KCC000507A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000507A_C02 KCC000507A_c02
TAGGCAGATACCAAAATGGCGACCGCTCTGTGCAACAAGGCCTTCGCTGCCGCCCCCGTG
GCTCGCCCGGCTTCGCGCCGCTCGGCTGTCGTCGTCCGCGCCTCGGGCTCGGATGTGAGC
CGCCGCGCTGCTCTGGCTGGCTTCGCTGGCGCTGCCGCTCTGGTGTCCTCGAGCCCCGCC
AACGCTGCCTACGGTGACTCTGCCAACGTGTTCGGCAAGGTGACCAACAAGTCCGGCTTC
GTGCCCTACGCCGGCGATGGCTTCGCTCTGCTGCTGCCCGCCAAGTGGAACCCCCAGCAA
GGAGAACGACTTCCCCGGCGTGATCCTGCGCTACGAGGACAACTTCGACGCCGTGAACAA
CCTGGTCGTCATTTGCCCAGGACACCGACAAGAAGGCGATCTGCCGACTTCGGCAGCCAG
GACAAGTTCCTGGAGTCCGTCTCCTACCTGCTGGGCAAGCAGGCCTACTCCGGCGAGACC
CAGTCGGAGCGGTGGCTTCGCCCCCAACCGTGTGTCGGCTGCCTCCCTGCTGGACGTGTC
GACCACGACCCGACAAGAAGGGCAAGACTTACTACAAGTACGAGCTGCTGGTCCGCTCCG
CCGATGGCGATGAGGGCGGCCGCCACCAGCTGATCGGCGCCACCGTTGGCTCCGACAACA
AGCTGTACATCATCAAGATCCAGATTGGCGACAAGCGCTGGTTCAAGGGTGCCAAGAAGG
AGGCCATGGGCGCCTTCGACTCCTTCACCGTTGTGTAAGCGGCCAACCTGGCTCGCGTAA
GGAACGGGTGGAAGGAAGAGAGCTCGGAAAGCCGCATCCTGGTGCGTCGGGCGTCTGCAG
GCGCCCTCGCTCGGAGCTCGGAGCCCGGCGCAAGCTGCTGCTGCGGACCCGAGTGCGAGA
ACTCTGGGCTGCTGAATGGAGAGCAGCGAGGAGTTGCGCGTGAGGGAAAGCATGGAGCAG
GGGTCGGCATGAATGGCGATTTTCGGATTCGCAGCGGTGTCATTTTGTGTTAGCCCGGGC
ATGCGCCTTGCGTGGAGCTGTGCCTATTCGTGGGAGTGTGACCGGGTGCGTGGCAGTCGG
CGGCATAGCCCCAGCGCCTTGTGGTGAGCCAGTGCGGTTGGCCTGAGGGTGGGGCAATCT
GATGCCCCGACCTGCTGTGCGTGTTTTGCGTGTCATTTTGGAACTTGTTCTTACCGGTTC
CGACGGTGCCTACCATAGCGGTGGAGGTGGGTGCTGCAATATGGCGGAGTGTGTGTGGGC
GGTGTCAAAGCGCCGCCACACAGCTAGCAGAGGACGACTGCGGCCATTTTGCAAATCACA
GGCAAAATGCCAAAGAAGTTTGGCACCCCAGTACAGCGTGTTTCGTTCATAGTCCCCTCT
GCAACCCTCTTGAGAAGAAAACTGTAAACCCATTTCCGTT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000507A_C02 KCC000507A_c02
         (1420 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P11471|PSBP_CHLRE Oxygen-evolving enhancer protein 2, chlorop...   228  2e-58
pir||T02873 probable photosystem II oxygen-evolving complex prot...   112  7e-42
sp|O49080|PSBP_FRIAG Oxygen-evolving enhancer protein 2, chlorop...   114  2e-41
sp|Q9SLQ8|PSBP_CUCSA Oxygen-evolving enhancer protein 2, chlorop...   109  2e-41
sp|P29795|PSBP_LYCES Oxygen-evolving enhancer protein 2, chlorop...   108  1e-40

>sp|P11471|PSBP_CHLRE Oxygen-evolving enhancer protein 2, chloroplast precursor (OEE2)
           gi|81253|pir||S00413 photosystem II oxygen-evolving
           complex protein 2 precursor - Chlamydomonas reinhardtii
           gi|167428|gb|AAA33088.1| oxygen-evolving enhancer
           protein 2
          Length = 245

 Score =  228 bits (582), Expect = 2e-58
 Identities = 127/169 (75%), Positives = 133/169 (78%), Gaps = 6/169 (3%)
 Frame = +1

Query: 16  MATALCNKAFAAAPVARPASRRSAVVVRASGSDVSRRAALAGFAGAAALVSSSPANAAYG 195
           MATALCNKAFAAAPVARPASRRSAVVVRASGSDVSRRAALAGFAGAAALVSSSPANAAYG
Sbjct: 1   MATALCNKAFAAAPVARPASRRSAVVVRASGSDVSRRAALAGFAGAAALVSSSPANAAYG 60

Query: 196 DSANVFGKVTNKSGFVPYAGDGFALLLPAKWNPQQGERLPRRDPALRGQLRRREQPGRH- 372
           DSANVFGKVTNKSGFVPYAGDGFALLLPAKWNP +    P       G + R E      
Sbjct: 61  DSANVFGKVTNKSGFVPYAGDGFALLLPAKWNPSKENDFP-------GVILRYEDNFDAV 113

Query: 373 -----LPRTPTRRRSADFGSQDKFLESVSYLLGKQAYSGETQSERWLRP 504
                + +   ++  ADFGSQDKFLESVSYLLGKQAYSGETQSE    P
Sbjct: 114 NNLVVIAQDTDKKAIADFGSQDKFLESVSYLLGKQAYSGETQSEGGFAP 162

 Score =  145 bits (366), Expect = 2e-33
 Identities = 85/128 (66%), Positives = 86/128 (66%), Gaps = 1/128 (0%)
 Frame = +3

Query: 375 AQDTDKKAICRL-RQPGQVPGVRLLPAGQAGLLRRDPVGAVASPPTVCRLPPCWTCRPRP 551
           AQDTDKKAI     Q   +  V  L   QA        G  A  P               
Sbjct: 120 AQDTDKKAIADFGSQDKFLESVSYLLGKQAYSGETQSEGGFA--PNRVSAASLLDVSTTT 177

Query: 552 DKKGKTYYKYELLVRSADGDEGGRHQLIGATVGSDNKLYIIKIQIGDKRWFKGAKKEAMG 731
           DKKGKTYYKYELLVRSADGDEGGRHQLIGATVGSDNKLYIIKIQIGDKRWFKGAKKEAMG
Sbjct: 178 DKKGKTYYKYELLVRSADGDEGGRHQLIGATVGSDNKLYIIKIQIGDKRWFKGAKKEAMG 237

Query: 732 AFDSFTVV 755
           AFDSFTVV
Sbjct: 238 AFDSFTVV 245

>pir||T02873 probable photosystem II oxygen-evolving complex protein 2 precursor
           - rice gi|4079798|gb|AAC98778.1| 23 kDa polypeptide of
           photosystem II [Oryza sativa]
           gi|24059930|dbj|BAC21393.1| probable photosystem II
           oxygen-evolving complex protein 2 precursor [Oryza
           sativa (japonica cultivar-group)]
          Length = 254

 Score =  112 bits (281), Expect(2) = 7e-42
 Identities = 75/170 (44%), Positives = 101/170 (59%), Gaps = 12/170 (7%)
 Frame = +1

Query: 16  MATALC----NKAFAAAPVARP--ASRRSAVVVRAS---GSDVSRRAALAGFAGAAALVS 168
           MA+  C    + A  AA VA P  A+R   +V RA     +DVSRRAALA  AGA A V 
Sbjct: 1   MASTSCFLHQSTARVAARVASPSPATRTHLLVCRAQKQDDADVSRRAALALLAGATAAVG 60

Query: 169 S--SPANAAYGDSANVFGKVTNKSGFVPYAGDGFALLLPAKWNPQQGERLPRRDPALRGQ 342
              +PA AAYG++ANVFGK    + F+ Y+G+GF LL+P+KWNP +    P +   LR +
Sbjct: 61  VKVAPAAAAYGEAANVFGKPKTNTEFIAYSGEGFKLLIPSKWNPSKEREFPGQ--VLRYE 118

Query: 343 LRRREQPGRHLPRTPTRRRS-ADFGSQDKFLESVSYLLGKQAYSGETQSE 489
                     +   PT +++  +FGS ++FL  V +LLGKQAYSG+T SE
Sbjct: 119 DNFDANSNVSVIINPTTKKTITEFGSPEEFLAQVDFLLGKQAYSGKTDSE 168

 Score = 82.0 bits (201), Expect(2) = 7e-42
 Identities = 41/64 (64%), Positives = 47/64 (73%)
 Frame = +3

Query: 561 GKTYYKYELLVRSADGDEGGRHQLIGATVGSDNKLYIIKIQIGDKRWFKGAKKEAMGAFD 740
           GK YY   +L R+ADGDEGG+HQLI ATV +D KLYI K Q GDKRWFKGA+K    A  
Sbjct: 191 GKQYYSVTVLTRTADGDEGGKHQLITATV-NDGKLYICKAQAGDKRWFKGARKFVESAAS 249

Query: 741 SFTV 752
           SF+V
Sbjct: 250 SFSV 253

>sp|O49080|PSBP_FRIAG Oxygen-evolving enhancer protein 2, chloroplast precursor (OEE2)
           (23 kDa subunit of oxygen evolving system of photosystem
           II) (OEC 23 kDa subunit) (23 kDa thylakoid membrane
           protein) gi|2921508|gb|AAC04809.1| photosystem II oxygen
           evolving complex protein 2 precursor [Fritillaria
           agrestis]
          Length = 264

 Score =  114 bits (285), Expect(2) = 2e-41
 Identities = 72/179 (40%), Positives = 101/179 (56%), Gaps = 12/179 (6%)
 Frame = +1

Query: 4   ADTKMATALCNKAFAAAPVARPA-----SRRSAVVVRASGSDVSRRAALAGFAGAAALVS 168
           A +  AT     +    P  +P+     +++S+     S + VSRR AL    G+AA+ +
Sbjct: 12  APSTPATTSRTPSHRLVPTIKPSQLICRAQKSSDTDENSSTAVSRRLALTILIGSAAVGT 71

Query: 169 S-SPANAAYGDSANVFGKVTNKSGFVPYAGDGFALLLPAKWNPQQGERLPRRDPALRGQL 345
             +PANAAYG++ANVFGK    + F+PY GDGF LL+PAKWNP +    P       GQ+
Sbjct: 72  KIAPANAAYGEAANVFGKAKTNTDFLPYTGDGFNLLIPAKWNPSKEVEFP-------GQV 124

Query: 346 RRREQ-----PGRHLPRTPTRRRS-ADFGSQDKFLESVSYLLGKQAYSGETQSERWLRP 504
            R E          +  TPT ++S  D+G+ ++FL +V YLLGKQAYSG+T SE    P
Sbjct: 125 LRYEDNFDVTSNVSVTVTPTSKKSITDYGTPEEFLSTVDYLLGKQAYSGKTASEGGFDP 183

 Score = 79.0 bits (193), Expect(2) = 2e-41
 Identities = 39/64 (60%), Positives = 44/64 (67%)
 Frame = +3

Query: 561 GKTYYKYELLVRSADGDEGGRHQLIGATVGSDNKLYIIKIQIGDKRWFKGAKKEAMGAFD 740
           GK YY   +L R+ADGDEGG+H +I ATV +D KLYI K Q GDKRWFKGAKK       
Sbjct: 201 GKQYYNISVLTRTADGDEGGKHHVISATV-TDGKLYICKAQAGDKRWFKGAKKFVESTTT 259

Query: 741 SFTV 752
           SF V
Sbjct: 260 SFNV 263

 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 30/90 (33%), Positives = 46/90 (50%), Gaps = 1/90 (1%)
 Frame = +2

Query: 278 PPSGTPSKENDFPGVILRYEDNFDAVNNL-VVICPGHRQEGDLPTSAARTSSWSPSPTCW 454
           P    PSKE +FPG +LRYEDNFD  +N+ V + P  ++   +          S      
Sbjct: 109 PAKWNPSKEVEFPGQVLRYEDNFDVTSNVSVTVTPTSKKS--ITDYGTPEEFLSTVDYLL 166

Query: 455 ASRPTPARPSRSGGFAPNRVSAASLLDVST 544
             +    + +  GGF P+ V+ A++L+VST
Sbjct: 167 GKQAYSGKTASEGGFDPDSVATANILEVST 196

>sp|Q9SLQ8|PSBP_CUCSA Oxygen-evolving enhancer protein 2, chloroplast precursor (OEE2)
           (23 kDa subunit of oxygen evolving system of photosystem
           II) (OEC 23 kDa subunit) (23 kDa thylakoid membrane
           protein) (OEC23) gi|6691487|dbj|BAA89317.1| 23kDa
           polypeptide of the oxygen-evolving complex of
           photosystem II [Cucumis sativus]
          Length = 263

 Score =  109 bits (273), Expect(2) = 2e-41
 Identities = 64/135 (47%), Positives = 83/135 (61%), Gaps = 2/135 (1%)
 Frame = +1

Query: 106 GSDVSRRAALAGFAGAAALVSS-SPANAAYGDSANVFGKVTNKSGFVPYAGDGFALLLPA 282
           G  VSRR AL    GAAAL S  SPA+AAYG++ANVFGK  + + ++PY+GDGF L +P+
Sbjct: 50  GGVVSRRLALTVLIGAAALGSKVSPADAAYGEAANVFGKPKSNTDYLPYSGDGFKLSIPS 109

Query: 283 KWNPQQGERLPRRDPALRGQLRRREQPGRHLPRTPTRRRS-ADFGSQDKFLESVSYLLGK 459
           KWNP +    P +   LR +          +   PT ++S  DFGS ++FL  V YLLGK
Sbjct: 110 KWNPSKEREFPGQ--VLRYEDNFDSNSNLSVIINPTDKKSIKDFGSPEEFLSKVDYLLGK 167

Query: 460 QAYSGETQSERWLRP 504
           QAY G+T SE    P
Sbjct: 168 QAYFGKTASEGGFDP 182

 Score = 83.6 bits (205), Expect(2) = 2e-41
 Identities = 42/64 (65%), Positives = 48/64 (74%)
 Frame = +3

Query: 561 GKTYYKYELLVRSADGDEGGRHQLIGATVGSDNKLYIIKIQIGDKRWFKGAKKEAMGAFD 740
           GK YY   +L R+ADGDEGG+HQLI ATV +D KLYI K Q GDKRWFKGA+K   GA  
Sbjct: 200 GKDYYFVSVLTRTADGDEGGKHQLITATV-NDGKLYICKAQAGDKRWFKGARKFVEGAAS 258

Query: 741 SFTV 752
           SF+V
Sbjct: 259 SFSV 262

>sp|P29795|PSBP_LYCES Oxygen-evolving enhancer protein 2, chloroplast precursor (OEE2)
           (23 kDa subunit of oxygen evolving system of photosystem
           II) (OEC 23 kDa subunit) (23 kDa thylakoid membrane
           protein) gi|72723|pir||F2TOX2 photosystem II
           oxygen-evolving complex protein 2 precursor - tomato
           gi|19317|emb|CAA44736.1| photosystem II 23 kDa protein
           [Lycopersicon esculentum]
          Length = 258

 Score =  108 bits (270), Expect(2) = 1e-40
 Identities = 64/132 (48%), Positives = 82/132 (61%), Gaps = 2/132 (1%)
 Frame = +1

Query: 100 ASGSDVSRRAALAGFAGAAALVSS-SPANAAYGDSANVFGKVTNKSGFVPYAGDGFALLL 276
           AS + VSRR AL    G AA+ S  SPA+AAYG++ANVFGK    + F+PY GDGF L +
Sbjct: 43  ASNAAVSRRLALTLLIGTAAIGSKVSPADAAYGEAANVFGKPKENTDFLPYNGDGFKLQV 102

Query: 277 PAKWNPQQGERLPRRDPALRGQLRRREQPGRHLPRTPTRRRS-ADFGSQDKFLESVSYLL 453
           PAKWNP +    P +   LR +          +  TPT ++S  D+GS ++FL  V YLL
Sbjct: 103 PAKWNPSKEVEYPGQ--VLRYEDNFDSTSNLIVAVTPTDKKSITDYGSPEEFLSKVDYLL 160

Query: 454 GKQAYSGETQSE 489
           GKQAY G+T SE
Sbjct: 161 GKQAYFGKTDSE 172

 Score = 82.0 bits (201), Expect(2) = 1e-40
 Identities = 41/64 (64%), Positives = 47/64 (73%)
 Frame = +3

Query: 561 GKTYYKYELLVRSADGDEGGRHQLIGATVGSDNKLYIIKIQIGDKRWFKGAKKEAMGAFD 740
           GK YY   +L R+ADGDEGG+HQLI ATV +D KLYI K Q GDKRWFKGAKK    A  
Sbjct: 195 GKEYYYLSVLTRTADGDEGGKHQLITATV-NDGKLYICKAQAGDKRWFKGAKKFVENAAT 253

Query: 741 SFTV 752
           SF++
Sbjct: 254 SFSI 257



EST assemble image


clone accession position
1 MX221e04_r BP090281 1 552
2 MX227d02_r BP090675 9 552
3 HC064g05_r AV636826 14 607
4 MX224e07_r BP090476 28 442
5 HC016h05_r AV633111 31 655
6 LC032c04_r AV621173 34 607
7 HC060e11_r AV636520 48 624
8 MXL027b03_r BP094678 113 475
9 LC032b09_r AV621167 113 618
10 LC018b07_r AV620144 117 637
11 HC019g03_r AV633344 117 540
12 CM078f11_r AV391855 117 722
13 LC058e05_r AV623070 118 631
14 MX225e10_r BP090553 118 429
15 MXL074b01_r BP097338 118 502
16 CM009d11_r AV397693 118 756
17 LC062c05_r AV623336 119 622
18 LCL095e09_r AV631521 119 605
19 MX025d05_r BP087103 119 501
20 CM031g10_r AV388362 119 493
21 LC072a01_r AV624030 119 634
22 LC077g05_r AV624439 119 632
23 LC077g09_r AV624440 119 568
24 LC095a01_r AV625582 119 553
25 LC092c01_r AV625416 119 613
26 MX210a10_r BP089578 120 447
27 CM030e01_r AV397384 120 758
28 LC034f01_r AV621337 121 691
29 MX203c07_r BP089230 122 496
30 MX023c07_r BP087032 122 431
31 HC047g01_r AV635546 122 660
32 MX253c12_r BP092373 122 594
33 LC096g09_r AV625713 123 559
34 MX242g05_r BP091689 123 643
35 LC075c10_r AV624267 123 650
36 CM087c01_r AV392484 124 686
37 MX201h03_r BP089160 124 424
38 HC065d08_r AV636872 124 621
39 HC079g02_r AV637944 124 590
40 HC029g10_r AV634145 124 662
41 MX220b09_r BP090187 124 452
42 LCL042d06_r AV628471 124 605
43 MX254a12_r BP092429 124 606
44 MX008d06_r BP086416 124 526
45 CM080a01_r AV392040 124 762
46 LC100e06_r AV625970 124 568
47 HC088d01_r AV638595 124 684
48 HC029g11_r AV634146 124 661
49 HC066h07_r AV636973 124 575
50 LC001g08_r AV618950 125 629
51 LC071c12_r AV623980 125 666
52 MX253e11_r BP092391 125 619
53 HC028d12_r AV634039 125 619
54 CM023e05_r AV387757 126 769
55 LC097f08_r AV625772 128 569
56 HC098e10_r AV639375 128 651
57 CM066d05_r AV390868 128 753
58 CM021a03_r AV387917 130 746
59 MX063d04_r BP088559 130 497
60 LC079g12_r AV624590 130 631
61 HC004c02_r AV632123 130 627
62 HCL017d03_r AV640500 130 621
63 HC025c05_r AV633789 130 652
64 LC074d03_r AV624203 130 668
65 MX029e08_r BP087264 130 523
66 LC015a06_r AV619920 130 674
67 HC031b09_r AV634262 130 672
68 LC050f10_r AV622514 130 683
69 CM099c01_r AV393132 130 608
70 CM075h08_r AV391621 130 778
71 HC016g01_r AV633097 130 607
72 HC074a09_r AV637513 130 454
73 CM014h06_r AV387368 130 772
74 CM021e08_r AV387916 131 774
75 LC017g12_r AV620119 131 663
76 LC010h03_r AV619619 131 650
77 HC096b01_r AV639188 131 594
78 CM077c12_r AV391795 131 772
79 HC077d01_r AV637775 131 601
80 HC030g02_r AV634223 131 640
81 CM029c03_r AV389358 131 717
82 MX260c06_r BP092873 131 672
83 MX203g10_r BP089254 133 510
84 CM030h02_r AV397367 134 768
85 MX046h02_r BP087919 134 515
86 HC070e09_r AV637240 134 594
87 MXL059e01_r BP096483 134 532
88 LC059e11_r AV623147 134 621
89 HC003e08_r AV632071 134 627
90 MX043a03_r BP087756 134 502
91 HC050a08_r AV635721 134 651
92 HC020g09_r AV633438 134 635
93 HC013a06_r AV632821 134 619
94 HC076e12_r AV637713 134 585
95 HC085f12_r AV638384 135 588
96 MX066a01_r BP088656 135 380
97 HC011g05_r AV632717 135 632
98 CM048c10_r AV389128 136 551
99 MX014f11_r BP086700 137 531
100 MXL023f06_r BP094474 137 621
101 HC008f03_r AV632468 137 631
102 HC085d08_r AV638362 137 672
103 MXL019h03_r BP094230 137 712
104 HC063g12_r AV636759 137 646
105 HC009a03_r AV632498 138 622
106 HC009a02_r AV632497 138 635
107 HC023c02_r AV633632 139 640
108 HC012g07_r AV632802 139 626
109 MX012b09_r BP086584 139 626
110 MX260a05_r BP092852 141 674
111 MX059d02_r BP088395 141 502
112 LC063g09_r AV623438 143 622
113 CM037h02_r AV388845 143 659
114 CM042f05_r AV389277 143 399
115 MX210b06_r BP089582 143 469
116 MX244f06_r BP091811 146 616
117 MX240h10_r BP091553 146 513
118 MX042c06_r BP087720 146 378
119 MX256c04_r BP092580 146 579
120 MX251c09_r BP092225 147 579
121 MX042g08_r BP087746 147 498
122 HC002d01_r AV631970 147 301
123 CM024e10_r AV388270 148 741
124 HC063h11_r AV636770 151 686
125 LC078d09_r AV624488 155 537
126 MX245f03_r BP091878 159 629
127 HC034d08_r AV634516 163 632
128 MX019d04_r BP086875 164 684
129 LC096c04_r AV625669 165 455
130 CM052a01_r AV390489 168 752
131 HC005c05_r AV632203 184 736
132 LC005a10_r AV619200 193 697
133 HC049c08_r AV635665 218 589
134 HC078f12_r AV637872 226 759
135 LC089h11_r AV625249 238 758
136 CM029h03_r AV389363 242 833
137 CM084c08_r AV392599 298 852
138 HC023f09_r AV633662 315 755
139 HC056h08_r AV636240 316 764
140 CM100f02_r AV392826 334 767
141 MXL056h01_r BP096328 336 754
142 MX103d03_r BP088976 346 857
143 MX102a11_r BP088872 351 863
144 CM037d12_r AV388908 371 861
145 MXL064a05_r BP096737 375 885
146 HC006d11_r AV632297 387 878
147 HC096f08_r AV639232 398 938
148 LC015e01_r AV619951 420 984
149 LC072c10_r AV624055 429 871
150 LC031e10_r AV621125 440 967
151 LC004e08_r AV619156 440 1006
152 CM020g10_r AV397441 446 1036
153 MX241c04_r BP091577 450 910
154 MXL012b08_r BP093697 452 720
155 CM027d02_r AV387647 455 1065
156 HC059h07_r AV636468 456 927
157 CM013d03_r AV387047 464 1011
158 MX102a03_r BP088864 472 880
159 MX102a01_r BP088862 472 882
160 MX102g05_r BP088925 472 1006
161 MX102g09_r BP088929 472 858
162 MX102a07_r BP088868 472 880
163 MX102e07_r BP088907 472 884
164 MX102f07_r BP088917 472 885
165 MX103f03_r BP088998 472 835
166 MX104g08_r BP089100 472 1002
167 MX102b11_r BP088884 472 863
168 MX103a02_r BP088945 472 864
169 MX103g12_r BP089016 472 880
170 MX102b02_r BP088875 472 883
171 MX033g04_r BP087400 475 875
172 LCL080f06_r AV630554 478 945
173 HC065a09_r AV636848 482 962
174 CM027f09_r AV387600 485 1088
175 CM085c10_r AV392400 492 939
176 CL36a02_r AV395112 494 1010
177 LC001a08_r AV618897 497 940
178 LC064c02_r AV623469 502 860
179 HC022g11_r AV633601 507 881
180 MXL031e08_r BP094880 510 829
181 CM027h06_r AV387657 513 1115
182 CM098g05_r AV392904 527 948
183 CM053b11_r AV389886 527 782
184 CS001h06_r AV397990 565 778
185 CM035f09_r AV388714 585 1146
186 CM086h08_r AV392556 587 916
187 CM086b07_r AV392563 591 1084
188 CM012d08_r AV387141 592 1101
189 MXL020g01_r BP094293 881 1404
190 CM021h10_r AV387951 999 1573
191 LC003e05_r AV619080 1011 1573
192 MX253e10_r BP092390 1090 1696
193 CM085b06_r AV392338 1092 1613
194 LCL051e03_r AV629074 1096 1607
195 LC075a10_r AV624248 1109 1602
196 LC021e07_r AV620389 1109 1617
197 LC040f04_r AV621761 1125 1610
198 HC022a04_r AV633542 1200 1610
199 CM007c09_r AV386831 1311 1577




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research