KCC000512A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000512A_C01 KCC000512A_c01
ctagtctcgagttttttttttttttttttcagcagggccAGGTTACAGTGCCCAGCAAAC
ATGTGACAAGCCCAGCAGAAGTCACAACCAGCGTAACGTAAATTGAATTGCCAACCGAGT
TACCGTATCGGCAGTGTACGTTTATGAGCCGAACTGTCTTGTATCTGTATCCACCACAAC
AGCCGTCGCGAGATGTGTTTTATGTACGGCGAAACTCTCAGCGCCCAGCTTAGCGCTTAG
TCCCTCATGTTCGGATGGGCAGCTCGCCGCCTCCGCCTTCGCTCTGCAACAGGGCCACAT
GGCCACACGCCTCCCCATTATTCTTAAACCGTGCGCTGCCATGTGCCTCTCGCGCGCGTC
AACTACTGCAAAGCGCTCCCAGTGTCCTACACTTCAGCCTGCTGTTGTTGCCACTTATAA
GTCTTCAAAAAGTGTGCTGCTTTATCCATTGCAGTATGCTATACACACATGCGCAAACAT
CGCTAGACGCACACACTTGCCATGCGCAGGGCTGTTGAGATACATCCAGACGCaaccgag
ccggcccatcccccaccgcactcctct


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000512A_C01 KCC000512A_c01
         (567 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_505801.1| protein of unknown function C6 and thrombospond...    37  0.19
gb|AAO63565.1| RNA editing complex protein MP100; putative exonu...    35  0.55
ref|XP_203424.1| RIKEN cDNA 1700024J04 [Mus musculus]                  34  1.2
dbj|BAB24517.1| unnamed protein product [Mus musculus]                 34  1.2
dbj|BAC05951.1| seven transmembrane helix receptor [Homo sapiens]      34  1.6

>ref|NP_505801.1| protein of unknown function C6 and thrombospondin, type I (5L452)
            [Caenorhabditis elegans] gi|7504031|pir||T21064
            hypothetical protein F53B7.5 - Caenorhabditis elegans
            gi|3876064|emb|CAA96634.1| Hypothetical protein F53B7.5
            [Caenorhabditis elegans] gi|3877441|emb|CAA96654.1|
            Hypothetical protein F53B7.5 [Caenorhabditis elegans]
          Length = 2761

 Score = 37.0 bits (84), Expect = 0.19
 Identities = 26/75 (34%), Positives = 34/75 (44%), Gaps = 5/75 (6%)
 Frame = +2

Query: 155  CLVSVSTTTAV-----ARCVLCTAKLSAPSLALSPSCSDGQLAASAFALQQGHMATRLPI 319
            C+V++STTT V     A C LCT   + P++ L P+  D       F L     AT   +
Sbjct: 2173 CVVAISTTTLVPATVAAGCKLCT---NLPAIGLEPNQLDANGRNGQFILDHVTTATACRV 2229

Query: 320  ILKPCAAMCLSRAST 364
            I   CA    S  ST
Sbjct: 2230 IYLSCAGSSASENST 2244

>gb|AAO63565.1| RNA editing complex protein MP100; putative exonuclease
           [Trypanosoma brucei]
          Length = 902

 Score = 35.4 bits (80), Expect = 0.55
 Identities = 26/79 (32%), Positives = 40/79 (49%), Gaps = 2/79 (2%)
 Frame = +2

Query: 197 VLCTAKLSAPSLALSPSCSDGQLAASAFALQQ--GHMATRLPIILKPCAAMCLSRASTTA 370
           +LCT +  AP     P+   GQL ++A +  Q  GH+A           A+C   AST  
Sbjct: 358 MLCTGQ--APQCTYLPAAGTGQLGSTAPSAVQLAGHLA-----------ALC---ASTAQ 401

Query: 371 KRSQCPTLQPAVVATYKSS 427
           + ++C +LQP++V   K S
Sbjct: 402 RNARCTSLQPSLVTPEKGS 420

>ref|XP_203424.1| RIKEN cDNA 1700024J04 [Mus musculus]
          Length = 109

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 13/42 (30%), Positives = 18/42 (41%)
 Frame = +1

Query: 337 CHVPLARVNYCKALPVSYTSACCCCHL*VFKKCAALSIAVCY 462
           CH   +  +YC   P  +   CC CH   FK C +     C+
Sbjct: 14  CHPRSSESHYCTCYPRCFKRCCCMCHRKGFKWCCSTCYPRCF 55

>dbj|BAB24517.1| unnamed protein product [Mus musculus]
          Length = 199

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 13/42 (30%), Positives = 18/42 (41%)
 Frame = +1

Query: 337 CHVPLARVNYCKALPVSYTSACCCCHL*VFKKCAALSIAVCY 462
           CH   +  +YC   P  +   CC CH   FK C +     C+
Sbjct: 14  CHPRSSESHYCTCYPRCFKRCCCMCHRKGFKWCCSTCYPRCF 55

>dbj|BAC05951.1| seven transmembrane helix receptor [Homo sapiens]
          Length = 472

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +2

Query: 398 PAVVATYKSSKSVLLYPLQYAI-HTCANIARRTHLPCAGLLRYIQTQPSRPIP 553
           PAV+A      S +  P+ YAI H    +A   HLPC G+L  +  + SRP P
Sbjct: 335 PAVIA----KASAIHNPIIYAITHPKYRVAIAQHLPCLGVLLGVSRRHSRPYP 383



EST assemble image


clone accession position
1 HC013b03_r AV632829 1 469
2 CL73h10_r AV396974 38 533
3 CL36d01_r AV395124 40 567




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research