAQGSGCSDVAEAEANFACGPCKRRSSDEGVSP 299
            SRH+ ++   AASWA ++        G  Q SG                 R S  +G S 
Sbjct: 2858 SRHSGSRHHEAASWADSSRHSQV---GQEQSSG----------------SRTSRHQGSSV 2898

Query: 298  AQIDAAGRWPSRTQTSTFGTQERQPNCASRNMAGG---QARHGTRRPNMHQ--AASHGRK 134
            +Q   + R    +        ER    ASRN  G    Q+R G+R P  HQ   ASHG  
Sbjct: 2899 SQDSDSERHSDDS--------ERLSGSASRNHHGSSREQSRDGSRHPGFHQEDRASHGHS 2950

Query: 133  SCDARLGST 107
            +  +R   T
Sbjct: 2951 ADSSRQSGT 2959

 Score = 31.6 bits (70), Expect = 5.2
 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 5/48 (10%)
 Frame = -2

Query: 235  ERQPNCASRNMAGG---QARHGTRRPNMH--QAASHGRKSCDARLGST 107
            ER    ASRN  G    Q+RHG+R P  H    A HG  +  +R   T
Sbjct: 2588 ERWSGSASRNHRGSAQEQSRHGSRHPRSHHEDRAGHGHSADSSRQSGT 2635

 Score = 30.8 bits (68), Expect = 8.8
 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 5/48 (10%)
 Frame = -2

Query: 235  ERQPNCASRNMAGG---QARHGTRRPNMH--QAASHGRKSCDARLGST 107
            ER    ASRN  G    Q+RHG+R P  H    A HG  +  +R   T
Sbjct: 4857 ERWSGSASRNHRGSVQEQSRHGSRHPRSHHEDRAGHGHSADRSRQSGT 4904

>ref|NP_785666.1| extracellular protein, gamma-D-glutamate-meso-diaminopimelate
           muropeptidase (putative) [Lactobacillus plantarum WCFS1]
           gi|28271611|emb|CAD64517.1| extracellular protein,
           gamma-D-glutamate-meso-diaminopimelate muropeptidase
           (putative) [Lactobacillus plantarum WCFS1]
          Length = 496

 Score = 38.9 bits (89), Expect = 0.032
 Identities = 37/139 (26%), Positives = 62/139 (43%), Gaps = 3/139 (2%)
 Frame = +2

Query: 47  SGSLKRDNSTKRHKPDRA--PNCAPKTSVARFAAMASRLVHVGPPRAVASLAASHVSGST 220
           +GS+    +T  + P +A   + A   S A  +   S+   V    +V S A+S  + ST
Sbjct: 228 TGSVASSTATTSNAPVKAVATSAAVSASNASSSTATSQSKSVAASASVTSSASSSAASST 287

Query: 221 VGLPLLGAKGACLCAAGPSTSSIDLGRAYSLVAGTALARAAC-EVSFRLRNVATSASLSG 397
                  ++     A+  STSS       S  + TA + A+    + +  + ATS+S + 
Sbjct: 288 TT-----SQSTASTASATSTSSTTATSTASQASSTAASAASTTSTASQSSSAATSSSTTS 342

Query: 398 SGSDGVATSSSTGPGSSSA 454
             S   ATSS++   SS+A
Sbjct: 343 QSSSSAATSSASNTASSTA 361

 Score = 32.7 bits (73), Expect = 2.3
 Identities = 34/145 (23%), Positives = 60/145 (40%), Gaps = 1/145 (0%)
 Frame = +2

Query: 23  VLADSTGVSGSLKRDNSTKRHKPDRAPNCAPKTSVARFAAMASRLVHVGPPRAVASLAAS 202
           V+  +  V G+  +  +    K   +   A  T+     A A+  V      + ++ + S
Sbjct: 136 VVGQNIQVPGATTKTTAKTSQKTTMSATSAASTTST--TAKATTAVSASSTSSTSASSVS 193

Query: 203 HVSGSTVGLPLLGAKGACLCAAGPSTSSIDLGRAYSLVAGTALARAACEVSFRLRNVATS 382
            VS S V      ++ A    +  STS+  +  +   VA +    +   V    + VATS
Sbjct: 194 SVSASVVSSTSAASQDAVSANSASSTSTSTISSSTGSVASSTATTSNAPV----KAVATS 249

Query: 383 ASLSGS-GSDGVATSSSTGPGSSSA 454
           A++S S  S   ATS S    +S++
Sbjct: 250 AAVSASNASSSTATSQSKSVAASAS 274

>ref|NP_062235.1| Ste-20 related kinase [Rattus norvegicus]
           gi|12643480|sp|O88506|SPAK_RAT STE20/SPS1-related
           proline-alanine rich protein kinase (Ste-20 related
           kinase) (Serine/threonine-protein kinase 39) (Pancreatic
           serine/threonine kinase) (PS/TK) (PSTK1)
           gi|3126637|dbj|BAA26000.1| protein kinase PASK [Rattus
           norvegicus] gi|3851173|gb|AAC72239.1| Ste-20 related
           kinase SPAK [Rattus norvegicus]
          Length = 553

 Score = 38.1 bits (87), Expect = 0.055
 Identities = 25/47 (53%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 345 AKLASASATSLHPLP*AAPAATALQPPAAPAQEAAAHALVW-ACRDA 482
           A  A+ SA +  P P AAPAA A  P AAPA   AA A+ W  CRDA
Sbjct: 26  APAAATSAPAPAPAP-AAPAAPAPAPAAAPAPAPAAQAVGWPICRDA 71

>gb|AAC23501.1| pancreatic serine threonine kinase [Rattus norvegicus]
          Length = 553

 Score = 38.1 bits (87), Expect = 0.055
 Identities = 25/47 (53%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +3

Query: 345 AKLASASATSLHPLP*AAPAATALQPPAAPAQEAAAHALVW-ACRDA 482
           A  A+ SA +  P P AAPAA A  P AAPA   AA A+ W  CRDA
Sbjct: 26  APAAATSAPAPAPAP-AAPAAPAPAPAAAPAPAPAAQAVGWPICRDA 71



EST assemble image


clone accession position
1 MXL019d03_r BP094191 1 481
2 CL36h08_r AV395154 18 482




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research