KCC000506A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000506A_C01 KCC000506A_c01
TGGCCGCTATGATGATGCGTCAGAAGTGTTGCCGGTGCCATCGCCGGCGATGCGCCGCTC
GGCTGTGTGCCCCCAAGATGGGCCGCGCCGCGACCGCCCCCGGTTGTCGTCGCCTCGGCG
AACGCTTCGGCCTTCAAGGGTGCCGCTGTGACCGCTCGCGTGAAGCGCTCGACCCGCGCT
GCCCGTGTGCAGTCTCGCCGCACTGGCCGTTCTGACCCAGGCCAAGATCGGCGACAGCCT
GGCTGAGTTCCTGGTCGAGGCCACCCCCGACCCGAAGCTGCGCCAGCTGATGATGAGCAT
GGCTGAGGCCACCCGCACCATCGCCCCACAAGGTCCGCACCGCCTCGTGCGCCGGTACCG
CCTGCGTGAACAGCTTCGGCGATGAGCAGCTGGCCGTCGACATGGTGGCTGACAAGCTGC
TGTTCGAGGCCCTGAAGTACTCGCACGTGTGCAAGCTGGCCTGCTCCGAGGAGGTGCCCG
AGCCCGTGGACATGGGCGGGGAGGGCTTCTGCGTGGCCTTCGACCCCCTGGCACGGCTCG
TCCATCGTCGACACCAACTTCGCCGTGGGCACCATCTTCGGCGTGTGGCCCGGCGACAAG
CTGACCAACATCACCGGCCGCGAGCAGGTGGCTGCCGGCATGGGCATCTACGGTCCCCGC
ACCGTGTTCTGCATTGCCCTGAAGGACGCCCCCGGCTGCCACGAGTTCCTGCTGATGGAC
GACGGCAAGTGGATGCACGTCAAGGAGACCACCCACATCGGTGAGGGCAAGATGTTCGCC
CCCGGCAACCTGCGCGCCACCTTCGACAACCCCGCCTACGAGCGCCTGATCAACTTCTAC
CTGGGCGAGAAGTACACCCTGCGCTACACCGGCGGCATGGTGCCCGACGTGTTCCAGATC
ATTGTCAAGGAGAAGGGTGTGTTCACCAACGTGACCTCGCCCACCACCAAGGCCAAGCTC
CGCATCCTGTTCGAGGTTGCTCCCCTGGCCCTGCTGATCGAGAAGGCCGGCGGTGCCTCC
AGCTGCGACGGCAAGGCCGTGTCCGCTCTGGACATCCCCATCCTGGTGTGCGACCAGCGC
ACCCAGATCTGCTACGGCTCGATCGGCGAGGTCCGCCGCTTCGAGGAGTACATGTACGGC
ACCTCGCCCCGCTTCTCTGAGAAGGTGGCTGCCTAAGCGCTCCACCCGGCATGTGGGCAC
CTCGCAGCACCCGGCCGCAGCTCGTGGAGAGTTGCTGGTTGTGTGCTACGGGTGAACGAT
GAGTGTTGGCTGACTGCTTTTGCCAGTTTTGGGACTGGTCGTCGCGCGCGCGCGCGGCTG
CCGTTTTTGTTGGTGTGGTGTTTGTGTGAGCCTCTCGTGGTGGGTGCTGGCTGGATGTGG
GTGTTGATGGAACATCTGGGCGGGCTGACCGTGCAGGGTGAATTTTGAGTGGTTTCGGGC
TTTTTTCCGGGCGTATGCCCTTAGGCCGTGCTTGCTGAGGTGGAGCGAGGTGAGAAGAGA
ATCAACGGAGTGGCCGAGGGTGCCGCGATTCGGGTGCGTAAACTCGGCGCGGGGTGTACT
CTCATGGAACGACAGGCGAATGCGCCTTATGTAAATCAACAAAAttg


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000506A_C01 KCC000506A_c01
         (1607 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P46285|S17P_WHEAT Sedoheptulose-1,7-bisphosphatase, chloropla...   317  e-121
gb|AAO22558.1| sedoheptulose-1,7-bisphosphatase precursor [Oryza...   313  e-119
sp|P46284|S17P_CHLRE Sedoheptulose-1,7-bisphosphatase, chloropla...   430  e-119
gb|AAK96860.1| sedoheptulose-bisphosphatase precursor [Arabidops...   303  e-117
ref|NP_191139.1| sedoheptulose-bisphosphatase precursor [Arabido...   303  e-117

>sp|P46285|S17P_WHEAT Sedoheptulose-1,7-bisphosphatase, chloroplast precursor
            (Sedoheptulose-bisphosphatase) (SBPASE) (SED(1,7)P2ASE)
            gi|100803|pir||S23452 sedoheptulose-bisphosphatase (EC
            3.1.3.37) precursor - wheat gi|14265|emb|CAA46507.1|
            sedoheptulose-1,7-bisphosphatase [Triticum aestivum]
          Length = 393

 Score =  317 bits (811), Expect(3) = e-121
 Identities = 156/207 (75%), Positives = 175/207 (84%)
 Frame = +1

Query: 526  PWHGSSIVDTNFAVGTIFGVWPGDKLTNITGREQVAAGMGIYGPRTVFCIALKDAPGCHE 705
            P  GSSIVDTNF VGTIFGVWPGDKLT +TG +QVAA MGIYGPRT F +ALKD PG HE
Sbjct: 177  PLDGSSIVDTNFTVGTIFGVWPGDKLTGVTGGDQVAAAMGIYGPRTTFVVALKDCPGTHE 236

Query: 706  FLLMDDGKWMHVKETTHIGEGKMFAPGNLRATFDNPAYERLINFYLGEKYTLRYTGGMVP 885
            FLL+D+GKW HVK+TT IGEGKMF+PGNLRATFDNP Y++L+N+Y+ EKYTLRYTGGMVP
Sbjct: 237  FLLLDEGKWQHVKDTTSIGEGKMFSPGNLRATFDNPDYDKLVNYYVKEKYTLRYTGGMVP 296

Query: 886  DVFQIIVKEKGVFTNVTSPTTKAKLRILFEVAPLALLIEKAGGASSCDGKAVSALDIPIL 1065
            DV QIIVKEKG+FTNVTSPT KAKLR+LFEVAPL  LIEKAGG SS DGK  S LD  I 
Sbjct: 297  DVNQIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGFLIEKAGGHSS-DGKQ-SVLDKVIS 354

Query: 1066 VCDQRTQICYGSIGEVRRFEEYMYGTS 1146
            V D+RTQ+ YGS  E+ RFEE +YG+S
Sbjct: 355  VLDERTQVAYGSKNEIIRFEETLYGSS 381

 Score =  117 bits (293), Expect(3) = e-121
 Identities = 59/70 (84%), Positives = 61/70 (86%), Gaps = 3/70 (4%)
 Frame = +3

Query: 330 KVRTASCAGTACVNSFGDEQLAVDMVADKLLFEALKYSHVCKLACSEEVPEPVDMGGE-- 503
           KVRTASC GTACVNSFGDEQLAVDM+ADKLLFEAL+YSHVCK ACSEEVPE  DMGG   
Sbjct: 109 KVRTASCGGTACVNSFGDEQLAVDMLADKLLFEALEYSHVCKYACSEEVPELQDMGGPVE 168

Query: 504 -GFCVAFDPL 530
            GF VAFDPL
Sbjct: 169 GGFSVAFDPL 178

 Score = 46.6 bits (109), Expect(3) = e-121
 Identities = 32/85 (37%), Positives = 45/85 (52%), Gaps = 4/85 (4%)
 Frame = +2

Query: 83  PRRDRPRLSSPRRTLRPSRVPL*PLA*SARPALPVC----SLAALAVLTQAKIGDSLAEF 250
           P+  RP  S    +LR +         +AR + P      + +  A+ T+  IGDSL EF
Sbjct: 32  PKAARPATSFYGESLRAN---------TARTSFPAGRQSKAASRAALTTRCAIGDSLEEF 82

Query: 251 LVEATPDPKLRQLMMSMAEATRTIA 325
           L +ATPD  L +L++ M EA RTIA
Sbjct: 83  LTKATPDKNLIRLLICMGEAMRTIA 107

>gb|AAO22558.1| sedoheptulose-1,7-bisphosphatase precursor [Oryza sativa (indica
            cultivar-group)] gi|27804772|gb|AAO22559.1|
            sedoheptulose-1,7-bisphosphatase precursor [Oryza sativa
            (indica cultivar-group)]
          Length = 392

 Score =  313 bits (802), Expect(3) = e-119
 Identities = 156/207 (75%), Positives = 174/207 (83%)
 Frame = +1

Query: 526  PWHGSSIVDTNFAVGTIFGVWPGDKLTNITGREQVAAGMGIYGPRTVFCIALKDAPGCHE 705
            P  GSSIVDTNF VGTIFGVWPGDKLT +TG +QVAA MGIYGPRT + IALKD PG HE
Sbjct: 176  PLDGSSIVDTNFTVGTIFGVWPGDKLTGVTGGDQVAAAMGIYGPRTTYIIALKDCPGTHE 235

Query: 706  FLLMDDGKWMHVKETTHIGEGKMFAPGNLRATFDNPAYERLINFYLGEKYTLRYTGGMVP 885
            FLL+D+GKW HVK+TT IGEGKMF+PGNLRATFDNP Y++LIN+Y+ EKYTLRYTGGMVP
Sbjct: 236  FLLLDEGKWQHVKDTTTIGEGKMFSPGNLRATFDNPEYDKLINYYVKEKYTLRYTGGMVP 295

Query: 886  DVFQIIVKEKGVFTNVTSPTTKAKLRILFEVAPLALLIEKAGGASSCDGKAVSALDIPIL 1065
            DV QIIVKEKG+FTNVTSPT KAKLR+LFEVAPL  LIEKAGG SS DGK  S LD  I 
Sbjct: 296  DVNQIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGFLIEKAGGYSS-DGKQ-SVLDKVIN 353

Query: 1066 VCDQRTQICYGSIGEVRRFEEYMYGTS 1146
              D+RTQ+ YGS  E+ RFEE +YG+S
Sbjct: 354  NLDERTQVAYGSKNEIIRFEETLYGSS 380

 Score =  117 bits (293), Expect(3) = e-119
 Identities = 59/70 (84%), Positives = 61/70 (86%), Gaps = 3/70 (4%)
 Frame = +3

Query: 330 KVRTASCAGTACVNSFGDEQLAVDMVADKLLFEALKYSHVCKLACSEEVPEPVDMGGE-- 503
           KVRTASC GTACVNSFGDEQLAVDM+ADKLLFEAL+YSHVCK ACSEEVPE  DMGG   
Sbjct: 108 KVRTASCGGTACVNSFGDEQLAVDMLADKLLFEALEYSHVCKYACSEEVPELQDMGGPVD 167

Query: 504 -GFCVAFDPL 530
            GF VAFDPL
Sbjct: 168 GGFSVAFDPL 177

 Score = 45.4 bits (106), Expect(3) = e-119
 Identities = 22/40 (55%), Positives = 30/40 (75%)
 Frame = +2

Query: 206 AVLTQAKIGDSLAEFLVEATPDPKLRQLMMSMAEATRTIA 325
           A+ T+ +IGDSL EFL +ATPD  L +L++ M EA RTI+
Sbjct: 67  ALSTRCEIGDSLEEFLTKATPDKNLIRLLICMGEAMRTIS 106

>sp|P46284|S17P_CHLRE Sedoheptulose-1,7-bisphosphatase, chloroplast precursor
            (Sedoheptulose-bisphosphatase) (SBPASE) (SED(1,7)P2ASE)
            gi|7484398|pir||T08128 probable
            sedoheptulose-bisphosphatase (EC 3.1.3.37) precursor -
            Chlamydomonas reinhardtii gi|515618|emb|CAA52439.1|
            sedoheptulose-bisphosphatase [Chlamydomonas reinhardtii]
          Length = 389

 Score =  430 bits (1105), Expect = e-119
 Identities = 211/232 (90%), Positives = 214/232 (91%)
 Frame = +1

Query: 478  PSPWTWAGRASAWPSTPWHGSSIVDTNFAVGTIFGVWPGDKLTNITGREQVAAGMGIYGP 657
            P P    G        P  GSS  DTNFAVGTIFGVWPGDKLTNITGREQVAAGMGIYGP
Sbjct: 158  PEPVDMGGEGFCVAFDPLDGSSSSDTNFAVGTIFGVWPGDKLTNITGREQVAAGMGIYGP 217

Query: 658  RTVFCIALKDAPGCHEFLLMDDGKWMHVKETTHIGEGKMFAPGNLRATFDNPAYERLINF 837
            RTVFCIALKDAPGCHEFLLMDDGKWMHVKETTHIGEGKMFAPGNLRATFDNPAYERLINF
Sbjct: 218  RTVFCIALKDAPGCHEFLLMDDGKWMHVKETTHIGEGKMFAPGNLRATFDNPAYERLINF 277

Query: 838  YLGEKYTLRYTGGMVPDVFQIIVKEKGVFTNVTSPTTKAKLRILFEVAPLALLIEKAGGA 1017
            YLGEKYTLRYTGG+VPD+FQIIVKEKGVFTN+TSPTTKAKLRILFEVAPLALLIEKAGGA
Sbjct: 278  YLGEKYTLRYTGGIVPDLFQIIVKEKGVFTNLTSPTTKAKLRILFEVAPLALLIEKAGGA 337

Query: 1018 SSCDGKAVSALDIPILVCDQRTQICYGSIGEVRRFEEYMYGTSPRFSEKVAA 1173
            SSCDGKAVSALDIPILVCDQRTQICYGSIGEVRRFEEYMYGTSPRFSEKV A
Sbjct: 338  SSCDGKAVSALDIPILVCDQRTQICYGSIGEVRRFEEYMYGTSPRFSEKVVA 389

 Score =  151 bits (382), Expect = 3e-35
 Identities = 98/181 (54%), Positives = 105/181 (57%), Gaps = 5/181 (2%)
 Frame = +3

Query: 3   AAMMMRQKCCRC--HRRRCAARLCAPKMGRAATAPGCRRLGERFGLQGCRCDRSREALDP 176
           AAMMMRQK        RR A    APKMGRAATAP           +G     +R     
Sbjct: 2   AAMMMRQKVAGAIAGERRSAV---APKMGRAATAPVVVASANASAFKGAAVT-ARVKAST 57

Query: 177 RCPCAVSPHWPF*PRPR---SATAWLSSWSRPPPTRSCAS***AWLRPPAPSPHKVRTAS 347
           R     S       + +   S   +L   +  P  R       +         HKVRTAS
Sbjct: 58  RAARVQSRRTAVLTQAKIGDSLAEFLVEATPDPKLRHVMM---SMAEATRTIAHKVRTAS 114

Query: 348 CAGTACVNSFGDEQLAVDMVADKLLFEALKYSHVCKLACSEEVPEPVDMGGEGFCVAFDP 527
           CAGTACVNSFGDEQLAVDMVADKLLFEALKYSHVCKLACSEEVPEPVDMGGEGFCVAFDP
Sbjct: 115 CAGTACVNSFGDEQLAVDMVADKLLFEALKYSHVCKLACSEEVPEPVDMGGEGFCVAFDP 174

Query: 528 L 530
           L
Sbjct: 175 L 175

 Score = 74.7 bits (182), Expect(2) = 4e-28
 Identities = 38/40 (95%), Positives = 39/40 (97%)
 Frame = +2

Query: 206 AVLTQAKIGDSLAEFLVEATPDPKLRQLMMSMAEATRTIA 325
           AVLTQAKIGDSLAEFLVEATPDPKLR +MMSMAEATRTIA
Sbjct: 68  AVLTQAKIGDSLAEFLVEATPDPKLRHVMMSMAEATRTIA 107

 Score = 74.3 bits (181), Expect(2) = 4e-28
 Identities = 43/61 (70%), Positives = 46/61 (74%)
 Frame = +1

Query: 22  RSVAGAIAGDAPLGCVPPRWAAPRPPPVVVASANASAFKGAAVTARVKRSTRAARVQSRR 201
           + VAGAIAG+     V P+       PVVVASANASAFKGAAVTARVK STRAARVQSRR
Sbjct: 8   QKVAGAIAGERR-SAVAPKMGRAATAPVVVASANASAFKGAAVTARVKASTRAARVQSRR 66

Query: 202 T 204
           T
Sbjct: 67  T 67

>gb|AAK96860.1| sedoheptulose-bisphosphatase precursor [Arabidopsis thaliana]
            gi|22136118|gb|AAM91137.1| sedoheptulose-bisphosphatase
            precursor [Arabidopsis thaliana]
          Length = 393

 Score =  303 bits (775), Expect(3) = e-117
 Identities = 151/207 (72%), Positives = 169/207 (80%)
 Frame = +1

Query: 526  PWHGSSIVDTNFAVGTIFGVWPGDKLTNITGREQVAAGMGIYGPRTVFCIALKDAPGCHE 705
            P  GSSIVDTNF VGTIFGVWPGDKLT ITG +QVAA MGIYGPRT + +A+K  PG HE
Sbjct: 178  PLDGSSIVDTNFTVGTIFGVWPGDKLTGITGGDQVAAAMGIYGPRTTYVLAVKGFPGTHE 237

Query: 706  FLLMDDGKWMHVKETTHIGEGKMFAPGNLRATFDNPAYERLINFYLGEKYTLRYTGGMVP 885
            FLL+D+GKW HVKETT I EGKMF+PGNLRATFDN  Y +LI++Y+ EKYTLRYTGGMVP
Sbjct: 238  FLLLDEGKWQHVKETTEIAEGKMFSPGNLRATFDNSEYSKLIDYYVKEKYTLRYTGGMVP 297

Query: 886  DVFQIIVKEKGVFTNVTSPTTKAKLRILFEVAPLALLIEKAGGASSCDGKAVSALDIPIL 1065
            DV QIIVKEKG+FTNVTSPT KAKLR+LFEVAPL LLIE AGG SS   K+V  LD  I+
Sbjct: 298  DVNQIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGLLIENAGGFSSDGHKSV--LDKTII 355

Query: 1066 VCDQRTQICYGSIGEVRRFEEYMYGTS 1146
              D RTQ+ YGS  E+ RFEE +YGTS
Sbjct: 356  NLDDRTQVAYGSKNEIIRFEETLYGTS 382

 Score =  117 bits (294), Expect(3) = e-117
 Identities = 59/70 (84%), Positives = 61/70 (86%), Gaps = 3/70 (4%)
 Frame = +3

Query: 330 KVRTASCAGTACVNSFGDEQLAVDMVADKLLFEALKYSHVCKLACSEEVPEPVDMGGE-- 503
           KVRTASC GTACVNSFGDEQLAVDM+ADKLLFEAL+YSHVCK ACSEEVPE  DMGG   
Sbjct: 110 KVRTASCGGTACVNSFGDEQLAVDMLADKLLFEALRYSHVCKYACSEEVPELQDMGGPVE 169

Query: 504 -GFCVAFDPL 530
            GF VAFDPL
Sbjct: 170 GGFSVAFDPL 179

 Score = 47.4 bits (111), Expect(3) = e-117
 Identities = 23/40 (57%), Positives = 29/40 (72%)
 Frame = +2

Query: 206 AVLTQAKIGDSLAEFLVEATPDPKLRQLMMSMAEATRTIA 325
           + +T+ +IG SL EFL +ATPD  LR L+M M EA RTIA
Sbjct: 69  STVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIA 108

>ref|NP_191139.1| sedoheptulose-bisphosphatase precursor [Arabidopsis thaliana]
            gi|1173345|sp|P46283|S17P_ARATH
            Sedoheptulose-1,7-bisphosphatase, chloroplast precursor
            (Sedoheptulose-bisphosphatase) (SBPASE) (SED(1,7)P2ASE)
            gi|1076403|pir||S51838 sedoheptulose-bisphosphatase (EC
            3.1.3.37) precursor - Arabidopsis thaliana
            gi|786466|gb|AAB33001.1|
            sedoheptulose-1,7-bisphosphatase; SBPase [Arabidopsis
            thaliana] gi|7263568|emb|CAB81605.1|
            sedoheptulose-bisphosphatase precursor [Arabidopsis
            thaliana]
          Length = 393

 Score =  303 bits (775), Expect(3) = e-117
 Identities = 151/207 (72%), Positives = 169/207 (80%)
 Frame = +1

Query: 526  PWHGSSIVDTNFAVGTIFGVWPGDKLTNITGREQVAAGMGIYGPRTVFCIALKDAPGCHE 705
            P  GSSIVDTNF VGTIFGVWPGDKLT ITG +QVAA MGIYGPRT + +A+K  PG HE
Sbjct: 178  PLDGSSIVDTNFTVGTIFGVWPGDKLTGITGGDQVAAAMGIYGPRTTYVLAVKGFPGTHE 237

Query: 706  FLLMDDGKWMHVKETTHIGEGKMFAPGNLRATFDNPAYERLINFYLGEKYTLRYTGGMVP 885
            FLL+D+GKW HVKETT I EGKMF+PGNLRATFDN  Y +LI++Y+ EKYTLRYTGGMVP
Sbjct: 238  FLLLDEGKWQHVKETTEIAEGKMFSPGNLRATFDNSEYSKLIDYYVKEKYTLRYTGGMVP 297

Query: 886  DVFQIIVKEKGVFTNVTSPTTKAKLRILFEVAPLALLIEKAGGASSCDGKAVSALDIPIL 1065
            DV QIIVKEKG+FTNVTSPT KAKLR+LFEVAPL LLIE AGG SS   K+V  LD  I+
Sbjct: 298  DVNQIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGLLIENAGGFSSDGHKSV--LDKTII 355

Query: 1066 VCDQRTQICYGSIGEVRRFEEYMYGTS 1146
              D RTQ+ YGS  E+ RFEE +YGTS
Sbjct: 356  NLDDRTQVAYGSKNEIIRFEETLYGTS 382

 Score =  117 bits (293), Expect(3) = e-117
 Identities = 59/70 (84%), Positives = 61/70 (86%), Gaps = 3/70 (4%)
 Frame = +3

Query: 330 KVRTASCAGTACVNSFGDEQLAVDMVADKLLFEALKYSHVCKLACSEEVPEPVDMGGE-- 503
           KVRTASC GTACVNSFGDEQLAVDM+ADKLLFEAL+YSHVCK ACSEEVPE  DMGG   
Sbjct: 110 KVRTASCGGTACVNSFGDEQLAVDMLADKLLFEALQYSHVCKYACSEEVPELQDMGGPVE 169

Query: 504 -GFCVAFDPL 530
            GF VAFDPL
Sbjct: 170 GGFSVAFDPL 179

 Score = 47.4 bits (111), Expect(3) = e-117
 Identities = 23/40 (57%), Positives = 29/40 (72%)
 Frame = +2

Query: 206 AVLTQAKIGDSLAEFLVEATPDPKLRQLMMSMAEATRTIA 325
           + +T+ +IG SL EFL +ATPD  LR L+M M EA RTIA
Sbjct: 69  STVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIA 108



EST assemble image


clone accession position
1 HC082c11_r AV638129 1 210
2 HC046h11_r AV635487 7 583
3 HC066d12_r AV636944 73 532
4 HC091f10_r AV638854 74 495
5 LC097g09_r AV625784 74 504
6 MX009a10_r BP086448 76 482
7 HC029g04_r AV634139 79 592
8 HCL089g06_r AV644510 79 561
9 HC036c11_r AV634673 80 224
10 HC008f08_r AV632472 80 595
11 CM055f02_r AV390242 80 716
12 MX014d09_r BP086689 80 347
13 LC065e07_r AV623551 80 584
14 MX005c02_r BP086258 80 501
15 CM043c09_r AV389471 81 356
16 LC058e06_r AV623071 82 615
17 HC023d06_r AV633642 82 545
18 MX007e11_r BP086378 82 514
19 HC040b04_r AV634958 82 547
20 HC034c08_r AV634505 82 554
21 HC076c10_r AV637691 82 552
22 HC072e10_r AV637390 82 539
23 MX209a10_r BP089521 82 399
24 MX219b08_r BP090126 82 422
25 CM050e03_r AV389759 82 465
26 MXL060g02_r BP096559 82 491
27 HC043a08_r AV635187 82 499
28 HC007g03_r AV632399 82 588
29 HCL029d04_r AV641182 82 589
30 HCL006h03_r AV639899 82 588
31 LC079e09_r AV624571 82 604
32 HC074h05_r AV637572 83 661
33 MX236a10_r BP091255 84 398
34 HC013e03_r AV632854 85 600
35 MX218f12_r BP090094 85 420
36 HCL033e05_r AV641432 85 492
37 HC082b10_r AV638119 85 534
38 HC057b12_r AV636264 86 545
39 MXL087d12_r BP098117 86 476
40 HCL072b04_r AV643575 86 570
41 CM032f08_r AV388534 88 488
42 HC094c01_r AV639037 88 541
43 MXL039h10_r BP095323 88 577
44 MX242d12_r BP091670 90 478
45 HCL026g08_r AV641047 90 598
46 CL35h10_r AV395087 90 654
47 CM067f06_r AV390936 90 725
48 HC063a06_r AV636694 90 565
49 CM043f05_r AV389468 90 284
50 HCL055f12_r AV642668 90 591
51 HCL094f03_r AV644847 90 495
52 HC056f07_r AV636219 98 567
53 CM028a09_r AV387719 105 743
54 HC034e12_r AV634527 128 692
55 MX233e07_r BP091083 173 577
56 MX003g10_r BP086196 202 629
57 HC040b09_r AV634963 221 756
58 LC063b04_r AV623393 221 744
59 HC014b02_r AV632899 222 717
60 MX034b01_r BP087418 244 622
61 MX064f06_r BP088601 244 577
62 MXL097c09_r BP098679 244 353
63 HC070g06_r AV637259 290 852
64 HC034f02_r AV634529 302 802
65 HC006h05_r AV632335 322 856
66 HC075g03_r AV637643 334 879
67 HC091c01_r AV638817 337 769
68 CM019a08_r AV387329 343 939
69 MX223f09_r BP090419 354 861
70 HC047b07_r AV635503 367 852
71 MX205h12_r BP089369 381 826
72 HC029d01_r AV634104 382 680
73 HC045f10_r AV635382 398 856
74 HCL042a10_r AV641895 408 939
75 CM087f05_r AV392445 410 929
76 HC037a06_r AV634724 416 879
77 HC053h12_r AV636007 416 618
78 MX202g05_r BP089202 433 838
79 MX052f09_r BP088142 433 784
80 HC071f12_r AV637328 442 893
81 HC012h07_r AV632811 454 943
82 HC074d05_r AV637539 460 966
83 HC012c10_r AV632765 464 941
84 HC087d07_r AV638521 470 980
85 MXL090g01_r BP098277 484 968
86 MX025f11_r BP087113 496 867
87 MX221g11_r BP090306 499 914
88 HC082c05_r AV638125 499 1037
89 MX039e12_r BP087629 519 974
90 HC029b11_r AV634095 519 1045
91 MX026h10_r BP087159 523 1039
92 MX023a09_r BP087022 523 1011
93 MX025b02_r BP087098 523 906
94 HC080c04_r AV637983 541 985
95 MXL046h04_r BP095751 562 1109
96 HC068a04_r AV637050 569 1031
97 HC074a01_r AV637507 600 1038
98 MX007f01_r BP086379 602 995
99 HC023f05_r AV633658 608 1108
100 HC055d12_r AV636123 610 1214
101 MX023b03_r BP087024 611 1091
102 MX042f03_r BP087739 611 1075
103 HC086g12_r AV638474 627 1131
104 HC095f07_r AV639153 632 1064
105 HC050f01_r AV635762 640 1121
106 HC062g06_r AV636681 644 1075
107 HC081b06_r AV638045 669 1108
108 MX036d06_r BP087524 697 1084
109 HC097d04_r AV639284 699 1014
110 HC022e07_r AV633578 735 1212
111 CM084g05_r AV392633 787 1125
112 MX003d04_r BP086176 800 1107
113 MXL059a07_r BP096455 828 1295
114 HC056e01_r AV636203 838 1336
115 HC097h07_r AV639324 848 1339
116 MX103b08_r BP088961 848 1244
117 CM027a08_r AV387616 849 1415
118 HC027c12_r AV633951 1222 1720
119 HCL045h05_r AV642117 1224 1479
120 HC007g10_r AV632405 1225 1730
121 HC011d04_r AV632689 1257 1722
122 HC062c10_r AV636645 1265 1724
123 CM051d06_r AV389872 1272 1730
124 CL54h07_r AV396152 1275 1727
125 HC069a03_r AV637119 1285 1723
126 HC052e02_r AV635903 1292 1708
127 HC098c03_r AV639349 1334 1731
128 MX229g01_r BP090829 1433 1730




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research