KCC000505A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000505A_C01 KCC000505A_c01
CTAACACTGCACTAGGTATAATACTTGACGCTGTGTTACGCAACTCGTCTCGCTTCAGCT
GTAGTCTTCTGCTTGCTGCACCTGTAACTAGCCCTATACCTGCACGCTTTGTGAGAAGGA
TGCAGCTGCTAAACCGTCAGGCGGGTCGCCAGACAGCGCGCAATGCAGCGGCGAGCAAGC
GGGCCGCTCGCGCCCCCGCCCGCGCGAGCCGGAGCGCCGCTGTGCATGTCCGCGCCGTGG
CTGCGCCGGTAGCGCCGACCACCACCACCACCGGCGACGACATGCCGTACCGCATGAGCG
ATGTGGTCATGTGGAGTGAGAGCAAGCGCATCCAGACGCAGGTGCTGCCTGTTGCCGAGG
ACACCATCACCATCCGCTCCCTGGACTGGGACCGCGACCGCTTCGACATCGAGTTCGGCC
TGGAGAACGGCACCACCTACAACGCCTACCTCATCTATGGCGCTGACAAGACGGCCCTGG
TGGACGCCTCCCACGAGAAGTTCCACAACCTGTTCTTGGAGGCGCTGCAGAAGGAGCTCC
AGGCCGCGGGCCGCAGCCTGGACTACGTGTTCGTATCGCACACGGAGCCGGACCACT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000505A_C01 KCC000505A_c01
         (597 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_442413.1| flavoprotein [Synechocystis sp. PCC 6803] gi|21...   115  6e-25
ref|ZP_00111402.1| COG0426: Uncharacterized flavoproteins [Nosto...   111  9e-24
ref|ZP_00105671.1| COG1853: Conserved protein/domain typically a...   110  1e-23
ref|NP_924721.1| probable flavoprotein [Gloeobacter violaceus] g...   108  4e-23
ref|NP_484222.1| flavoprotein [Nostoc sp. PCC 7120] gi|29336850|...   108  4e-23

>ref|NP_442413.1| flavoprotein [Synechocystis sp. PCC 6803]
           gi|21362458|sp|Q55393|DFA1_SYNY3 Diflavin flavoprotein A
           1 (SsATF573) (NADH:oxygen oxidoreductase)
           gi|7448603|pir||S75748 flavoprotein, 63.5K -
           Synechocystis sp. (strain PCC 6803)
           gi|1001242|dbj|BAA10483.1| flavoprotein [Synechocystis
           sp. PCC 6803]
          Length = 573

 Score =  115 bits (287), Expect = 6e-25
 Identities = 57/91 (62%), Positives = 70/91 (76%)
 Frame = +3

Query: 324 KRIQTQVLPVAEDTITIRSLDWDRDRFDIEFGLENGTTYNAYLIYGADKTALVDASHEKF 503
           KR+ TQ   +A++   IRSLDWDRDRFDIEFGL+NGTTYN+YLI  ADK ALVD+SHEKF
Sbjct: 10  KRLSTQTEAIAKNITAIRSLDWDRDRFDIEFGLQNGTTYNSYLIQ-ADKVALVDSSHEKF 68

Query: 504 HNLFLEALQKELQAAGRSLDYVFVSHTEPDH 596
             L+L+ LQ  +    + +DY+ VSHTEPDH
Sbjct: 69  RQLYLDLLQGLIDP--QRIDYLIVSHTEPDH 97

>ref|ZP_00111402.1| COG0426: Uncharacterized flavoproteins [Nostoc punctiforme]
          Length = 572

 Score =  111 bits (277), Expect = 9e-24
 Identities = 52/90 (57%), Positives = 70/90 (77%)
 Frame = +3

Query: 327 RIQTQVLPVAEDTITIRSLDWDRDRFDIEFGLENGTTYNAYLIYGADKTALVDASHEKFH 506
           R+  Q + +A +T  IRSLDWDRDRFDIEFGL+NGTTYN+YLI G ++T L+D SH+KF 
Sbjct: 11  RLTIQTVEIAPNTTAIRSLDWDRDRFDIEFGLQNGTTYNSYLIRG-EQTVLIDTSHQKFR 69

Query: 507 NLFLEALQKELQAAGRSLDYVFVSHTEPDH 596
           +L+LE L+  +    +++DY+ VSHTEPDH
Sbjct: 70  DLYLETLKGLVNP--KTIDYIIVSHTEPDH 97

>ref|ZP_00105671.1| COG1853: Conserved protein/domain typically associated with
           flavoprotein oxygenases, DIM6/NTAB family [Nostoc
           punctiforme]
          Length = 574

 Score =  110 bits (276), Expect = 1e-23
 Identities = 52/91 (57%), Positives = 69/91 (75%)
 Frame = +3

Query: 324 KRIQTQVLPVAEDTITIRSLDWDRDRFDIEFGLENGTTYNAYLIYGADKTALVDASHEKF 503
           KR+  Q + +A++T  IRSLDWDRDRFDIEFGL+NGTTYN++LI G ++TALVD SHEKF
Sbjct: 10  KRLTIQTVEIAQETTAIRSLDWDRDRFDIEFGLQNGTTYNSFLIRG-EQTALVDTSHEKF 68

Query: 504 HNLFLEALQKELQAAGRSLDYVFVSHTEPDH 596
             L+ + L   ++     +DY+ +SHTEPDH
Sbjct: 69  RQLYFDTLTGLIKPT--EIDYLIISHTEPDH 97

>ref|NP_924721.1| probable flavoprotein [Gloeobacter violaceus]
           gi|35212341|dbj|BAC89716.1| glr1775 [Gloeobacter
           violaceus]
          Length = 584

 Score =  108 bits (271), Expect = 4e-23
 Identities = 52/91 (57%), Positives = 69/91 (75%)
 Frame = +3

Query: 324 KRIQTQVLPVAEDTITIRSLDWDRDRFDIEFGLENGTTYNAYLIYGADKTALVDASHEKF 503
           KR+  Q   VA +T+ +R LDWDRDRFDIEFGL+NGTTYN+YLI G ++ ALVD SHEKF
Sbjct: 7   KRLTVQSGAVAPETVAMRCLDWDRDRFDIEFGLQNGTTYNSYLIEG-EQVALVDTSHEKF 65

Query: 504 HNLFLEALQKELQAAGRSLDYVFVSHTEPDH 596
            +L+L+ L+  +    + +DY+ +SHTEPDH
Sbjct: 66  RSLYLDLLKGHIDP--KRIDYLVISHTEPDH 94

>ref|NP_484222.1| flavoprotein [Nostoc sp. PCC 7120] gi|29336850|sp|Q8Z0C0|DFA2_ANASP
           Putative diflavin flavoprotein A 2
           gi|25319127|pir||AB1829 flavoprotein [imported] - Nostoc
           sp. (strain PCC 7120) gi|17135156|dbj|BAB77702.1|
           flavoprotein [Nostoc sp. PCC 7120]
          Length = 579

 Score =  108 bits (271), Expect = 4e-23
 Identities = 51/90 (56%), Positives = 68/90 (74%)
 Frame = +3

Query: 327 RIQTQVLPVAEDTITIRSLDWDRDRFDIEFGLENGTTYNAYLIYGADKTALVDASHEKFH 506
           R+  + + +A +T  IR LDWDRDRFDIEFGL+NGTTYN+YLI G ++T LVD SH+KF 
Sbjct: 18  RLTVETVEIAPNTTAIRCLDWDRDRFDIEFGLQNGTTYNSYLIRG-EQTVLVDTSHQKFR 76

Query: 507 NLFLEALQKELQAAGRSLDYVFVSHTEPDH 596
            L+LE L+  +    +++DY+ VSHTEPDH
Sbjct: 77  QLYLETLKGLINP--KAIDYIIVSHTEPDH 104



EST assemble image


clone accession position
1 MXL055a03_r BP096232 1 235
2 MXL054e07_r BP096201 1 398
3 LCL088e09_r AV631085 23 196
4 LCL022h09_r AV627221 23 415
5 LCL090e07_r AV631225 23 459
6 LCL051f02_r AV629078 23 467
7 LCL015h08_r AV626816 23 488
8 LCL045e02_r AV628674 23 289
9 LCL047f01_r AV628821 23 394
10 LCL045d11_r AV628671 23 489
11 LCL094c06_r AV631452 24 330
12 HCL041e12_r AV641867 24 488
13 LCL067b11_r AV629835 24 506
14 LCL015h06_r AV626814 24 466
15 LCL019g06_r AV627011 24 517
16 LCL096e01_r AV631581 24 577
17 LCL093b02_r AV631389 24 459
18 LCL097e05_r AV631646 24 159
19 LCL021f11_r AV627136 24 277
20 LCL012f09_r AV626633 25 503
21 LCL096h05_r AV631607 31 562
22 HCL047a04_r AV642181 31 458
23 LCL055a09_r AV629238 33 565
24 CL35h01_r AV395057 35 527
25 LCL010b01_r AV626492 39 488
26 MXL076b06_r BP097464 39 155
27 LCL022a04_r AV627158 39 339
28 LCL048c10_r AV628875 39 373
29 LCL052f06_r AV629125 44 506
30 LCL001g08_r AV626056 48 582
31 LCL096a08_r AV631548 94 259
32 LCL081f09_r AV630620 100 393
33 LCL049d04_r AV628946 312 597




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research