KCC000509A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000509A_C01 KCC000509A_c01
gactatcaCCGACGCAGCGGAAACGGCACGCCTGCAAAGGCGGGGCCCCCTGCAAATGGC
CATTTGACGGTTGAAGCACATGCGGCGCAGGATGACGGGCAAGCGGGTCCTAGCGGGCGA
CCACCTGCCCTAAGTATGCGCGCTAGTGGCGGTGGAGGTGGCGGCACGCACAAGCGTCTG
CATGCTGGAGCCTGCTTCCTTATTGGTGTCGCTGGGGGCACCGCGTCGGGCAAGACAACC
GTCTGTGACCAGATTATGCAGCGACTGCACGATTCGTGCGTTGTTATGCTAAGCCAGGAC
AGCTTCTATCGATGTCTCACAGATGAGGAGCGCCAGAACGTTGGAGCCTTCAACTTCGAC
CACCCCAGCGCGTTCGATGTGCCGCTGCTGATGAAGACGCTGCAGGACCTTCGGGAGGGC
AAGTCCGCGGAGGTGCCAATCTACGACTTCGCCAAGCACTCGCGCTCGGAGGAGACGCAC
ACCACTGGCCCAGCCGACGTGATC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000509A_C01 KCC000509A_c01
         (504 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAC38646.1| unnamed protein product [Mus musculus]                128  3e-29
ref|NP_109649.1| uridine-cytidine kinase 2; uridine monophosphat...   128  3e-29
ref|NP_036606.2| uridine monophosphate kinase; uridine-cytidine ...   126  1e-28
dbj|BAB56162.1| uridine-cytidine kinase 2 [Homo sapiens]              124  9e-28
gb|AAH54665.1| Unknown (protein for MGC:66240) [Danio rerio]          122  3e-27

>dbj|BAC38646.1| unnamed protein product [Mus musculus]
          Length = 261

 Score =  128 bits (322), Expect = 3e-29
 Identities = 65/121 (53%), Positives = 85/121 (69%), Gaps = 9/121 (7%)
 Frame = +1

Query: 169 HKRLHAGACFLIGVAGGTASGKTTVCDQIMQRL-------HDSCVVMLSQDSFYRCLTDE 327
           H++ + G  FLIGV+GGTASGK++VC +I+Q L       H   VV+LSQDSFYR LT E
Sbjct: 12  HQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYHQKQVVILSQDSFYRVLTSE 71

Query: 328 ERQNV--GAFNFDHPSAFDVPLLMKTLQDLREGKSAEVPIYDFAKHSRSEETHTTGPADV 501
           ++     G FNFDHP AFD  L+ KTL+++ EGK+ ++P+YDF  HSR EET T  PADV
Sbjct: 72  QKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEETVTIYPADV 131

Query: 502 I 504
           +
Sbjct: 132 V 132

>ref|NP_109649.1| uridine-cytidine kinase 2; uridine monophosphate kinase 2; cytidine
           monophosphokinase 2 [Mus musculus]
           gi|20455355|sp|Q99PM9|UCK2_MOUSE Uridine-cytidine kinase
           2 (UCK 2) (Uridine monophosphokinase 2) (Cytidine
           monophosphokinase 2) gi|13172222|gb|AAK14052.1|
           uridine-cytidine kinase 2 [Mus musculus]
           gi|23273990|gb|AAH23789.1| Uridine-cytidine kinase 2
           [Mus musculus] gi|26342284|dbj|BAC34804.1| unnamed
           protein product [Mus musculus]
           gi|26343693|dbj|BAC35503.1| unnamed protein product [Mus
           musculus]
          Length = 261

 Score =  128 bits (322), Expect = 3e-29
 Identities = 65/121 (53%), Positives = 85/121 (69%), Gaps = 9/121 (7%)
 Frame = +1

Query: 169 HKRLHAGACFLIGVAGGTASGKTTVCDQIMQRL-------HDSCVVMLSQDSFYRCLTDE 327
           H++ + G  FLIGV+GGTASGK++VC +I+Q L       H   VV+LSQDSFYR LT E
Sbjct: 12  HQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYHQKQVVILSQDSFYRVLTSE 71

Query: 328 ERQNV--GAFNFDHPSAFDVPLLMKTLQDLREGKSAEVPIYDFAKHSRSEETHTTGPADV 501
           ++     G FNFDHP AFD  L+ KTL+++ EGK+ ++P+YDF  HSR EET T  PADV
Sbjct: 72  QKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEETVTIYPADV 131

Query: 502 I 504
           +
Sbjct: 132 V 132

>ref|NP_036606.2| uridine monophosphate kinase; uridine-cytidine kinase 2; uridine
           kinase; nucleoside-phosphate kinase; NMP-kinase [Homo
           sapiens] gi|20455356|sp|Q9BZX2|UCK2_HUMAN
           Uridine-cytidine kinase 2 (UCK 2) (Uridine
           monophosphokinase 2) (Cytidine monophosphokinase 2)
           gi|13172224|gb|AAK14053.1| uridine-cytidine kinase 2
           [Homo sapiens] gi|31417998|gb|AAH02906.2| Uridine
           monophosphate kinase [Homo sapiens]
          Length = 261

 Score =  126 bits (317), Expect = 1e-28
 Identities = 64/121 (52%), Positives = 85/121 (69%), Gaps = 9/121 (7%)
 Frame = +1

Query: 169 HKRLHAGACFLIGVAGGTASGKTTVCDQIMQRL-------HDSCVVMLSQDSFYRCLTDE 327
           H++ + G  FLIGV+GGTASGK++VC +I+Q L           VV+LSQDSFYR LT E
Sbjct: 12  HQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSE 71

Query: 328 ERQNV--GAFNFDHPSAFDVPLLMKTLQDLREGKSAEVPIYDFAKHSRSEETHTTGPADV 501
           ++     G FNFDHP AFD  L++KTL+++ EGK+ ++P+YDF  HSR EET T  PADV
Sbjct: 72  QKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADV 131

Query: 502 I 504
           +
Sbjct: 132 V 132

>dbj|BAB56162.1| uridine-cytidine kinase 2 [Homo sapiens]
          Length = 247

 Score =  124 bits (310), Expect = 9e-28
 Identities = 63/117 (53%), Positives = 82/117 (69%), Gaps = 9/117 (7%)
 Frame = +1

Query: 181 HAGACFLIGVAGGTASGKTTVCDQIMQRL-------HDSCVVMLSQDSFYRCLTDEERQN 339
           + G  FLIGV+GGTASGK++VC +I+Q L           VV+LSQDSFYR LT E++  
Sbjct: 2   NGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAK 61

Query: 340 V--GAFNFDHPSAFDVPLLMKTLQDLREGKSAEVPIYDFAKHSRSEETHTTGPADVI 504
              G FNFDHP AFD  L++KTL+++ EGK+ ++P+YDF  HSR EET T  PADV+
Sbjct: 62  ALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVV 118

>gb|AAH54665.1| Unknown (protein for MGC:66240) [Danio rerio]
          Length = 261

 Score =  122 bits (305), Expect = 3e-27
 Identities = 62/112 (55%), Positives = 79/112 (70%), Gaps = 9/112 (8%)
 Frame = +1

Query: 196 FLIGVAGGTASGKTTVCDQIMQRL-------HDSCVVMLSQDSFYRCLTDEERQNV--GA 348
           FLIGVAGGTASGK++VC +IM+ L       H   V +LSQDSFYR LT E++     G 
Sbjct: 23  FLIGVAGGTASGKSSVCGKIMELLGQNKIDHHQRQVAILSQDSFYRVLTPEQKAKALKGQ 82

Query: 349 FNFDHPSAFDVPLLMKTLQDLREGKSAEVPIYDFAKHSRSEETHTTGPADVI 504
           FNFDHP AFD  L++KTL ++ EG++ ++P+YDF  HSR EET T  PADV+
Sbjct: 83  FNFDHPDAFDNELIVKTLCEIMEGRTVQIPVYDFVTHSRKEETVTVYPADVV 134



EST assemble image


clone accession position
1 MXL078b01_r BP097585 1 363
2 CL36a10_r AV395156 9 504
3 MXL003d03_r BP093099 9 358




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research