KCC000515A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000515A_C01 KCC000515A_c01
ctggaacgccaccagtggcatgaagtattggggccaggtatccaccatgatcaatctgga
tgaactgctcaaggggccggACAGCAGGCTGCACATGCTGGAGCACCGCGGGTACCTGTA
CAAGCTGCGGCAGCTGCGCACCTCCGTTTCTAACTCGGCTCGCACGCTGGGAAACACTAC
GCGGCTGCCGGAAACGCCCGAGGTGCTGCCCATCAACGTTTACAACTTGCAGTGGCTGCT
GGAGCTGGCACCCGTGGACGGCTGGGTGCCAGCGTGGCATGACCCTTGCATTGCTGCGGT
GGTGGTGGGATCCTTCCTCGTGTCGCTGTTGGTGCTGTGTGCTGCTGGTGACGCGCGCGC
AGCACGACCGGCTGCTGCGGGCCATGCTCCCAGACAAGGTCATCCAGCAGCTGCAGGACG
GTGAGTCGGACATCGTGCAGCAGTTCAGCACAGTCACCATTCTGTTCAGTGACATTGTCG
GGTACACCAGCATTTCGTCCGAGCTGACGCCGCTGCAGGTGGTCAGTTTGCTCAACGACC
TCTTCTCCAGCTTTGACGAACTGACTGCAGAAGAACAACGTGTACAAGGTTGGACGACAT
CGGCGATGCACTCATGTGTGTC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000515A_C01 KCC000515A_c01
         (622 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAA35198.1| membrane guanylyl cyclase OlGC1 [Oryzias latipes]      74  2e-12
dbj|BAA20563.1| membrane guanylyl cyclase OLGC1 [Oryzias latipes]      74  2e-12
sp|P55202|ANPB_ANGJA Atrial natriuretic peptide receptor B precu...    74  2e-12
gb|AAC78297.1| C-type natriuretic peptide receptor precursor [Sq...    73  4e-12
dbj|BAA83786.1| guanylyl cyclase-1 [Xenopus laevis]                    72  5e-12

>dbj|BAA35198.1| membrane guanylyl cyclase OlGC1 [Oryzias latipes]
          Length = 1055

 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 37/73 (50%), Positives = 53/73 (71%)
 Frame = +3

Query: 345  LVTRAQHDRLLRAMLPDKVIQQLQDGESDIVQQFSTVTILFSDIVGYTSISSELTPLQVV 524
            L  + + + LL  +LP  V +QL+ GE+   + F +VTI FSDIVG+TS+S+E TPLQVV
Sbjct: 833  LEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVV 892

Query: 525  SLLNDLFSSFDEL 563
            +LLNDL++ FD +
Sbjct: 893  TLLNDLYTCFDAI 905

>dbj|BAA20563.1| membrane guanylyl cyclase OLGC1 [Oryzias latipes]
          Length = 1055

 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 37/73 (50%), Positives = 53/73 (71%)
 Frame = +3

Query: 345  LVTRAQHDRLLRAMLPDKVIQQLQDGESDIVQQFSTVTILFSDIVGYTSISSELTPLQVV 524
            L  + + + LL  +LP  V +QL+ GE+   + F +VTI FSDIVG+TS+S+E TPLQVV
Sbjct: 833  LEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVV 892

Query: 525  SLLNDLFSSFDEL 563
            +LLNDL++ FD +
Sbjct: 893  TLLNDLYTCFDAI 905

>sp|P55202|ANPB_ANGJA Atrial natriuretic peptide receptor B precursor (ANP-B) (ANPRB)
            (GC-B) (Guanylate cyclase) (NPR-B) (Atrial natriuretic
            peptide B-type receptor) gi|630921|pir||S45636
            natriuretic-peptide receptor B - Japanese eel
            gi|1183001|dbj|BAA05007.1| natriuretic peptide receptor B
            [Anguilla japonica]
          Length = 1050

 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 37/73 (50%), Positives = 53/73 (71%)
 Frame = +3

Query: 345  LVTRAQHDRLLRAMLPDKVIQQLQDGESDIVQQFSTVTILFSDIVGYTSISSELTPLQVV 524
            L  + + + LL  +LP  V +QL+ GE+   + F +VTI FSDIVG+TS+S+E TPLQVV
Sbjct: 828  LEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVV 887

Query: 525  SLLNDLFSSFDEL 563
            +LLNDL++ FD +
Sbjct: 888  TLLNDLYTCFDAI 900

>gb|AAC78297.1| C-type natriuretic peptide receptor precursor [Squalus acanthias]
          Length = 1056

 Score = 72.8 bits (177), Expect = 4e-12
 Identities = 37/73 (50%), Positives = 53/73 (71%)
 Frame = +3

Query: 345  LVTRAQHDRLLRAMLPDKVIQQLQDGESDIVQQFSTVTILFSDIVGYTSISSELTPLQVV 524
            L  + + + LL  +LP  V +QL+ GE+   + F +VTI FSDIVG+TS+S+E TPLQVV
Sbjct: 834  LEEKRKAENLLYQILPHSVAEQLKWGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVV 893

Query: 525  SLLNDLFSSFDEL 563
            +LLNDL++ FD +
Sbjct: 894  TLLNDLYTCFDAI 906

>dbj|BAA83786.1| guanylyl cyclase-1 [Xenopus laevis]
          Length = 1047

 Score = 72.4 bits (176), Expect = 5e-12
 Identities = 35/73 (47%), Positives = 53/73 (71%)
 Frame = +3

Query: 345  LVTRAQHDRLLRAMLPDKVIQQLQDGESDIVQQFSTVTILFSDIVGYTSISSELTPLQVV 524
            L  + + + LL  +LP  V +QL+ GE+   + F +VTI FSDIVG+T++S+E TP+QVV
Sbjct: 825  LEEKRKAEALLYQILPHSVAEQLKSGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVV 884

Query: 525  SLLNDLFSSFDEL 563
            +LLNDL++ FD +
Sbjct: 885  TLLNDLYTCFDAI 897



EST assemble image


clone accession position
1 CL36f04_r AV395137 1 464
2 HCL059d05_r AV642858 192 622




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research