KCC000511A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000511A_C01 KCC000511A_c01
tgctcagcatactctGACAGCGTTTGATAACCACACCTCATATACATTCAGCGAAACGGC
AAGTGAGAGCGCTGACGCAAACTATTACATCAACAGACGATGGAGACTGGTCTCCAACGC
CGCTGTTTTAGGACAAGTAGCAGGCCAAACCGTTATGCCACTTGCCGAGTGAGCGCCACA
CTGATGGCGAAGCCCCCCGGCGTGGCGCTGTCGGGGCGCACAGCGACGCCTGCGACCACC
TCCAACGAGGAGCGCTTGGCCAGCGGCGCGCAAGCTGGACCCAGCCCCCATTCTGCGCAT
TTGCAGCAAATGCCCCGGAGGTCTCAGCCGGTCACTGTCGCCATGCTGAACGACGTGCGC
ACTATGTTCCACTCGCTGCTGGACGAGTTTGCATACTTCGTTGACCCCGGCTGGGTGACC
GGAACCATTCCACCGGAGCTGAACGGCACGTACTACCGGAACGGCCCGGGTTTGCAGGT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000511A_C01 KCC000511A_c01
         (479 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_488324.1| lignostilbene-alpha,beta-dioxygenase [Nostoc sp...    41  0.008
ref|ZP_00112423.1| COG3670: Lignostilbene-alpha,beta-dioxygenase...    41  0.008
ref|NP_680806.1| lignostilbene-alpha,beta-dioxygenase [Thermosyn...    40  0.011
ref|NP_441748.1| lignostilbene-alpha,beta-dioxygenase [Synechocy...    40  0.019
ref|ZP_00072956.1| COG3670: Lignostilbene-alpha,beta-dioxygenase...    39  0.024

>ref|NP_488324.1| lignostilbene-alpha,beta-dioxygenase [Nostoc sp. PCC 7120]
           gi|25532499|pir||AE2341
           lignostilbene-alpha,beta-dioxygenase [imported] - Nostoc
           sp. (strain PCC 7120) gi|17133419|dbj|BAB75983.1|
           lignostilbene-alpha,beta-dioxygenase [Nostoc sp. PCC
           7120]
          Length = 497

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 20/36 (55%), Positives = 24/36 (66%)
 Frame = +1

Query: 367 FHSLLDEFAYFVDPGWVTGTIPPELNGTYYRNGPGL 474
           + SL  EF Y++D   V G IP EL GT +RNGPGL
Sbjct: 25  YKSLRQEFDYWIDD--VEGEIPTELQGTLFRNGPGL 58

>ref|ZP_00112423.1| COG3670: Lignostilbene-alpha,beta-dioxygenase and related enzymes
           [Nostoc punctiforme]
          Length = 498

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 19/36 (52%), Positives = 24/36 (65%)
 Frame = +1

Query: 367 FHSLLDEFAYFVDPGWVTGTIPPELNGTYYRNGPGL 474
           + SL  EF Y++D   + G IP EL GT +RNGPGL
Sbjct: 24  YQSLTQEFDYWIDD--IEGQIPRELEGTLFRNGPGL 57

>ref|NP_680806.1| lignostilbene-alpha,beta-dioxygenase [Thermosynechococcus elongatus
           BP-1] gi|22293736|dbj|BAC07568.1|
           lignostilbene-alpha,beta-dioxygenase
           [Thermosynechococcus elongatus BP-1]
          Length = 487

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 23/50 (46%), Positives = 31/50 (62%)
 Frame = +1

Query: 325 QPVTVAMLNDVRTMFHSLLDEFAYFVDPGWVTGTIPPELNGTYYRNGPGL 474
           +P T+A   D R    SL  E+ Y+++   V GT+P +L GT YRNGPGL
Sbjct: 7   RPYTMA---DWRGGTESLTQEYDYWIEE--VEGTVPTDLVGTLYRNGPGL 51

>ref|NP_441748.1| lignostilbene-alpha,beta-dioxygenase [Synechocystis sp. PCC 6803]
           gi|7469459|pir||S76169 hypothetical protein -
           Synechocystis sp. (strain PCC 6803)
           gi|1653515|dbj|BAA18428.1|
           lignostilbene-alpha,beta-dioxygenase [Synechocystis sp.
           PCC 6803]
          Length = 490

 Score = 39.7 bits (91), Expect = 0.019
 Identities = 19/36 (52%), Positives = 25/36 (68%)
 Frame = +1

Query: 367 FHSLLDEFAYFVDPGWVTGTIPPELNGTYYRNGPGL 474
           + S   E+ Y+V+   V G+IPP+L GT YRNGPGL
Sbjct: 24  YQSQPQEWDYWVED--VEGSIPPDLQGTLYRNGPGL 57

>ref|ZP_00072956.1| COG3670: Lignostilbene-alpha,beta-dioxygenase and related enzymes
           [Trichodesmium erythraeum IMS101]
          Length = 300

 Score = 39.3 bits (90), Expect = 0.024
 Identities = 17/36 (47%), Positives = 25/36 (69%)
 Frame = +1

Query: 367 FHSLLDEFAYFVDPGWVTGTIPPELNGTYYRNGPGL 474
           + S   E+ Y++D   + G IP +LNGT++RNGPGL
Sbjct: 21  YKSQPQEYNYWIDD--IEGEIPEDLNGTFFRNGPGL 54



EST assemble image


clone accession position
1 MXL016c02_r BP093957 1 403
2 LCL091d07_r AV631282 4 283
3 HCL010e06_r AV640108 19 254
4 LCL067h09_r AV629866 29 471
5 LCL099h04_r AV631787 33 216
6 CL36c09_r AV395144 35 485
7 LCL096c07_r AV631568 136 403




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research