KCC000453A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000453A_C01 KCC000453A_c01
gcttacgtattgttataCACATATAATCGTCTGAGCAAGTCTCCAGACCAGGTGCCGCTC
TGTGCAAACGCTTTTCCAGCATCTATTGTCGTTTTAATCCTGCTCCCGACATCCTCCCCC
TTTTGTGAGCAAGCAAAGCAAATTGGGACTTTCTGGAGCACGCTGTACTCGAGGATTGTG
TGAATTACCAGTTCAAATGGCTTTCCGCGCGGAGCCTTCGTTTCTTTAGGACGTGAATGC
CCAACCAGAGTAGGACCGCACCCCCTGTCAACCCTATGGCTGCTACCTGCAACGGCTTTG
TAAGATTCAGAGCACAACAACCACGATTACGACAACAGTAATCCGCCTCGAGCCGTGAAC
TACGACCTTTAACCGCAGCACGCGAGCCCGTCGCCCCTGCTTCAGGACACGACCTCCTCT
TGGCTTAGCGCCCTAGCACCTTAGGTTACTGCACATACAGCGCAGCGCAATGGCGCATTA
TCACGGCAAGCACAGCAAGGGCATGCACCACCTGTCTGCCCACAACCACGACGCCCATGG
CTGGGTGGAGGGCATCACCAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000453A_C01 KCC000453A_c01
         (561 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAF88022.1|AF264698_1 NDR1/HIN1-Like protein 2 [Arabidopsis t...    28  0.43
ref|NP_566395.1| harpin-induced protein family (NDR1/HIN1-Like p...    28  0.43
ref|NP_733239.1| CG4976-PA [Drosophila melanogaster] gi|26080443...    34  1.2
gb|AAM48433.1| RE61305p [Drosophila melanogaster]                      34  1.2
emb|CAD70525.1| hypothetical protein [Neurospora crassa]               34  1.2

>gb|AAF88022.1|AF264698_1 NDR1/HIN1-Like protein 2 [Arabidopsis thaliana]
          Length = 240

 Score = 27.7 bits (60), Expect(2) = 0.43
 Identities = 12/35 (34%), Positives = 15/35 (42%)
 Frame = -2

Query: 551 PPPSHGRRGCGQTGGACPCCACRDNAPLRCAVCAV 447
           PPP    R     G  C C +C  +  LRC  C +
Sbjct: 18  PPPPKAHRSYNSPGFGCCCFSCLGSC-LRCCGCCI 51

 Score = 26.9 bits (58), Expect(2) = 0.43
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = -3

Query: 337 CCRNRGCCALNLTKPLQVAAIGLTG-GAVLLWLGIHVLKKRRLRAESHLN 191
           C R  GCC L+L   + +A   + G  A++LWL       +   A+++LN
Sbjct: 43  CLRCCGCCILSLICNILIAVAVILGVAALILWLIFRPNAVKFYVADANLN 92

>ref|NP_566395.1| harpin-induced protein family (NDR1/HIN1-Like protein 2)
           [Arabidopsis thaliana]
           gi|6041818|gb|AAF02133.1|AC009918_5 unknown protein
           [Arabidopsis thaliana]
          Length = 240

 Score = 27.7 bits (60), Expect(2) = 0.43
 Identities = 12/35 (34%), Positives = 15/35 (42%)
 Frame = -2

Query: 551 PPPSHGRRGCGQTGGACPCCACRDNAPLRCAVCAV 447
           PPP    R     G  C C +C  +  LRC  C +
Sbjct: 18  PPPPKAHRSYNSPGFGCCCFSCLGSC-LRCCGCCI 51

 Score = 26.9 bits (58), Expect(2) = 0.43
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = -3

Query: 337 CCRNRGCCALNLTKPLQVAAIGLTG-GAVLLWLGIHVLKKRRLRAESHLN 191
           C R  GCC L+L   + +A   + G  A++LWL       +   A+++LN
Sbjct: 43  CLRCCGCCILSLICNILIAVAVILGVAALILWLIFRPNAVKFYVADANLN 92

>ref|NP_733239.1| CG4976-PA [Drosophila melanogaster] gi|26080443|ref|NP_651598.1|
           CG4976 gene product [Drosophila melanogaster]
           gi|29427833|sp|Q8MT36|MES4_DROME Potential histone
           methyltransferase Mes-4 (Maternal-effect sterile 4)
           gi|23172478|gb|AAF56762.2| CG4976-PA [Drosophila
           melanogaster]
          Length = 1427

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 19/49 (38%), Positives = 25/49 (50%), Gaps = 6/49 (12%)
 Frame = -2

Query: 236 SRPKETKAPRGKPFELVIHTILE------YSVLQKVPICFACSQKGEDV 108
           S P +TK P  +P E VI  IL+      +  L + PIC  C Q G D+
Sbjct: 742 SEPPKTKKPVNRPIEEVIEDILQLDSKYLFRGLSREPICKYCYQAGSDL 790

>gb|AAM48433.1| RE61305p [Drosophila melanogaster]
          Length = 1016

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 19/49 (38%), Positives = 25/49 (50%), Gaps = 6/49 (12%)
 Frame = -2

Query: 236 SRPKETKAPRGKPFELVIHTILE------YSVLQKVPICFACSQKGEDV 108
           S P +TK P  +P E VI  IL+      +  L + PIC  C Q G D+
Sbjct: 331 SEPPKTKKPVNRPIEEVIEDILQLDSKYLFRGLSREPICKYCYQAGSDL 379

>emb|CAD70525.1| hypothetical protein [Neurospora crassa]
          Length = 550

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 3/80 (3%)
 Frame = +2

Query: 305 IQSTTTTITTTVIRLEP*TTTFNRSTRARRPCFRTRPPLGLAP*HLRL---LHIQRSAMA 475
           I STTTT +T+ ++  P    F R         R+   L   P  LRL   L++   A+ 
Sbjct: 109 ISSTTTTTSTSDLKPNPKPKAFLRLLHIPHSPHRSSSLLIPPPLLLRLFCLLNLDPHAL- 167

Query: 476 HYHGKHSKGMHHLSAHNHDA 535
           + H  H+ G H L+ HNH +
Sbjct: 168 YLHHTHTPGFHVLNCHNHSS 187



EST assemble image


clone accession position
1 LCL086c06_r AV630915 1 395
2 CL31a11_r AV395031 18 485
3 MXL015c11_r BP093900 28 365
4 LCL029b05_r AV627592 36 562
5 LCL092f11_r AV631365 40 478
6 LCL070c09_r AV629975 57 503




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research