KCC000516A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000516A_C01 KCC000516A_c01
TGTGCATTCTAGGACCCCACTGCTACTCACAACAAGCCAAAATGGCCGTCATGATGCGCA
CCCAGGCGCCCGCTGCCACTCGCGCTTCATCGCGCGTCGCTGTTGCCGCTCGCCCGGCTG
CTCGCCGCGCCGTGGTGGTCCGCGCCGAGGCTGAGGCTGCCCCTGCTGCTGCCAAGAAGG
CTGCTGAGAAGCCCGCCTGGACTGTGCCGACCCTGAACCCCGACACTCCCAGCCCGATTT
TCGGTGGCAGCACCGGCGGTCTGCTGCGCAAGGCTCAGACTGAGGAGTTCTACGTCATCA
CCTGGGAGGCTAAGAAGGAGCAGATCTTCGAGATGCCCACTGGCGGTGCCGCTATCATGC
GCCAGGGCCCCAACCTGCTGAAGTTCGGCAAGAAGGAGCAGTGCCTCGCCCTGACGACCC
AGCTCCGCAACAAGTTCAAGCTGACCCCCTGCTTCTACCGCGTCTTCCCCGACGGCAAGG
TGCAGTACCTGCACCCTGCTGACGGCGTCTACCCCGAGAAGGTGAACGCTGGCCGCGTGG
GCGCGAACCAGAACATGCGCCGCATCGGCCAGAACGTCAACCCCATCAAGGTCAAGTTCT
CTGGCCGCATGATGTCGCCTGCTGAGATCTAAGCGTTCTGGCAGCAGCTGGACCGCCTGT
ACCATGGAGAAGAGCTTTACTTGCCGGGATGGCCGATTTCGCTGATTGATACGGGATCGG
AGCTCGGAGGCTTTCGCGCTAGGGGCTAGGCGAAGGGCAGTGGTGACCAGGGTCGGTGTG
GGGTCGGCCCACGGTCAATTAGCCACAGGAGGATCAGGGGGAGGTAGGCACGTCGACTTG
GTTTGCGACCCCGCAGTTTTGGCGGACGTGCTGTTGTAGATGTTAGCGTGTGCGTGAGCC
AGTGGCCAACGTGCCACACCCATTGAGAAGACCAACCAACTTACTGGCAATATCTGCCAA
TGCCATACTGCAtgtaatggccaggccatgaaaaaaaaaaaaaaaaaaaactcgag


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000516A_C01 KCC000516A_c01
         (1016 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|Q39615|PSAD_CHLRE Photosystem I reaction center subunit II, c...   392  e-108
gb|AAO72568.1| chloroplast photosystem I reaction center subunit...   236  4e-61
sp|P12353|PSAD_SPIOL Photosystem I reaction center subunit II, c...   231  1e-59
emb|CAA68728.1| unnamed protein product [Spinacia oleracea]           231  2e-59
sp|P12372|PSAD_LYCES Photosystem I reaction center subunit II, c...   228  1e-58

>sp|Q39615|PSAD_CHLRE Photosystem I reaction center subunit II, chloroplast precursor
           (Photosystem I 20 kDa subunit) (PSI-D)
           gi|629468|pir||S47088 psaD protein - Chlamydomonas
           reinhardtii gi|498824|emb|CAA56122.1| psaD
           [Chlamydomonas reinhardtii] gi|1644293|emb|CAA52440.1|
           PSI reaction center, subunit II [Chlamydomonas
           reinhardtii] gi|18478582|gb|AAL73208.1|AF335592_1
           photosystem I subunit [Chlamydomonas reinhardtii]
          Length = 196

 Score =  392 bits (1008), Expect = e-108
 Identities = 196/196 (100%), Positives = 196/196 (100%)
 Frame = +3

Query: 42  MAVMMRTQAPAATRASSRVAVAARPAARRAVVVRAEAEAAPAAAKKAAEKPAWTVPTLNP 221
           MAVMMRTQAPAATRASSRVAVAARPAARRAVVVRAEAEAAPAAAKKAAEKPAWTVPTLNP
Sbjct: 1   MAVMMRTQAPAATRASSRVAVAARPAARRAVVVRAEAEAAPAAAKKAAEKPAWTVPTLNP 60

Query: 222 DTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQ 401
           DTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQ
Sbjct: 61  DTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQ 120

Query: 402 CLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVN 581
           CLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVN
Sbjct: 121 CLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVN 180

Query: 582 PIKVKFSGRMMSPAEI 629
           PIKVKFSGRMMSPAEI
Sbjct: 181 PIKVKFSGRMMSPAEI 196

>gb|AAO72568.1| chloroplast photosystem I reaction center subunit II precursor-like
           protein [Oryza sativa (japonica cultivar-group)]
          Length = 203

 Score =  236 bits (603), Expect = 4e-61
 Identities = 122/196 (62%), Positives = 145/196 (73%), Gaps = 11/196 (5%)
 Frame = +3

Query: 54  MRTQAPAA--------TRASSRVAVAARPAARRAVVVRAEAEAAPAAAKKAAEKPA---W 200
           M TQA AA          A  R +  + P +R    +RA AE  PAAA    +KPA   +
Sbjct: 3   MATQASAAKCHLLAAWAPAKPRSSTLSMPTSRAPTSLRAAAEDQPAAAATEEKKPAPAGF 62

Query: 201 TVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLL 380
             P L+P+TPSPIFGGSTGGLLRKAQ EEFYVITW + KEQ+FEMPTGGAAIMR+GPNLL
Sbjct: 63  VPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPNLL 122

Query: 381 KFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMR 560
           K  +KEQCLAL T+LR+K+K+   FYRVFP+G+VQYLHP DGVYPEKVNAGR G  QN R
Sbjct: 123 KLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFR 182

Query: 561 RIGQNVNPIKVKFSGR 608
            IG+NV+PI+VKF+G+
Sbjct: 183 SIGKNVSPIEVKFTGK 198

>sp|P12353|PSAD_SPIOL Photosystem I reaction center subunit II, chloroplast precursor
           (Photosystem I 20 kDa subunit) (PSI-D)
          Length = 212

 Score =  231 bits (589), Expect = 1e-59
 Identities = 117/185 (63%), Positives = 142/185 (76%), Gaps = 2/185 (1%)
 Frame = +3

Query: 60  TQAPAATRASSRVAVAARPAARR-AVVVRAEAEAAPAAAKKAAEKP-AWTVPTLNPDTPS 233
           T+   + +  S V  A++PA+R  ++   A AE   AAA +  E P  +T P L+P+TPS
Sbjct: 23  TRLTTSFKQPSAVTFASKPASRHHSIRAAAAAEGKAAAATETKEAPKGFTPPELDPNTPS 82

Query: 234 PIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLAL 413
           PIF GSTGGLLRKAQ EEFYVITWE+ KEQIFEMPTGGAAIMR+GPNLLK  +KEQCLAL
Sbjct: 83  PIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLAL 142

Query: 414 TTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKV 593
            T+LR+K+K+   FYRVFP G+VQYLHP DGVYPEKVN GR G   NMR IG+NV+PI+V
Sbjct: 143 GTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNMRSIGKNVSPIEV 202

Query: 594 KFSGR 608
           KF+G+
Sbjct: 203 KFTGK 207

>emb|CAA68728.1| unnamed protein product [Spinacia oleracea]
          Length = 212

 Score =  231 bits (588), Expect = 2e-59
 Identities = 117/185 (63%), Positives = 142/185 (76%), Gaps = 2/185 (1%)
 Frame = +3

Query: 60  TQAPAATRASSRVAVAARPAARR-AVVVRAEAEAAPAAAKKAAEKP-AWTVPTLNPDTPS 233
           T+   + +  S V  A++PA+R  ++   A AE   AAA +  E P  +T P L+P+TPS
Sbjct: 23  TRLTTSFKQPSAVTFASKPASRHHSIRAAAAAEGKRAAATETKEAPKGFTPPELDPNTPS 82

Query: 234 PIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLAL 413
           PIF GSTGGLLRKAQ EEFYVITWE+ KEQIFEMPTGGAAIMR+GPNLLK  +KEQCLAL
Sbjct: 83  PIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLAL 142

Query: 414 TTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKV 593
            T+LR+K+K+   FYRVFP G+VQYLHP DGVYPEKVN GR G   NMR IG+NV+PI+V
Sbjct: 143 GTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNMRSIGKNVSPIEV 202

Query: 594 KFSGR 608
           KF+G+
Sbjct: 203 KFTGK 207

>sp|P12372|PSAD_LYCES Photosystem I reaction center subunit II, chloroplast precursor
           (Photosystem I 20 kDa subunit) (PSI-D)
           gi|82100|pir||S00449 photosystem I chain II precursor -
           tomato gi|170492|gb|AAA34185.1| photosystem I subunit II
           protein precursor gi|226544|prf||1601516A photosystem I
           reaction center II
          Length = 208

 Score =  228 bits (582), Expect = 1e-58
 Identities = 110/159 (69%), Positives = 130/159 (81%)
 Frame = +3

Query: 138 VRAEAEAAPAAAKKAAEKPAWTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKK 317
           +RA AE APAA ++      +T P L+P+TPSPIFGGSTGGLLRKAQ EEFYVITWE+ K
Sbjct: 47  IRAMAEEAPAATEEKPAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPK 106

Query: 318 EQIFEMPTGGAAIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHP 497
           EQIFEMPTGGAAIMRQGPNLLK  +KEQCLAL T+LR+K+K+   FYRVFP+G+VQYLHP
Sbjct: 107 EQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHP 166

Query: 498 ADGVYPEKVNAGRVGANQNMRRIGQNVNPIKVKFSGRMM 614
            DGVYPEKVN GR G  QN R IG+N + I+VKF+G+ +
Sbjct: 167 KDGVYPEKVNPGREGVGQNFRSIGKNKSAIEVKFTGKQV 205



EST assemble image


clone accession position
1 MX227g03_r BP090702 1 537
2 CM085c12_r AV392407 5 528
3 HC097c05_r AV639276 8 522
4 HC046c06_r AV635431 8 570
5 HC092g08_r AV638934 88 462
6 CM053e03_r AV389956 91 633
7 LCL015e09_r AV626795 91 627
8 CM035h06_r AV388754 91 605
9 CM092a09_r AV392661 91 515
10 CM048b08_r AV389140 91 427
11 LC092c02_r AV625417 91 549
12 CM060b09_r AV390741 91 574
13 CM068f09_r AV391069 91 585
14 CM026c09_r AV387554 91 686
15 LC023c12_r AV620530 92 574
16 LC033e04_r AV621258 92 606
17 LC040e11_r AV621759 92 615
18 LCL072c03_r AV630058 92 398
19 CM039h07_r AV388927 93 646
20 CM060b12_r AV390784 93 691
21 LC019h09_r AV620274 96 516
22 MXL081c04_r BP097782 98 542
23 HC034h05_r AV634554 98 583
24 MXL092a09_r BP098353 98 526
25 HC086g02_r AV638464 98 505
26 MXL098a10_r BP098726 98 463
27 CM016c01_r AV387478 98 581
28 HC082e06_r AV638145 99 526
29 CL61g08_r AV396347 99 601
30 LC033b10_r AV621235 99 606
31 CM098c12_r AV392922 99 511
32 LC063d11_r AV623413 99 601
33 LC082d02_r AV624764 100 609
34 CM060g02_r AV390799 100 524
35 CM077a04_r AV391753 101 665
36 CM053e11_r AV389889 101 448
37 CM033g03_r AV388386 103 586
38 CL44c07_r AV395578 103 474
39 CM061c11_r AV390577 103 614
40 MX060e01_r BP088434 104 457
41 CM060e04_r AV390760 105 658
42 CM021a07_r AV387979 106 706
43 MXL020d10_r BP094275 108 548
44 CM032f12_r AV388472 111 601
45 MX222a11_r BP090319 118 328
46 CM060a10_r AV390749 121 614
47 HC056e04_r AV636206 122 573
48 MX018e07_r BP086854 123 497
49 MX064b05_r BP088579 432 767
50 MX064e03_r BP088593 432 771
51 CL77f06_r AV397270 522 1069
52 CL36h03_r AV395110 563 1015
53 CM068h09_r AV391070 592 1113
54 CM033d11_r AV388439 697 1093
55 MXL065h11_r BP096854 731 1087




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research