KCC000508A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000508A_C01 KCC000508A_c01
ttGCGAAACGTGCATATACGGAGCTGTCTCTACAGCTGAACACTATGTGACTATGTCCTC
TGGCTTCTCTCAACTCTCGCCTGGATCTATGTAATGAGATAGCTATTCAGAAAAATGGAT
GCAAGCGCTGAATGGACGGGCGGCAGCCAATCACCGCTCGGAGAGTCTTTGCTTCCCTGC
ACTTCGGCTTTCCTGGTGCCTGGGCAGGAGGATGTTTACCTGCGCGACTCCCAATATTTT
GACGGGCGTACGTCTGTACAGGGTCTCAATGCAGGTTACGGAAGCCCTGGGCAGCTCATG
GGTGCCACATGGCCAACCCGACACGCATCCGCCTTCGCAGCACCAACAGCGTTCCCTGGC
CAGTCGCAGTATCCGGCGGATCCTCCCCTC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000508A_C01 KCC000508A_c01
         (390 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_542162.1| Emu1 protein [Mus musculus] gi|37537819|sp|Q91V...    35  0.33
dbj|BAA84938.1| ApBra [Asterina pectinifera]                           32  1.7
ref|NP_523548.1| spalt-related CG4881-PA [Drosophila melanogaste...    32  2.8
gb|AAH08642.1|AAH08642 Unknown (protein for IMAGE:3868989) [Homo...    32  2.8
pir||T13805 spalt-related protein - fruit fly (Drosophila melano...    32  2.8

>ref|NP_542162.1| Emu1 protein [Mus musculus] gi|37537819|sp|Q91VF5|EMU1_MOUSE Emu1
           protein precursor (Emilin and multimerin-domain
           containing protein 1) gi|16197710|emb|CAC94780.1|
           putative emu1 protein [Mus musculus]
          Length = 444

 Score = 34.7 bits (78), Expect = 0.33
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 6/72 (8%)
 Frame = +3

Query: 186 GFPGAWAGGCLPARLPIF*RAYVCTGSQCRLRKPWAAH------GCHMANPTRIRLRSTN 347
           G P AW   CL   LP    A+   G++   R+ W ++       CH+ N T ++ R   
Sbjct: 2   GGPRAWTLLCLGLLLPGGGAAWSVPGARFSGRRNWCSYVVTRTVSCHVQNGTYLQ-RVLQ 60

Query: 348 SVPWPVAVSGGS 383
           + PWP+   G S
Sbjct: 61  NCPWPMGCPGNS 72

>dbj|BAA84938.1| ApBra [Asterina pectinifera]
          Length = 453

 Score = 32.3 bits (72), Expect = 1.7
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 10/55 (18%)
 Frame = +2

Query: 203 GRRMFTCATPNILTGVR---LYRVSMQVTEA-------LGSSWVPHGQPDTHPPS 337
           GRRMF   + ++ TG+    +Y + +  T A       +   WVP G+PD+ PPS
Sbjct: 64  GRRMFPVLSASV-TGLNPNAMYSILLDFTPADEHRWKYVNGEWVPGGKPDSPPPS 117

>ref|NP_523548.1| spalt-related CG4881-PA [Drosophila melanogaster]
           gi|24583684|ref|NP_723669.1| spalt-related CG4881-PB
           [Drosophila melanogaster] gi|7297848|gb|AAF53096.1|
           CG4881-PA [Drosophila melanogaster]
           gi|22946253|gb|AAN10780.1| CG4881-PB [Drosophila
           melanogaster]
          Length = 1267

 Score = 31.6 bits (70), Expect = 2.8
 Identities = 24/68 (35%), Positives = 30/68 (43%), Gaps = 3/68 (4%)
 Frame = +1

Query: 178 CTSAFLVPGQEDV-YLRDSQYFDGRTSVQGL--NAGYGSPGQLMGATWPTRHASAFAAPT 348
           C S F   G   V Y R +Q F       G+  N G+   GQ+ G  +P R    FA P 
Sbjct: 354 CGSKFTTKGNLKVHYQRHTQIFPPMLLPPGVAPNVGHSGQGQVQGEQYPIR--LPFAPPV 411

Query: 349 AFPGQSQY 372
           A  GQ Q+
Sbjct: 412 APVGQEQH 419

>gb|AAH08642.1|AAH08642 Unknown (protein for IMAGE:3868989) [Homo sapiens]
          Length = 135

 Score = 31.6 bits (70), Expect = 2.8
 Identities = 21/67 (31%), Positives = 30/67 (44%)
 Frame = -3

Query: 241 QNIGSRAGKHPPAQAPGKPKCREAKTLRAVIGCRPSIQRLHPFF*IAISLHRSRRELREA 62
           Q    R G+ P  +  G P C  A+   +  G  P + R+HP    ++    S+R L EA
Sbjct: 1   QGASDRWGQSPAGKG-GLPPCSAARISSSPGGLPPVLSRVHP----SVPRSVSQRSLMEA 55

Query: 61  RGHSHIV 41
            G  H V
Sbjct: 56  LGSGHYV 62

>pir||T13805 spalt-related protein - fruit fly (Drosophila melanogaster)
           gi|1684681|emb|CAA68937.1| spalt-related [Drosophila
           melanogaster]
          Length = 1263

 Score = 31.6 bits (70), Expect = 2.8
 Identities = 24/68 (35%), Positives = 30/68 (43%), Gaps = 3/68 (4%)
 Frame = +1

Query: 178 CTSAFLVPGQEDV-YLRDSQYFDGRTSVQGL--NAGYGSPGQLMGATWPTRHASAFAAPT 348
           C S F   G   V Y R +Q F       G+  N G+   GQ+ G  +P R    FA P 
Sbjct: 354 CGSKFTTKGNLKVHYQRHTQIFPPMLLPPGVAPNVGHSGQGQVQGEQYPIR--LPFAPPV 411

Query: 349 AFPGQSQY 372
           A  GQ Q+
Sbjct: 412 APVGQEQH 419



EST assemble image


clone accession position
1 LCL032h02_r AV627846 1 302
2 LCL014c02_r AV626718 3 310
3 CL36a08_r AV395140 7 391
4 LCL040h06_r AV628382 17 356




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research